gnuchess-4.0.pl70/ 40755 21542 13 0 5567302531 12704 5ustar cracraftusergnuchess-4.0.pl70/INSTALL100644 21542 13 4134 5563712436 14041 0ustar cracraftuserTo install gnuchess. NOTE--- If you have the binary book from an old release it must be rebuilt for this release. The following files are available: gnuchess-4.0p69.tar.gz - source files for gnuchess patch level 69 These files are now split from the source distribution and the version numbers will be updated when they are changed. gnuchess.book-1.0.tar.gz - source file for the opening book gnuchess.test-1.0.tar.gz - source files for the gnuchess test suite Tar will greate directory gnuchess-4.0 tar xzv gnuchess-4.0p69.tar.gz optionally: tar xzv gnuchess.book-1.0.tar.gz tar xzv gnuchess.test-1.0.tar.gz You need to know: BINDIR where will the binaries be stored LIBDIR where will the book and message file be stored What language and notation you want to use. (Current choices are english, swedish or german.) What size book you want gnuchess to have. (Current choices are tiny, small, medium, large, huge.) Edit the Makefile setting: BINDIR (Default is .) LIBDIR (Default is .) BOOKTYPE (Default is small) The default language and notation is determined by the order of misc/gnuchess.lang. The default language and notation is taken from the first line in the file. If the line is : 001:eng:{ pnbrqk} the default is english. If it is: 001:ger:{ bsltdk} the default is german. In any case the other language and notation can be used by specifying -L [ger|eng] on the command line. New languages can easily be added by making new gnuchess.lang entries for the language. If you make a new language set please send it on to me. ***** If you are not using gcc select the CC define in the Makefile for your c compiler ***** Machine Specific Changes to Makefile Default Makefile is for SunOS/gcc for other systems: Solaris2: Change LIBS and CFLAGS HPUX: CFLAGS must be selected from the list in the Makefile DEC: IRIX: MAKELOG.HP is a LOG file from the make I did on HPUX here. mike Now the Makefile is edited just type make and it will compile everything, or "make executable-name" and it will compile just that executable. Then type "make install" and it will make the book and install the executables. gnuchess-4.0.pl70/book/ 40755 21542 13 0 5563714077 13646 5ustar cracraftusergnuchess-4.0.pl70/book/gnuchess.bk1.z100644 21542 13 2670147 5527661732 16531 0ustar cracraftuserQ-Խۖ#Ǖ$>_~iLqzH@B"OeV\<"Ja}mfTq{Ru3pbfۺլ3ԳA9A | z?hƃb:(&/60#l0ov893?,Dt˼lWĖyu, oNNjkghjי `s\۟vBؒoB=F.x_Õx 7Nx vM9j} =d`E\pY-뜏7f%ӘSOt|UvulvA6]і3jֹOln |v#wK#Gr4[Ob$Xgǒ iC=9%v2_|*P'71f 'ṿf\ֲWǢsY6Z1u3k`2r0cJ˗=Bc-VkU{ؖƲF+Χxlk/ Ļӥ`~)/2k kdot UkOv`j۞}m=VT%N̠0>RKڕ+oڠ~N&6Ϲ]gSq̟oZYx<c9vC^܁jnj+k(`EҪ>o4\ӣѲZ3gP1 g}@c`ф~XP/]ڦ9Ol3I' Mp&l<zl' Ls~HsώGx9?T{=`1hegĻ|~L9^=ف'~@\#@zUj>a|^]Gj>boH S[͋^ h% G$iZMn8~]Ɯe>5iAmJ ١zpj׃w_ξ~}s&;=%Fryj[*2gqJ6,m7tk_d#Ո!l=ߑsކ/l0)|?~߽y U;/į)%bx9YE66*ߓŜgpgddnn gw~9'`0e֋Gj= cOfbK jSy),?բ3DGf90We8ݵhgd{}/4w7&3;L4稔[, |0#mdYSBy򶋙\fgn)û,g2 Mh|>?gp.O&y'O{ug}UeNod; ʬ=&y l)*rX!G'FZovowݯh_ b /T%;*7IE;aG[uY a-V-&kB*LvP i6c,63<2bq!b2˫M.G  -My n SCLgo޵YݯoYv;GmX.KfNTʼnnJ\^Yc|kս{pNq`"}*vw.ޱ>7?Y , ^[B֗U:u\~\x2QMaQ_"I3GYuc5vn{NCYx_Ok&guAy4'g/r׈*`YVʱb֬$s9m^4]Jnw!>O='>F,.jt]aXf.fV0;ڝ0GDfi=[,\8]'=(~ &~.¥}6|[0HeDžĽ{ )I\[X *fĈ.2wqQӿz<1Okn^tq# SʭkG @ٛ?b.OhS\Wv0ou_޲͸ W?\uN󰻽zuτ@u2&=uنPtY a՘86$fiYa9"?EGA= dʐ08;x?/D,*CB-]m0'py,]mnG̰6Mp^s%gg<A (o MWC{Y̔V* `3x-Œ'قbQ " 0v^^=9z}iod&0X[1͌H}U3t\ܔMĒVFjqoKWi ;, l@(9:$tkC[51?p32B ra%y lq!'q/qn{?f-&[y o;iP2/`O T^S1}%[2{${9bUl`g[C[mkN+9|Mv7s4X5u6}5ϝm.מYna1l9#ӑ°l2ۧ0Sguwڻa6PŴf΄q3Gzpx3Ǒ_i']?o߅]]E'N`!q4b8v3^IKWn 6-+攪!clV* 1;H0l}[ϿFWg'Tk dVYx,L,OAh/"$E MSvY}C{6 w x^ڿd5D2 nex #E\Sy%j~Ź<2_a΂.KG13EAM^Jϖf۟ovIf˞&63x@?.J\nvoGTs"9Cf1-BɁFʰR 6 &h(F^?jAa/YN#bzrl&fVO_ث6{gGlOG<_c?/aMdr5V*B׵ J}!*7ڡlJT evٿ?ŕ$LvЧض mdl'EYU$1I5>󘗎_˦O[|^0C37Wl] V phmsh$igKVY0K nv+ˇz+ףjpSN ֯B)Xƺ1 Ξ/[RDQIxsrU};Y 5K]kVEk7 gfeՐh ,'cdmq6nf; ͱ|1SJ!Uk63MnM՟wjck1~̊]վGu|lHT1ڈm\V*+R,E[xn2rFg`\8W2n,Ǯas:ħ:-*pI_P {wxW^q9ðȸ(_n~?Bsn}r/=v #%׵ER:cڢl3 FX?^x͒PE[Eiݗ;I ڽeWN\p3ʈ6.Zyv9= Pn*K-VՃF1yI>5ݐas8ذY77$"?Ȭ}RϞT" v ~nB| І0 3Ye2Ɗ~} 7v>n-)IU>Jvnߞgq \ x/2'%oaP1&Ch}xws& w1;devndGz/2Ffۘn dzx;Ls$TƪRx;xS^|yG݆!IJs.ЊY H#I'f]ɷ2LG3[w P:efϳ0O^+SA_$ǎ }Iwׯnnc흳Yta)4u'k@SZ J&@T9$BG=h͇mCnlY4AA4^c Kg0vP!{HF~'RtZ!I&]cL9˞3("&+o1 xW]뿷5=:E+Qz$>V!$B v∴#a6l Ŧ FTw0HHf; G`_=Hv݅3OpW5XuPo ׇ6Իz}>?o'5# 4^ )7sXx.ϕTFƂn!ꐑ`{P i[fv<܂i3,e1d6JFZ,-r S\Kbn)qjof$!0&' ,5` ;Ж_buk+1`*(Fo5`g~i%{!Փ(6HY0HvEerl0}hʨ}fD=x #E@lrVFRͳfld) jl2>=>'6`OD2SYovguo.[,8Jպv* k׍M Ji߁.aedA6)dT)^>|jꤜ*2nfTGPć NU$9;D&#F:bq͑jWo&;<ݿϞE#zF@YP'$Π8ciM8dW E- iKb1mcKäbp"\—5R=AnIFP .IyVЀe$J^,lX:Օf_ cֹ`El]*)S2ojUXh 7eGsPRi(VS\fآFpmZZB׫oAQ&1\ ۍg" , ȁ{aDHS 篮p+X FiŅ2qQ흄 w}Գ3r~Yb[Pvk iȂ9%xv _CuU+f _{o _|U-Qj#E&)j!e|Xwf%̧Q %/"g)݂ ./|qd2-E[䖜j]6-Wޅpc%M< ]\j~}?jo,y8Bxb&hӂp.hV#Yn 4Azo6X EKm~tLB!͏Zk2#< E "n%ŧ]L%UMAgI3_~q@G#8.~BR`$pe3d{-zOs'Ç-g@GN.Íq n$]Ս"T]2 }$UF32*#sX ng%^G"GI.7=Hqw4٥YdəbG-qXӨU19qK{ W_3vuHG{qx0SFkAk~ϙtL@q+|˩$ڟnȷ=: oM"|$LXT!0$, .Osh4$2 )r"0 aD8͸'('l! ֗> Rc3o(_>sd*-Z()Fa׸DLdE6rsU~@4 yOd"M~m0$)".]VɝȘ=9-Gy vv_IO! )doNGMi64 ]Eğc ,?dyV#/M&9r k&=}IbPϧJ7CZ1b LXH&³.5-|4ۓk@:~" i)tU@qQR$ `]pI0 9Gp_,^)3]ڟY]xpmbiORa.)ӵʫ*adYedm5᱔3ۥc_ݛM;?1d.G U}ysKԼ8C"Bׯ&cGz'II82"W=3ܰ-%CET$5S΄FTTh#x% KwCc@j$Sj  -O)1eaT2[h~i(+BZam'tW@CԀwb,o,yy_&mIZ2P@5XrJFܐREς-EZԁL_E(E$ʈFYI7,plQCb޸6eC-,'A#sϡ b,#q3UVȖ1lM݄HBȹb <YEF23!Gz\V,@^RgXRJ) ^M4=KyKRx0V17Ӭ}V>3،JfbDž}ߞrie㊝[&⚁1/ tQua_.dqc"b_biȑĀabbgC$jp' .CP4hj=kus"Xq%'v Dٛ`p1M{/]^6&mHG缮t/WYD1ψ숶vUG!ȹVn:dO|&^E QF{)k&@W*efXĔ:+jA:Qny꥞VV(ƽcdH~"l_=M_1;uo{t*ncxߒ')c=F*$hIҵth晣tg,c艬|>bd&}BՁoU=s҃.Նf,cvs8d{ 6a 5``-7 QeD崨29d~_|켓1PZ(>+>!'+'6%*˙ӵ }l&sAo]Ț"Q=vfRGa+G$ xYO+41bFkQyzHf[+t[z1w3*^YA=]W `Ds`]M%|0 r$@ܪF=*O x³c"F"q:2_BCY7rE ǖ殈-P ġv߂ *)M:ג-Rjw/?XjHlNM uLcfJY@=oHBoT4gKj/] sPC:rV\(x8<=D xI@=~p^^7ٻaJ9'؛nTBQ)weDc+:#{%2ܔL7b˰Ub&.]Hc,ڳnQhwUj*3hDѬr^US8~ f KGҢa`u ;2k5-f̯ (',:*S!&:OD+jz7'ubHC֬$e,JacGO:iTgg D,f.hass@ݹgݛQϜmN^ wL|m"^kRU⻹@oE-HQR=f|5}2z)Uۖ!o&O/0EcLjU`. 0̦Ҁmx dN!|$Xfzԑ${sڮQwl~Ytf367Φ.E.BU-c>ˤjE.z%?Hz]]c󓜚Coy4PP'acF o'zb @f)99LG.0m{:LF4xȣjOKD Yĺp"%QXqGyΔ:g~eIX[=T T@[!*+medS9|H̫]@=`s%5G\.޽k9a|I+dκ*dҗ+5o wE˼T!mgP4s(t4Bpu!K>C 98x:kc2'ѹa}Ie_QET13嬊CtooNHV~rqNϘBN}MCE @-:)(kwَc7I933%}j+Pp&C3%5QU҈spZYSSM`v0Nyg%Z{*qL̨Rt. "b#| h-vS>]qf.-iE p |2,mmL"Fogb6șl++u\zles P;nA/ie׿a{s$#a-g^P&RiA\+D!o mDM\QS\Lz(͉\DFAR"`/:{í30~ pu#} S̅ߪX$}>}¤3zY]VL9K ΂O(!xy6SLt/rT,C 9ō(`[6t7ԓx!,VAmZg<R֤޷) 'P5g!zK}mvjc669yS5!#@=oD ^ lPmk>i⫠ٯH`rXj_ Q}c ) % Y?xi8W>ȎnIHR\p9Oe+2H\pНyB Zc4XR? k2t=&QIWqV(LHe&7'Zw -aVO2ۊ%xjx+8dLs 0ߚȓcmB-Jd{ˮlAwZH9·_K,kc.}<1Ax7b4KqRd7,ڭ`ͨqt>˭YM\.\xG$>qW9AN~ VD!/t'ѭqcAbtMOm-²zt.k-bb)c E.V.8gzޣ' / pn=,gv&x1+T9e| |$ wV1[:0%KFG"b/sZ~rp55cVM$3 6AaB%X~mHz8Sm;Kr 1ol; κXdފ=X$|L ?dr&8ٻ*T's>Nf8kͨ6dEs3' .99=i <hKyW.TX'Wn"_i*{z҅%`<6`%"6,ӯ"QT7{` mPG7[*(?o3ߋՔ=rQ$\`MͼZ4ԕ+M2#.'SL*ћFwpy0XnyJ8*9!5 TIwF @~9e Ȥl)9ɪ?nއk6^JIEJc>WD0(?aw~C>ؚ..(l=7tv:Xs(5b[zUwOs5#缠x912& ި]; fo` m8jz/ Mv{W)_Լj >쏟ỷ3fJC 6=Uef ѷ e7jӁg%GK;tLUFRT9{bl ?|?KMNu97sML#Bgc3L/4aă1dmC4l%P>jhG T!3Şז=?<5^ IUŖ@۝\Q֪]_۫[ؓVl<Eo m ?RΝSr_>."kbYIDa}{ rTZݏjJ˘ȕ'3 qJ;Q](c8kRG'i7 PMM I:S3T5-)$gn{ ˕$N'>0҉K}T`@{UpnI;ޭ8[ (WKzu+lE:^o,sfmN8,!u{ؗ9~ZJx u a7vRc HUl4NtJR`Y4jŨdײ$$H`>d%T)ۂ^v/*ԡNM7~ݔ;8\}qN)ǯF4"dh+ ".ae-걔`uv-&gɔh{!ffd8zڐ%"Be,n̎m3fŒuY[“D Re"g׸vһwI(yN52$ h>jTctv!|,0R' *%XT=)άMPb R5 75sXF[_]}{- ɥ զL3|QmҧW"$xwT Zj~&@HyJw Ho-|2 PӉ32y rawVICkxɚ//Qa3BY$oǎFၴ. EX 6}(@#j(]8fȓ4^Ddj\ YՂPWĚZNu>] mصOc1vǴ{7 ĝ(pfe<`˩rỲ JC=BLRǭ5oBe)Y3Vi`( 7Wd)8lN Kc@[)t[ $&4i.R(PxZiĚ;IӐ)#-} | !GG̏Cw;NqxYDކof7Q1QmS<|_l .0#pޕ^P&0X[i,Y hionNG E:s̋7$,nLJw:ڻ7I6{kl N K#$A3sbDBo&vQZQ" *e] LKݳ3a)1K- s%OӾӳv E!Xur⼀=.IicX\|qa6|e9]4ᎮÙHI[)a.򥕊+ [H#~qlٍu _AvԡG4/Α6`UqTrջ.LuCN'$I'`ZKp7&06$PX;Z58,EbS-*iqlp <]Gba+dojQslCp!:`[fu$b&rgCW[\7+qUd?!a+sAm=QL ;%2d&U$flH8SAPx/=!/ҾDܱM~ 'R|`bxOzٓus P%u Ct??RI5^,YnET&31\1Ƌ^V\ hzTͽ7 '64]9կWh)DZMa"˽/N:bҾPPsmf_½!Px3џAf}ӫRY#rv5Ւt7#P5C։ĥar~wkYBp\x][X:h hipRUL(2ͦ)+R1G0(^AJ[ p&{xYvpwT:8O`/=Lctլ#E-*>B"D LkJo y4xL62#k@i$cNiAF Do1 EP' 'FBKq !ذRRՔek^~8dEgsxUƳZjKTzj.Z36gMX se#z nTzw}}{-3.)&x~,r qq` E.7woX&&8]L<+QtBT.4#T78J_i=;ٌtrOWoj2e; @*!fdO9$/6]\7}h"d']YS>6)t~|S+/Fqsߌ䙻憳AѓJC(zBY4;qSA֣I*׍o$m;g ceі&3>k$?H;.&c\Ө%yO( $y2E>{(ɤ90&Z4}`0RXڤ\eDoa$ `X'p?3yǙ)b\%䌓lpm# pʻ6vBT-VJ?;!TGW$l5\%vkq1tK[4tjzTWIBPTD %9bBsw!&vɘu|ifɅ)fX=>#:,F>T Z-'E=gD1OQ2U[4B|hy-!2V8>dZ4?vq2+m8;c?N(鹌LWuq⣺:!ԋ.b kx;*Y^ PTMELDT3ŦeK$I@2b)D !Sz'\Q2 p+/rzq#K85!.F 2O&c[,\$*-/HZMbC4['rᜍUNK2kAO‚wJNgC-z*]Bl N8XjҼœ:4"M.G=d^<(^: |ƱQkgtP]m4P+zWR~F)z8V"}=~}crIףDpe X(RaO.#!R sQsעq'>@()\HHh?0/!GA#s8fTd1}m=#rL/%(-NHbWT8ڊ,TJ|tvtU"OhV*,7+x2LԡWKѱUT9 $d`(gpt=TB y[&!g&Xv SgmPFy(*N> Vب8HP)Yw9\&$%)/yf΀˘&Q,j8f:o?Gݽ+F-fi=oI" 32v;tn+7`7K& A Oo *s)ʑtCA^,N'M0tBc{Vڜ1JT(;>]AQ{ʁ{rWUЪ3-]$1[BR+I ئ"tqQl ~BE.tl:F;l;RK['wt)e]Е]N=?3 YýOq&eIɏۊP"ξ +QPv0rF  A.¸I3R=tҶqmuIj5;S*H+B~׮{2$Tlφ^:-p`L3=鲻 #⾤; ?˧ ( 'RJb3ϰVS{fJx.iI \DׁvDWydE{PYSy _1ʉ-Pr9I?_445qvD(~}5({3)@F|koKׇ|+xK]9цg^Rؓ,fU&M? ULPX  19[ЋN5ZP8x͸ -!aE+'跰E:l+lE`\]3e{ͦQ˾bO\ݵ5(+%\b?w\zޭc*Muczs9#arrl4D7b,tܜj7BFSh6o:*Rm !Fj]1s͉lReN2⟤߆~"XO' R_wEL53~%2ZEWyY mDذR8Dkp 5{oP{='9OߨWp"!p~"zM}y8tӼ,5596.Uީ\@Sʙ3HK_H#\5 *RҠ87\^Y(DM~5lCҫ,_T;ΥٜFmp(]K7X@?u.Sߣ{Nގ B(hq ED#HXou<"\>) JlZi&?e?6SBҙH;淎+nR̷3fӶZVQY{DŽ=qL'ȓ%F Bp!pHH nqW_'|ib ds*GQ`uUJw!""%Vi$7+a#j `<"d3lri`*BJ/TTCKkVJ 'MȞX#X"Y+LrI"EdBxco"1ְ ,<rj>CV߯;3)J *8`KKlLRuHQl$*n-v0\E" tP Rʡ'k^C2eԍqB)bP՝& n/..S IINsi=g0%d-}UuKW_ .󘂈W$k?I5X4d"z"86 ~tegJB{)'Ĭϐ^M(~_? e9"INj&Q^)Lm]>p*QKl JKh*ֻ.oM]$^JHO17Q֫J$ejA?H*;$vl?f 0Hbi]oBA8 T|{bH1Q--mWxT!kMo3_TO`oD0KBۼOIs)iJgdZ:U Ltٿ?NJuty){rPM-63fmtvV(/ww.Qq"b.J~˓?;=ErL2B:Y fkz/"leԖ"1뒲nkoؤ L% 7~W28Wɣ3BPݗr-:̍W{1%< ۨĻ/$̙'d)֮/x,tN:lxMVd5dѫZlQ/( \n59i>:絀7=`|{Zm2*>|r4:dDAW݈Ba /J()s\D soZEfo}v{bӧHGtzeB/?v*Iݰ( {_񤕱V뙞2UKAw#rЦ#3ܪ[{njUJFD*`_>L>%8/ "=܋A0e&QGQyH ؓB=s]#3IBH n`kE)m羷s{q ĩ@/@MY.!?ҡfʩ׳ ܗ{`3_ {CFЍ QGD i.YC8ʙ3q<,|5S{]w5&k;N~1uWv_hRUKо֥uN޹dw6zwlI 2 X>F1u4e&e1r ?J(<@($ ~|E`,(o ޢ&pkh5!+hST0QjՖegx6<_Y5I@|h4 Wa࠹P(C`i[rf0!okۚ+^P3;.lP8ʹ.ijemsrFI0BV>gf-2'e=7"'CZ,VPԂRՂm "̗9 n'lyB/22 (70ixocPD9f! r#XBK!rl.,{`R41.Κ*1r<PL4 E7-leDUvo`B~Ew/bYFq%t ƩkqxUɓq"t+a# VZE*TaCWDuѻJ/( ly]{WnnMoޅ;3ɓUEgXC.cp-eM_/" Š 쒗$$RHq?fBp1T:q?aJՋEl3g4O$nϙboޫ뽡E8wՓ:}liA_CTe)ٲZ>l'ΚqͥڻT*_y2hq/H$iî ~!Vj#o ?,U<'6%MۯQ$Pm* v<4:mkÄNQʾVke.Og%O#AhE茍ܓqd4P$Gмٟ/BOt2@?֎'Yٵd{$/kh$)FyAg1-IFj$je[ayfag˜t~vgDV/}̹8\-ʡAJn؏6}oݛC9,wДq:F} ~`y۳ A页3>rMKzԲicϕ&Baw^7j5:'iyǺ7ZX!1"\ (8zA[Y6xh#T@ 1|*5r,W.Жn֩&-H!\&e]]ܤv8 \RTq9q.WDK=1Kkpkd$Acn)~ xu/ڂ[8!X^^g nܺ_$GZDL^0] )؍*ׯژ^ ~N<{G\2:3J.)EŌc=6hOw؂t'h dIlC՟.'o,SMNL"([FYS]WؿaddcgNQ2%;&t00Ddм2a(Hp[ߣgtsSt2{UuCj%b ~\9ՙ8l."ޣb-$GN/»S@қʪ`S@N,,iXGt)eWT<雯>݆zo&{k%٣_XǭE 0cˠBelE.k4L$k.}# F^hϫ(NsC}Z7=%j9/`,fK ДHBW\#{7?QYx0fWjݖ{P8}Blw_\G|fr9x$8IWif5U?F?ioD.kΝd'0 :$)AK6ҩ|,de@gTT1jN_7{I0]ͼ ,]v tb'xkdI dW?*HcO*/qoGvZQ L4O FM #k*JMX`۸&"_Iۻ mZ w5k= (ir"U9ϔ^eE7N"ZBӵ6?bJGŤ6 zKYu]ibgz`)pwNڱJ1V phL %IKPDw]B/#M!;n>K D'~y'sn%S!؊S=A]轛#+Tpy^p|լ4FTnO&A0sF˅^~x $BؓGO<7K%$1Oa}9`>|xps2{(]7(eהYk[ya9Z~uv'}M'tMl,o"K/aaK-|״6;p/k=Qu>˗WWy]9o^| Y9>Ty'e,8!=*vz,̮_A7oN4^?ÆL=]Ж[JoRODzFjZiaT244WGAg0 \a lF^3WSfV!Vnɥ[ :gZJ2>C JR\zݐ Ay  &5KtW4 {8 xǰ O[Mf ځ[܄lcp7ՠ ڟ~IڻOau~-nB=oy wvX-i-hUeGXVOpCDEó.ŋϒUr >.w*ʩzmio u |t({jZN/sԦv c|xoz>pF/=yIc9W4hK}XEpF99>A:eVB O#f G΀LEհָ7A7fƞ|F j />z3Gc% Gv|rJ}hRcyz~7]̱<0Me,7ShM R'xg x͡sw`>}ͧ 5r0●ULOG>V(ݎ2|n eHB؉tYfga@x*.F)OfddsWPؕvu34x/ GDVF.xśgu|pj̓f{/4ֿQm+ͲY,Al5YǬ,5O4 ټs?<4nm|rI~W(" D0"ȦyH(B`/#!w=+6zgEd徿+=ܬIl ZRy3ϓYzySt-qBWYe.(ఔ!^'O˾Zo)ai,1Z'`)m[O;6Dks{aCY)0XЕ8Frln;܅xbl0SȽtjZTgμ 'w`Qd v<`/Nci}IzQ5' W Rdl[4 ܯt0Mm(jJഢLhA=n\v4M]֟%nph _@jdܰho  Or Վ9-RMʮYp"CH+Э[hڔG_-wx^%Ud1!Mx3MPFS޹ڣW@;C%E!e>qcNSHRm]b| OO$ꐽݽ|{_<͆PB$10j180(e4J6MA{HyBG64U ܢ"cw{sfO%fMX¶tdX 'rmФeοF Ͱ+]/pڿ8-iM)yGH" .3€&8~/3(Ilj d=)vL.m <3Ǿ*3ʝ!y-CfWUIW8]nH$dG(my"1x$9~_jw7{k93/e-uB]Lzf)o,#IR|H|gtx˒Qڸ^LjR3VX욼pOBB}zuyUo*j׭J%0j8kys}r@Qt(8GK1%h0k]Ku_EVaMDi7[+ETF#yI<6Ge/~ÍDZ*4tN Tt^X=ׯZz*6]-լ,]57/Zh$0&|]78i&]BWf_|k8hFɞ֦H p*FS NmE՟a$jUW^+EdE\DZDi]*VݫR_05ȲW?+}yLzDV,pz(sՐ|k)3`_HǷ :-He*'պMRazrU ̫i9Y XC\f*@\VeZ _ ќi^Udzq2BIEsE*<:.'"zk)vu>TN?$nI7A]4dVN3릐v@y@*dQĖr2P5Ӄ90&uPc>P?TGĂJҋ#qjjGTK޷d4[`SjY)I $W,zD @Q@n9't*w"\.G9L,~]*SE UWb7u(Ʊ֑x^pNbdCD1;(.K*C.%+os΄0e&(nNex- h=tĽɋ ёY~WiXkd%4Mw4T̚m/zG4>A^,$8eVsyaԲF9c{jux, 6\ ~8dEVwb\5l+mrTẒq mych_q6=V $favd}@Lnq|,n@OC?q4?5g4}hd}`ވGzЏ+VN$z/!|q*pr%'߰W9Jf6FwDrʁwL}Y Dd(ƒmeA'a욊yLxR+1B~7ȵʑ3@rfirW,tq.{3|h];tS`ӈQӎ1aP]I)1J2fO3G~,Kd4*3MKwOozfӗv;Qu;GKU3]q|OSBɂ^jTOvM?uyy.t1Bxo%@a:66򖍧إˇr<f;hKnVN~@T`}n9qnQzՀ09yvYt2DE󜙧?zr=b9=cW`"rM}Pxjg^~k>i,Bmώ|Xlƚcm8R6}(iB x|Hq},^ {$ciۺ,j~^4`??hU' Mi>Һ:{`7PLP?a׼383ƚu`y?a0n,OZ^wOy|Zm֬.YtXr|&kIϛ5*|4np@8=gr < Z U9@%F_ec\`&F0V$"Y`Bfw[_ ~h#w, <5i1N\ P28P>ȁ.,e )gţI ~a T#gc%&ੳO*/fh$\8~X!&*;>Ih0m0Kڀ|X=kE#4:|)M2!x`f6l &8zugi;Sν$O3,OD/Sʽw; @[xj`'3(΢1߈0\r [XKG.6{8n]Z(+"c#E5 UFDs * 21,V7v2DzdAhsB ,]@Bf?h~J7:eupF >C<N%0KA:m!]uIP Y|nn۬hms=1Lc|$ Ǭ /)(].EBsEpü&,sv^;w1vb=m*U2v ګ.a%:[%țM.ɯl#fvY'm?ArbΆC` $f& ` k7T1j(m ~mA,ƮiwrO(fJ+>hvV{D7\I66E E} / 0RXZ>6fvwǨEzB|)qjBٟ)By˃gьV*ZbH_7'Pv*SB YBlnжIpA3oByi8M~lv=)EDΊ2+}UX70X~d.* z‘rp4`&fBTi6qn x*̥>ݣ'D -Nw\IIrzJy,-_&(ܑh7'-(G0,-WqF~R67%\s=%Rx XcȶѭkjV R>OT' AB_'Q[)i=ܛ_MlBx?ݏ:#9NAVmwMJ%}vm;@kT9BfPʲ=^{ i;!h ] zWmTlqm5P&ھmï^c- 9)^u fjjzr `o͋ݦON4oޏ;~Xܱ]o[' 7r TgҫO!Bh)d8|pqe~/*ȡՇq/Tӽ"X\ۑF=nKdy'ɂ*|hhaSUc&$+U=IO`@o}v/:P'ŤWryP;٧*Dd1)2QnX:3P-̎,b <92~es]V8 LpNnGJL}L<91cw:͢1CJƮcCktjIH,zh޽}z)jv77N(q[%r(x?66eam6~!0,3!bAm^},#xMڠZr9 ;L~`1VGC5%Y׏b>&uzB[|q\P+Y5e)Y͑op?2wӵЀ+MS.9#myg=ssO -sW5Iط=^v/`wܕ|:&^co\lDB-!2ǵۥVFl!iUʪW$ˠ Ts{R58W9ӌS5*v'ט0؟ E@\p߄;I-&b!u7ã 2yh") rr* #g-R2ua I/v?f3-޸7fyZK1<(\Q5[b7O/V  *6̸E (TN4xj: #eL8])ivѸdY kLH|r$κM M؂*xt:hw *ֿ߼ L1H&b~(@ﻛH3aH!v:iPNc!j¬~P_ٿ5]8ZS@FӤ;ۉS6I? EXRC)fnxCү/<=d Z~ŕg H74EYxӵ(n#>[LƟR^~]4/EtIZڡj+隻h7wRvNX#$ T0@\( ݙs+f}Pa6-E{s}EBOOu Ȱeǵm-jc%hC{`_H%\@l'\zElڞ#*p戢\i.D^c/iA}ޅ{6<ɫMA RMQ ~ Of xE3iO Y+50#HPb& :fh/E=X6%$lOromŽC]~w; δy!dhYTH-G*6ʻVb]s%|%TJիⱳ[-=|RڪNCm͛d[uݪ^I^ T@W)Kr5*4ۚ(_4K\/hdKÜR9n[WmQUR?Aʪu4T=Hr;\k M% #V)iq>>bg]<9oCWXJ3pJh幅yP -!H6Piww7]6`|rq3}άuV1J:9љqJm,UiDv;cQI=NDχv6. O'D^>뒋`Rט?)ʤ Ӵ j :c6 d jpQe~XϘ &]ׅrŤe  .1(er>ʥ3,}s^?bu}kfB$K!巇iz- B "z^&2Au^bz%\&5$7 LeN* ]/˲P6Od;FVa77jfۨF6TY&:ޅ] W?_ Wy_h""A02PэOs*(MSt3/ jp/ͩ+ls̜n2-ާ},Om|O%J1&HM1v-mDaDg9w@ds̺ >x6>b_1Hs?åK!]+*OP&:%e3l939  V wB v Kn{yUJ~.qza$YL0BZU1ۺ%wyh)6q)oy<=E1ъB= 碷CXNQ>r6=hc+3MVv?nڭr7g7h5ԧ"sAl0mHP5}Leux~Ū̉PzfW_7Caw:N Bz"[^ <{L ޼-RE}.T yl *YTuTto~'mts$k7D`HbPosUN\Ċ@* o?{u7%BGYS)db.~{3jD}O3VRGUτ- \Ŋ~hU3~O!i`҄aCJY+:*=ܬ8PB`cgc`)]d%|JJ~"V|RjPt 3eC\>ʅ K's JJ]Yqe%M۷mn!Kpf? ZbX|ÏJˑO͵>&->P{`-muYP E,d-֍|5-xn_/V *H"8.BS> ᫚iiR Tgu7Hc/ n:]1G#mJ!>o鈆)RBۆѺHq!\L%8/VP 5P u ]$c 3м_@;D;~*}ۉDZ"g;2(XE_fMɊ)~8)\VSl ;dP#J41I;5o:%|]?ۿL f+MP9ESX;/,s+ O` WO 6Ǜ}}NGO)ɹZ *"`b.i#7!VZr`QRg̡>owfWmCx_lɳR^/]!53O]"G?Q obRs=HP"!cCwo~U~#8`Las8|n% ųlЖ3GPLŌ9sސJe ZC)gQ[8{b$M^Ƒ͹ b*|> T,.oXh[ z-Ƭ)l>Z ~FCyť ُ/>)<%Iei2L%Ve|tJ\ \7fu4KqACL`_t\rlLeنS϶VSfeU{#P[7Ljs$o޵j>S)~5g%H2&%IZ+TP2Kr*-m(!pfs~1nt(Cfw."2f1L'Y #= Gs l>f= IϥQ$DpH:jqJFkM_2/-o* 6t5VP0_Qm" ь@ѭ8،y9E\g'3 l\T,F bXI١n!$NuX@D\[<6;Ǐ> EnPpg@prVZЌFԲ*tI(s8лR tKj...&H1%򨼋d: 7.Zawdf,%?dNxm 1bj's'O&B9LbӘ T,9-t<āhL6xw w\z ;#eh54TH6nWw`3[P& T*lD;+;"K?uWH k!×T \7aX3ɣw 30 |.Ч`å ۓ쳾8'eXQFz($N'(fJ$骘\Szb:j:)<r<ܷvk#?"ۓ1;q6EJXJg_舱 T(E |N KKWtp\8,:Zu(9u"z 4rU =%Bc)ZlC=2R&{1+}v1[$8uaj(<Nbg +`{J^+0%ΉQ+kƐJ;kNyIqF_H%< 1"4HQ@"\5{M߿xު?'n41JLbobu=OE2^e'X 5 (:o,b$$~!$n?`2}iA Zj*`ܫPI W3 ]'iC3yTlE p+&?+=>۰Į)=lU BѢVj`;%fZ 5aq9|W6(-?lY:/EX箪ac.?LR(YQ\O*b51śJF]:z4̫Avٍ;5'1nNiËy֭{1+ޚf͇P?, ߨډzꀇ\^oI'awݮ٩tQod%}vS!@7E`N)!h6 9Hk-G't8 r}b83׆]CJK/%U%'zho"]6fC!-+[5rVwٝY0x0\wN&v2 WetP1UՂ鵕u$q7 |n۟^P8eK fN/u֑aR?$]~]G`Yg+vB!#cO;ΨQUQ8|M,՘$3JAIBU%}-]]9n1LxLζppFxac&C I"mt '5뗰nB{ﷃIȱL6jsHh̢RBUb€M3~I$7<Ժ8O{ѡK׸92H%MZ)J)XATT?դ{c}ϭ|j?]P)]^Czj@@@TxJLvaډ%dhGR:}*h:إmO54 P0?+kRASAϢ,^ e;&_@ܡÈ0!H+(JG$9 8)Uc8ʐC{Dz]g/mXR~I[(yd<W>0a}f6Iy \?Nɮlܨ8l9V&{{+!3~7YOqck&I. "ieU%=KA@+Լ zP&Zfԭ͹. Ä4*u"f OGk_BEM,)qg.@u>-T|C`އC&h6;)Ly޷4l>yےYn-wBXBp~ vο5{{s;fNQ'DG٘c#hbmJ5&b, *e{s6}Fߨ|l K0$ Q!7vӆ@H r+ٴ^Y$t"6>qG62SfjѸ+Y $7/8^l?o?O&NJ%K >>"`czTy@WS5Ǩ)o_]$m> ś.,xw%uO͉鍊dJG.f e؋)ϴ7V yނH44yVg IpGc_?Q{TnjOe([dcdE"(@O9 ˹ƓeWYZ{2^88x\a.d⻱&B&0^T]m=9g1(Bڌr P*& CV+J1kf߅۫]5+˯_߅&mL .)X Y"9Wز#94|F+7bEH}| v.\Ix@JED-cBPkmRL5?(/DN({$3Yc°-t`gفΤi i}^,"U;蟜mRļ-&ׇ }uLװ_˪晩wW}^l}NjVҘХR L:!ެfxMa o,{ ͤUh05d.'}[NMj p& m4^ZCh`'m[ ը8If0t@%\x~,C/j KUÕ*,FZgeCߠb]T2C5r\`FE&I;_PW).2~x@CI'B\ݿby|I&IT#yNV箅.]GH(Ǯa[3OKa_. c| 9o XpsjiGu\0eS.Z_Lv;*2-:9L*lWbZ WSjBvҋ200\: (im[lwQ{\`zuvȆ/V,\S\0X34G.y"%aA$C>uo*> v&Kҫ^QqroA,)f}.LUY#+]Xq6=N2=(JZryZL9En7[a)g.?S }\-K[SxLbVH Wv]3p]t$cQB0Z#*ktMD)vc*n83(O6s3d2nZb,"3Xl%$tK$#Ʈ \JT%Z*ŗQ5KcDf$NH.,ׯnnWv |3Kg<^98qv BNyδ `.v&Ҷ,'c~KdʉL(hkWO^O@hvqr%Ewef6hIT5 iQwbKu AIDGg|ܭoïo2h&c9@x %؊BMy $b:/fmj)1 vH~&;#NJb)~f^ztŵ xL٠bkp%" xY8G3mDs:%|Z1XO2+iZq1ç|ɿ)?[0 54Ӭ6 u I&!(|pK9>=ǫXD S))eF6) )xɦ* SYk~ϑYG ]K][STC#A?͑fWlE,RNP(rUh([)K}6SP߷ +O<͕H$d4,)&MZB ~8 צذӏ_T,?mɮۙ%hJsniOY2ދs9VX- $>cD6Xf@4c>a~,{KzbMީȥJ!=3DCBl:iݓ2,|A=וeᔗ>݅o*[Nђ$ЙԽ$%[S0R:YHj}8ٛt>1~ !vږ6d^`UmSDJj+]2ʲHPZz.5uHwԺCVjF)GVL\BeV.& ;617y* \M3W.EqA%ŁB0E*VIl;.BMMnՔNوPcdY^زR jjM&s%6vRF BFs21BK\O7[İ圖ͥ}Bcʠ9%KkjXI:9,5;-nt;,%]p,\`y6Em "0l5ny^fV|_– QA,\v$rRdaKQ(D%@yB9_scY⑻.cv270Ŝ ΄bpsmбVΓa18zm_]Ose@P[J%N $>a6_7oߺ}0,s& cIg- ;,$ud<QkD 9(w8lihe5 ^ջ7mnHT]ϪsR֚cLN>k%5. ` _D0+^b+H&7T}y$\3Y8WwuəVJ)lC!_WZ}⭲R f"t.H`ДxA {ƳyNO' l6.ZTjCm,H¯5j;6yijggI !d<IJtp#jxm>^xJ_@L:zE ˌ`?PbE I]"0E {T\d)+Qs0L.TUY{7gcdcTUl]cm#~c8z.}9'eEqhto6OP±sbW'ߍ;*bܪXyR~.mWQRY0-\ٕ,ki`-S/݈AiJ(aZz3-HYrC;6`$=""yoI8mRRNX:bbH$hnM4Äs7W.PråD|0_aYUzFUq @=.W@ {%LJ"ʹrTT$cf;zC_3[Dr)UPwq1@ХX7$#LUhg3yqf2UAvNtRWg;¸c"mUJBt2mLЮcgIAB<u8x&̈́i24ykTf|G9)%jhOҠ\Ootzpw5Nt,5!m]wv*s^wdz% uY^֡]rs]hyڃ|#vvuRYoʩR͸MxF8(zM6NeUDZ&1bp3|v'^U!i> :y~u8̂EkIOon2ο7*^=r2f^tCexy8Q66""^}%b.Hu]>^>ʼnoy4 FU8EdK*"G2u.|5ꄩ-ڸ'jjD4]ksuu}(3Ï)TIZ7F ։{JUp0}PASɢR{ฅvyrv:R>ؼ~KQȆ\HEX&+Pf[ry |C VfA)b}@I "XX9*]AueW*K5KPJuH=NMr[ sRMmlk5N9Wg5:P4| 6KrҊ6i,K`%G99h'磈iXfϣ *i9uwJoN d$ʍR+Oi2w%pP 6@e1#M2}]vpP,E %Vyp gؙf2Wxuv{ ui0zˡ H5$7k0HEqL=mJV&'jQIj*sK}f\-`dx<蝓-z[2x5£ YyHEГM\󝓢Vcc 呅Nfs,f$pA ʓwRUYUQ9ee[O3Q.bT01 &?vwM (e쳌TZCshfYh(aɹRij KY9J7x4b& +4nEOldS(&L6{JJ*8JܿzPF8X~ޡB"; \#hrNߟSO^!%;~<|L9;xC܃G"Nlvl Dx6!R mCD }.EǬv 3za;\.}Y,G3{Ydy%,8#&i(q49(ےmBԂ̌Pr>Ϲ(C 14JE*jX^`G?Ukow7@`&_B6P#CP@c[Qk1ɜ6pYW95;^"/+Jh*so rѝUU^^lRC%@ֵ- b^ŪD9/d}Y'؂=OHr9f.uQx+ d;!xp$ų?X -ȾgRuqf_ ~lҏYZw2;;/?z%YӥGH\rRp8h7DelDy31g `|vW{z(c| /N(g-B٭@'b^%)"`UK~!L<Կ=;}w(gB[+itDYܛg1A35V?[kޡ[: W0JM,ZvCM}N\$`ʴڬ:{H!RL9֩+⣗ɨћWtk,`Lmd!u(j萂Cb{M!eh]\kRGɴs:NKl&1 95,c@!$* -?{OqI,Tlt$T,|ׁ͞NJ# 1D zPDC_u78W;ϊ|fn',E( d$gʯ>uʼ!GSzi5ںw75E7HHQK7;xv̞W;'d?0d6*pUfbC++oh@]y_ o};$} f,Z;x?yX&AG` S)CƞP<'Qn)(6cQ7$R4qLjtS"qg{ýPU= +"xJ/Ky7)B%e$*_@?AܰwScct]VA,fj0M5j)dЁGӖ&`;Y1 ҌX`7X V̘_;E\(&䷋ D[_W|noʶ.k",<+H_Z_iCݯ>ﯟ?4m(96fٱ)ޜL'®;WR`-4#bQZO9w@!pVg(JuN4*C, fUvH$*E u :bAI肯9F:rY?Ґh 5k8z#vdKUFH4!f,L\ʡdo}irQֽu>S9!C2SaD9*}=1t!vzrU&R+1/_:RpMc)FJ̤n$2wt4@y Kg(:%@1gQ\\lr"&[*0 vABm7z(4l7tdڷW׿?PAV[̛씐cy# z3y g g=]a̋=PQ%ծSK{+ t+ALNWƕW: z3.^qTain{Xv 5$YT6jfA՜#RJYl=-nO&7;XSK{i/vms*^bK:#ue~w$D-$q.MoBؘ%( V#Se'aw{&/̧-,w[%T Xf~wkw!xeTCˬ{7{Ɵlݛg4}p`yo`u޶3#t=ܴZgE 1iK(miz zULAv tቱ%I=8PrD? ~mv:z&"J-^6PhئxJ` =N Z!扂sL6!&+7uI-oÇF?xDww2oS!ms&2AR1Nm"G4L:K)Y*ٽI>:PYᮯ{LWz+/j91]e+Lof Y K  ;]@aA9{ՊiS nX]T&OubÛin>RM)nžTݪY-hĆXVBlT7dxB@^FPOD4|~kߎ /hnz&) ,ȹ p;2d9_ؐh6pAe aZ%K#}HfbQP}Gbph6CQ,u!wIÛQ(LtK8#.Db ۱a/8'~mj8 ZvyGYWR#4$3uttS9}\~A1.)&~M6?3YB){kj5ѕHH\Kf,:NT[R [aEafs^Je'pI` 2YŤkvjqs]6Ab#,?!mQg;̮+jf'K_\M,|B"b[@M\K^3HҶ:bV=*q2+bokev#cd{h! ugi B ޜlA~jBfWb؄a]>Sa?NGkH7=O]JYb Ȣ1QT;K_B*5MTkRH)* ؚזf[mMZ!𵓁@kTTR.w<]!k力C cI%Vū'+Il+Y1"uEͲ7]Cҝ8^E5( r1MeKp8hG)v#`=~.X˜^-b3V'.|O S{Q^S˛(P4vDyA)'tFf3DnE,:^ J%ef59@u5!W^ B"}zqPKQ#`!wW-0M|>m&Z -gcfX$]nYz+]-A1Wπ"$2*7Z[(no-YFŻP=$Rʦؾk1rA ~6oW\~N\w٥3uIw'V:$#29pN"*fB\1eƭhjȖnԀUp9QRHAbĬֈX1lI(Xy(j[ ]pUŜd-SR(-j`~&-\$ku{{L++4C-ёfTS"d Z-]9O[Z #8ȁ٠[X)L'w{"8p}+Ubc)Yw󏸵Q>[n9Ų o`|2xڿ5ƃd0dt!:g Ѽ-i6֌ 0!Ń$ M"B|ݖvE5w7evxk<աlGdksBbT3\.<I3d7\ ! @RBi9nj'~toKPpɟ 3A 1| "q%2Ԑixmoǫo⹿ǐ0Kϳv>30#tZb܉V u~~Wba',1I1DۥGUGEh&hNjc n='FsǧO 8tDKʎ2`RrSƦ:YqZfE.[ 2(| @R5d,R0}gXϴi*<a\WfHV Ψ 3:#HshndrB,jJr"( 8丹fxCMySes<O=3cqv}p(W ;PD32}绎$f>f)abU'":18&g+0PqC5iWe=}(y/D:CGX>E~P}]]Rܤ[,8PS)Eg.k,siڳKa^aL;73'΋Z%ȁ%H]w [59:;-&z$P~uy D]ۖ6kIIy0鱚(#FF% Я 8 Ě~$B6&̻ȒDkfΑgv6F"6bzb&6[ ~ϤŗOG'.~9^GK9Ѹޥۺ%M}\]ξAPB?@ʭCu;m.DVGg0~wGh$UR#IH5b#e􊈖PS UtudZjaG\Vwy5?6c (:<:͇؜o7f ?d7Y}<.R!슼װZl>g11'Dul 4u}!S|e$u7g& L.5D97 ^pedD#{3ݷsCh(,bG3"-ݕ/t%f8GToMli O"ólLf<V`8.*Ռr)ϰ/B{ȩ4>pK-uWXQC)MLonwus5GkTҿWd]$zXKk7Dѻܨ 2ov  o?5*qDƗSb t{q]?g=cMu@8G5 &@ukir3Ex!rW&[̈́\`+c-]> ob\Lq2.ӓ0jqLxx(P8m`6jm^TnśXt/> {#0N3(䣘?igGMw|0-zثpJ֌Nݗb%}l uL/{#Yp/-]n IKln9iV/g 0hW1 _(y%(6GUehJIxQxw)!æcQ9x7jfM,RkSi_]x)!ԈlhKW.;[ީ(^KZn]o7YuKF$9^jW^Y0b/au\J5,Fήͯ.?zy&AlbzlVFPie r5  fӚoiO톟#H +濽%Y5B罚pˮ+WT;58S=SXRUv(φL VR;T4ww7VѳÇ={lO %B(Rɀ1I`T=-u88*MnmT13kjF*g)Y+cBS8荪2[uM9GN]5înbrm {\ETd5%k,ͻPB1^O[t{nG{,T4hcKa + lUcx$ H|2`;oԤlh Wn l(>i no*:k=`= H ބcU )|Ub')\eoaU ّd&֢}Hڙ=ԛOZ\Mտ{2e66jbkE6UtQܹ4NR-ca.ɷ1-PB񡚲ҒM{ =E˫Kfnvu߮:<ϤƜ̕fQ{!Vr~L[]~$kR@A^c',EF')BS^I-E%ϯFޚ,dn͵T{RvlCĂW @%mWdr8:_GaxƎ%R\SR֟\ʋ$]T#/i*_;)yF}\OKv |X`cL kj 3 +WUS뮅)[8ךND6aPQ_(r,R+v(.J$6]4zdVۻ7__\g8]2D!(I<}@F=~\W r6r^'0dMܨǗkՀ`W2eb g2^j+Ob`\/0tj5+YQNm n˜\{ EoZ2,@ X|-ָ!#b³[Eϯ@a%>y_XQr쓼6jV,P@RY֯?1kFRڧL"jּK|koa%5 s戫 b +TB*oDRWl5:'Ya`Ȭ_5p; XjJv,),MV}\ss݄t@] %/ .9{VFJTm5Jϸ!J9D4MFM[,8݄1 ܱQ0A8uQGh\ZgT1sh wd6[Qbdr^Ilh1]HbPfq8jjo7qc ,Ni^gWhλ*NbJz.A|< cwV q= ` ?IE43G9$PARCjfD^x_HVtߝ-jƹ:gTkIݕ dEځPWuT`2e+Ӥ+NTt+9idB[B1CƵLϖfGV rB0rKx1'= ]&Hj(eo=DV!ek=Ċ[BBS'-.ċg,X* >wI$]H5ã³mNP|4׮wĞIંST@(!$ 7'G1HS =戋,gQ38"H 7riN7I+rPRECwNG_ACw#8z! }RZD`@ҀCEPhj=RA>k^mfZ.NV!$Ci50҈t^spNOf~ph~ eɓ sA0ʽ. ϋ'PepJ˽$'"=kNz/ q Nqiڢ9yR]ĶPj~nWQoMݼ]IdxQues,;3GXX~- !ƪi3~qAt'q| ZN4Gi1őcypU8YV<Pk9z{7u,?1LC +*Lw#pnBu#qqk5^t<>Se׎Z79qʤ1ŷ'\ؐWψ#\)aA XL+7˗]a+39QL9qIg@F>z38e8-N`M# S}4ض6/ev*qSiD{}!EnB0w4mr~]r 13(5WyBUL]k9dlFJJ|7,ةT8B  -Y6$3N-[Nrxx/l= Wђ#]Kc"ޡ`ܰ&mm)lὒD_V%ඦlddwUΗۇOX6;F,rVUlP-([Hǎmqyc¦h"kWdB; O^|\=7It$o o*7߿~vgfM`$PpiOqLhe+CѪ KWߣم@0? {aِ{KXHcz&9^cHDϻPbO=cr~FNYEltdHVn-Z1a$dTÏ״QG;aτH$څԂ$Ka*0$Fs4WZ6ADŽ"gxv '2@Ň?G2cςʲIPo޼U z} yI;DM&PܓۓQ=v{-лC `<{Zm);1.7BqNIR&:Q: lNs'˽&SO=\5 6J-i8QǚFY4K3r>[=\(/HPV>MQ^5OfSRVgJ[V"DW2d&\WA?[6x5 %~[KGP vw٭݈3E?ƠtɎ47_ư?Y"ȓJ*KvaMƔU/{f`VD5b&F\RWLJU!Dtf_'ؾODjqqd^829WZ!zY ;q;Uq9FhL6RxݱihXi}4!w&:|8 !"{/ofuH;Úrk9{nRP~P 6 Uc~ѷ;>- tp髟zAFWL%Gk59;T;3#y7ļ դ˅' LmOVЕ<Ǚw q-OCªlBRiu 9bvLCQ糖.X\emg1:) ~ɤ|-`<@כ]lL:fLj 'CS!+f1 da>w#,ӃGh(5+516:ta%p\늇UCNEjBfgL$]U,,:Y@kUW'2kszpi[P~D$ y'{:oQibP(s\9&CyoE=hR&,z?'ϔzzol2dUsxY]M-i74 U(RzB*PRY3CƝ[#~'%R_ Spmhp ԏm|] _3ެ7e}=D`znyE]7j3XĔ$j_3PH'HݽC1YOg}O*IBKUldGS$ho<|A3]l~h|WC8*\He[[ E(@emwC Šd:!3QHUbH}qj#,K]#ypѹ ,z;UI<i 5Ժ$T%yzXQE)}Vמ=nqd.Ώ~s$B9 kjW qNU`b,}+zl;<5kGqT|5v#ZsD؏}q mdS%:L$*ˡ<.PW}yEI_|/r%TR=M Ͳհn潏;) @E~nuyٟN/] ; e.;Aa, F虱%1VT/bBGD@AM> f4#~e],kF@TL6ҽ&Ĵb-J9<}Ψ!O`uO@6cvwW'ŧ7ިwu;ManrhRt)0 []*T E4K<>A c&nҗ֐X#7:A 6Ǘ(Y[r  ƎL OfpLO1ŋή)->VÅ5qLpH>ɥlz[h6 L~aHr|e,?A"Kܟ\mr6I{aP[N,OTP#e ʅ3{,"MIk]ij{U+SMۼq,}} !g2iΘ)KeGi -}v&PԳ~8amiP@Y) M. J<1kduNSwYTy8v)in95đz/Qx Y7!>8wO1,Ef<"Žv `Zshd7kI)BB!^U@tƖ`SǤQ3  Ft)VNf,ZR\j;*L[s>7sKJ\X[jTizBd6H37&+RO=Ouh]_PEj- 0ظk=d+38T"vKPNoSeLdY~Z =.Rѣu]Y=('C?+jgI Sn`CmEdH|0LjGqJ-E'7Q Fjx$),;4sxww1fu2bڂy{7E&k>":֩n+#iz(;;[ *&$N Td%vUg A8]1UA2SCdk@YЏMG6.RM5=4 P҂),(^b`]~lw4zݐ|aQB?/An++VS2sXrb@ƃlD~NǥoKqMo "È}_K}|}U]0Af{٨b2 $^-ɮ&Xj(ﲄH5˩krClˀsux۫P]d,L5D~aZi\EHmXiӐiS& `7pJZ0$?KdHE F(% AGɚZo*+`/zC0F%20+BǷǘ1 O*{g#UUQ↢e%^:@X a.jW ioE\arntnnQ sZ`cu&ϐ߂>4'0iX66g8K-pAUWemC5ؤ/^@g弞6}nau$FPI23WoPZAjn@}3z\2X@1 3v, s3ՑX>zbg-h3>TVtM@rHn]UIÎu`p&>Ѧ5e(ԱTö:E3meUJ4G/OxuaZ%cU$(] oﶇoW?}wSuGÛ)l}ϫvI/g-p*eԙWlJ R=Q$:72K0 %/-uRa UǿrUqcOhgY=SN/4 sx)3A+tG<Hv@`\ lhDZ>}SC]d긳&@2t<%,sƒ7Z-]  RvZDi(Or/2O.㾽>|RS>VvV611N^.OIn\,pˆXn9C /LdT7B%KAK}oijDcl$ȬQm\bݢӬYmkK To/ٔNGo6o$Қŭ+(r ћc_q͟DzXW~d.u9(+?v?N I2 <Ys̃[7q3kЉd.e)PEuH|Do'Gp2Y 7&e˪x|H+n9뫞p@W޳M*~_p59}%U$_c0AMHmfn!(Jd*#؅Y+,ZmBx]noEW-:sdP>RBZ,lY*Z/yJ%*̟ ޵mn(lުj{,wùY^uMɒǎȦ>RrI U7~7<Ç_5FFU1h _VrMXumֆK1ĢbGWمW.x3 $iDүr=sTxkOL\?%܅ {wxjcw-M*^HyUU#%%tȬ"n(%0Dg!pVu`bMq% &3~ DT^{lsʫAւ&52RlgyL $ކ5MT 9N%7تW)A^ er>I1-HThq TA$JN+6$C"EbsbYaDN˺hfB& ]gp[}B}* (6A9od:1i9nS$5<9-UD_% @^CXlo;&ȋϞ5B qĠqch64nr;R)&wTrhNRlsZ jKqaq"RIKPKշ7͜wrx)[yW@E *_:֏ ]_? OrIf}04%RMe\Z]% kC ߦ<H%jSl=ہPʏIֶ>jPG _mVѾuW\s]r: (Pa)ߍ1çU([&uY{쪝Zݵ,$^DLȖ$4(ٴتc0Fr7^z2txCJ=aF[Q9S

i(&qIƚzbݡQEV`Zb +EJ7Ac ׊+]ǩs92;.aR9&=L+:aڞ혵Ί+m{<HI`%1b8D=F?Ə6vXjME8b7r#|pCntSQ79 ~?NՓCNlP~gJ:M -+UQ;g l+e$z2d-չliI!Q&;"ˉK'<%.Xs]%;Z8',WZ_Sdw; sS6q[9 b ΢TXp>"&a7=HY1#nc" )&SF-fH9xei?[i,?_Iq}<^zE>oD*)rФrq˛e;hד/ p{-B&H8$ XJGC)+EҬ2$A(\LTϏJL]P oj B33N&_q{>u4CsK9kDa8bXKE9 T sl(4Il$Jn`Yi<,& QL05"^[2F!׊}Z˜\2c LJ#@9l1c -Y>ayх7If,s6@x:cL:䇏Ig>sB)ҊɂZ }8$\ $`')"U@ gknt)j&d3ZW9JA9om0?x.=5½KTV(;ݑ"շaoQ罵 -˼ aYEG%=h˺l-myd,CYID.$k&+В}ë$DY}^vDgCUN)SեT݅7C0EízW .<{2?{{q#?9"Z.wfr$1RF w 9 t_xye4x{(&O/y]]%qMy-ֈJ}N(nQm;߼MgE(ڱke[\c^& L"K>x=xl"cp$bPd[jΛ6DPzDQM"WmKyF8W(]FlGϰfۆFMM_4_Q. #Dּ;3n:kGֱli`%iDw4iӫ77CtOk9Exf؅P&c"Ycg\%vܳG5mf:mEa:T~~>0{f,iV&Yص31`Z_ci'n!KhsApUm] Ky9۹ 3vtWk)8R> )R 9kkIڏCH$(H~Lud!R*'MW襴$kV C_r, $*GN}y?r;Jpkl0Ky(U7v8^r^'2C{Z 9u*؋o c:Hv& yۯz^VdĐǼQ^הu \dW؊4)K1i:mMsדEO7XQ#r;,ƻ^X\xef8JD1FĆ 3_9^wGaDYwJH֡=U uZ|tdv7RC4 -=)v DBi)k;,Ot =/6yi<&BJұFe3P@mh)v]ϋyWt;e+_yK|v~Q)Cm w!o.W=DXNN%.Іq#ѰM6 |1zj$>jZ{u%{j ƠZچR2lly2Co_n4XcN:ToI+N=;i%8|Z$AggƆ,|Y:^;-yi Gee|zPnG/hYUܧzd;M=DeBE^#Z١`:LWKjEk'BIb|\bjɻnj j8~1J!/wIu${놜Akv,KAq3JMjJ"M#QQMHcZV[$}򕟶#*,h{Pi&3ӨcJc.\xG@$)Na\uI.l&e 3Nwi%[B}%{Jy^91^5GaT3{ ^W5=b5ڨkW;팏|qk6`CI@wo^QfNՓ#yJ"qٹ[ECu{q8}kzz/x`2ʽIQ> L%!L~3F~D$jԖ&4Bl'uӞbER:xj(:~M^U}|s?=py;|"ə ZZʑ̄e<ݕcfL1ӸHAn-s)H {s ]q#F0zA0*&퐉bc̮D[GΈo^[-}[[7/lW08  T82}@y0zQ5& lD6[tlZ`YXTN|&g4K(Өv v v+]8gTTRj OÎo{ď *9q4Wэg@`2B *4{5 -B,󍊊 &C(aC922!D%l{#P_l'c2* "|5<ęPG6&9= GH N#$+9P_^LωvSSyD8 k!U]Tg  ϱl{gj;4lkE ::b #tP1j  C嚈^V +`&g]j'\^&#oJj0iGmya9:vј'DOYڛ8![PYIdHiUҰOYMdmsdqWc4(@U .nlU1!8.3:`*P]BEI~v1 [Py`" ,$?i#O{>kzنyf["yr!6Z&ӈy*R' "1p# .뱢R8 dFkOԻafw0qOVy=fe[ iC7ȧgU{"4aӄP;#ى\Rv)P~/xHwT''o؟x-16QmaVJ] nZFubh.Of>~wcgon)G :MJ2IVzm:DRG᫗ÝA#?^+ڦQ)YiZ;4c(TUJDvNbwa$w+[ (pT zv/K/IY//+-~(Z&e!:`7gk6{!d#u0%v'ʚ]3a7-g%uW''% |;O{nz7}bI?|#4ZA^nۈAmє%2T*~Y^%(lUcb[n h\cAkނ.'4jsmtBH4IݸDȃe3&AөJHzLRqJTIjMjzj ~- ai(rۇ}x|x;~>vN~b@Y2ZZ6M)izoE90279KJۿ1BNB BVҶg6LEz4jZFAgsk'5$|δ,68Y kƪdFiAԨFqFP.j D^ Lr1:t\{q~޻ΝV% A퇜k_Ft ЂccG2 mzk{tFUM\mD_h[X O%np:IsF,O*HXsgG|eW?ޣcr2kx84͈|)nhLy\wdIZV?fZ7!G#!?ۃ:i{~ ?E`0~*|%S.mܿZ환|T -S\zo~hEӔnIop-r'%@8RХ0dc8KW=-y(煌JR>YR);hZJ";LfJoAٞJ,]<^.qD̤Y_Ŧ,:h5Rөq[ r> ݝj/MBr38Qxoj2ד=ND(w5sc +9"Pℚ.$i2I Xswwm?Tb30ll7:s7s9]d88(`YߤO}wVޝklE*g?χRj+x;=OR"X!u|S۵=c<;F\ބ ERK~epw~L~ZqvʜHTS sz6H{muwqߌ 0r21t[_2k+)" *‹br)w>V↕ `֓Za@߬pu4 DS.%ЖnO5U8lN>U([tHAůZcQoIɔKq Ykqrg)q>$ Wbm^9/ݝa /WK?&4ᩃLTIkgK%M WΙ-4ʺihiᄞ|M|͙z $ԪBƍ%(#R8 쌯Aןޢ-#,W]_HuƧxj@M\,j%NTF]ORa/>3ɤc%'.FFPRIrɊ N2뎴~!T}߅ŽM^K;!4\xE?SNJ>`5CMԃj铭k(kLJ~+hx8![]1AdskP#)b"7$Y8jG}Xb*X]~LoTT`vawa*4X˰츻V4[K(B Mąqk-ga&cPO˃amσO3K軌Ojy|= |hmp"zZ TgV`M8)QVU\|puBr+]b .'%皸mY6BF/i^DOӝ6LW[j;:؅SLx`$ w1zÐ뛟X,uls-|Ji8ܩqM@u1E0`h.n s\~K6Zs~zak{ͩzz,{ O+&"5ѲN9xݢb? aVX5}Q*`y}HStI^l=h"״TS"qQMEg /Rv#iէH^ktՃ(nd# eMseAԛr@Pfo\v6a ZZ~&T"% ;TL^ߚrBu}`חn)[%mwQXwOw^e#`Zd{*XZHy)s4tk>ՅЈj#[hzga^uSt.dG=M,ҭVNlLmxcRqf 8M@]"ϡx-wBkmx!LuآEm`+tXAX\2%6ɑxl]-ש-ݿa{u"L8CTú…o6`ctrx]2Үم$mӃG RyDbĖȏ_Ī}zI`2QgwKQrR~7%ՀMZ}5q4Ǟc/<҄BW-x'웜B2-,YX;WU/* q FS/HkU;4c)P$v1h}f.YCF6K9>38a[f.IEljb2[ 7l ɊT˽L2Hs†Cne;p6Nŏ&S8'X]b?KZ#.mw DRP*\Pa'A#?wm|k;NOCcvq" Z?f(a,G6nWqIezz.I\-a}m0 5ƅk ;u%?XdJg6|.(0σ%(xQ>G DPCtҤMDi:>I6K-M+.٘6#SRw4؊az <5ʕ{2a:I`fwPn\*p}6ijp&M`eQ>>nS)Ql`&YՐ.,P̎K9{*#LǯVGA찅`M69\3b# /+P@`MHVh~w5qJ9Rv 歧yS̰>* \ș`1EgbS7OnHjQe zFL[5Z0 ]ƲPG-lC%"*TI(&j4dJAU$d\ +?k9PRfΝfF0|1І;x{3C٬KB!S ph6Rk%uuC =2/"vJJ꾉0y;hf@.u fKc0+\ 6h]z"{$Rt{34պ%6D>c6^K`]rS K^g uHs)+b7(,%[YC8{D0.(/j#|(kX@gG_hh\QrEK _NVXZ#0BR,{Sl)~9nb~dvyt3j"5 bv&92;+䎁w|%$i@pzǻ2c2O_xͤOܯR `QuGgZt,24W3L\̯TV09RbpةOx^t@Wu8kwПML<1kѸIn!ЕJ=hR*iPAc*x%f4ŸboO29#yVK(;,nDYF8XšGVB1srF-ct_-ɣ!}F 9k59wUww+|-Z6OVam[/=t[БƘbRؙ߰`GTEnx.ؗQXPf8,n'N0ƜD%E~[l3k6FPB.<e(!MY墂y'x'^h]^ L7ۗD-[÷l=EE&7ǻӐ3N\Lgf⑦͍ c r)4== VAbLD[in d+v !W [YrsKk7Fe!jY)z ߽>>|nwNB;N\#5Ekk5'YC^at/ճIK^wEsUϫYMaȘ193v8%<+ (/~yq? ._6=I-qeVlndCkhՕtNfv %̯ M*%L1M@Ma8. ZPiҸ=Hv L~nN exC썢NI֥f!4g +4;\EAu"7kFW$ wB[PڳfFm%A>7;FF98xXp=4C=&@Y@nm2wkSNkة߹EӣckP5v 0P}a~2%81U}" QNIdu,AQKL!$%zQ~iX[nwf-xbY'Xf$uLenaD@xSҬh~Ph9wI8PwzHuכ|yJV Fd,}Bٱjg6 p~/$D3q57fHwShJ tDK*jKީa<йUk p # BSbފV y&й3imwh¶ 4ϐ{Cbx;E0/ˏۇtϙ 㔓#8)&c;Dxo73lXڨ`@sh%f*8$@~\,]xsv =>XNTA;ҩUY6 uh:j*k:zIVh讷H֑U6F-)[kZqDfC9̊̔1V^SLdP;.[V}6yFOY ]y ]ڔJ#s@hCV>(9o3dSmRb^ᰔ@ XϚcZ8d5{=Hb2\>j}]I0`IdXH!^IB9̈́ ~cl"u($@ À(Dlo:Y !:|.yRޟJ`:Z~=FV6}i,; H]dr+g[ZGLD%剛ѷ*ZZj,-3׆:wQݠ 2 OglRLqẨz UС y [+ hS 2AE)ae:3nɗa'ǒN=kY١< F\CLˑ7,j-;7$!!wh^H+xfZJǪ>0a (xm{'`wkBhU֋lHI)pe~ھZ-=9jlfUKlsKZʕ붞8L4̔dZgMqC+n]M{c%򖁽B"1`5`TJ6лI&^"RѾeĚ]O4k¹z lV25eS'04jC;\P@"t4 &Z۱gwƱ€1.W+l?[Ms3}D.$ɫH]O#L ~ o#*GFz=BrZhDo@IUN` @ѴS]kh?fbmj6GPk(»ҖZOC\Hn#mvxd,8엳f5׊ uƆugV[-,Aƪj]`3C#n UqԿ6CZ ޾}`m~a9ZAI. @5B1xs)J5`a:7ltw>|@&Xh?w21O/&O'O_x/ u+7LS[g7LfQ[H -!Ǝ#y6R3]{WR3yzTS-3VWrTCZ3p*U.Blx9݁^kfqZq^1bݍ]]NFGS`\O+ny[R򫖡ڪeU0*5" E pLFv'W&3ʞJ,n-ݬu wc&㟙``;j+u{*c(B F Bs[ \_{xCd =f,M>Ur^7߇O{缉Y ~w/`N+}-tG+׺XyS'D7L Xi^ŭ (W.3kwriq>=1FuqJk ^UtoLvHyE]þ#cp8YM%c-l*E#e(PkZ*5mTCxZOweԄZݿV4t./V`)o`%g Z`nuqzMH =DTErHc+]Zg tSs5ʅԱ"a*e5yzR$z-WH: ]o@+RnL'XizJ#P&/u#H2(}4;lW1((oCxX627_n/}圎ɏ6UTZ FZ5lV 1NC9t?&( ;`1~%SفW9HDjX}U[r,|Fiw4v? L:d]as:j͡]xu0٨@`8-K:]Cj%qN[+rōoH$x֋fh&k濸^!w|?<_*ڙx6]\%H KB4oJ% "ġQo:u sUeh(E1+qb y鮀ߊX!T$h-9 ɓ\LHYjqӍ_7E2D*Jcs?oçro??Mw)KAkJ}b@Ad\%(DL8mD٘bj$[)bge[Аywۛaۆ{wX/{m%NCI6j3YuOUmI;Ane%r㞆Եrpsu6Sl7q97b+@M!RP -Gƺ ]'*D1[K$f~megg-xl ΌNAf2Ij=֟q@ȿ(BYC'hpV,)j8G_#Odx+1d'R)ꓐ+.2fiGtp Ҟ{^0ElKw'3eZִOa7JPv狚@:TpP!eQj 5#t8ЍzԧMXvA 9#~X$@Qy)$,{ؗq{ױ>mV^2߫ &.CRHG[otzBFп,MuKw~p؀Gf'Xuvp)Ts,uUBoiNajYlᄣ)IJ/J8iDa97sm>ε%l@@='l-&c+G V*}Dzs?; x`PFtO)40V-w`oS 2ׅdxSovo]k=ЦdL_,<#a $:PI*Yr@7L~K.NP}Z] ?"0M>ģL FZx X!1䐊 Lt PIgDe-!1~C0fإƋl3P˭ <^_-7 leQ?ŝtYI%](x5@p&_}e+CA\.}fڧz`U:o_NN xZ\g 4i-|[!X҉%IQb2T1F< Gј #1ʼnT&Ȑ0\!H(-oDzBx%KLrVҗ6)F&I<nKy)+tsJ.I\OcCZ">m&0,6,4uD"c 0d:ᣡ' W殜6onmDN߀N͵z)$lXD&kxP,jjؑyzѺ4z(MC^ɥĕ l@Q.艷mhsli,$n㇣f#Y8o<Lu*DB*,`0C$bKН-lTeL՘}j ZPw!OVvq\z3^$'^H)[dVʮgC7\caFLNȕ3e8< [rMw>$̻eĻ+5'G-i4J/gϙys_)(P@=h|p!M!y7ijuX-3`!veX4~ sEٺ.@@e1]y:"{Fx{@W44UG0?P|&`I"BDT0-j;f2}O)9ԥTs tn%^V~ۇ?܇pbsyQ*! qՏu1d b,+DRn؋C1Pg=wYb`QX3ܮqeoMF|kdwXLX'p&}SvВAcC\/*}!YhZw8hHLja87i+xz7RuA.Ђy09H]c|z=خϦ{}ְF OLZɜlfrVbQ) . ȿ*\cZtB?.Z&e"ٲUnkɜ+J1JcM Rn(]QNz/cB=D0#kL3 pXS*b"QH 3ѳ樂?u~nwΠ?`OM(EljJ*,xl8PMQ1ϒ F,WhEG4Zq7> WҨ5ҨjQE1%SR'qcϾN)S.dXGBPRp8X%/'/նYˢt?hsxGǗeE(y&{|GmLi JwA i F^C}@ @p .zfG_*uboFLC"W*PHr7)֪݀h+"|DΌZ9)WQMv{}Fy[+I[,*HuJ{yTw󑩄h>wW# +],c?@7KJ;V g\D_/-<*5%ip}Q awxkNtՋo<G9ĈMŀHt>PNrNb'sNIfs\8c ywqRBQNʟ!'C&f} bn[!2Ptn<9y-쥏uf q/fO6U|}_>~"x$YY ԲCZk3iƌ%^9*!*SBRf"iqYHґ,Lɚ-ſChH*"F]j3$ ې0%]@Jp/#ރ/mܧspXLƿh.r," E)V>Vx@ֈK  qg⬼{9\tXƃ~`:צMG6sC.&ҷۇؘ{|ivww_II`a<ہ${,U|ʹ#<5AxlQ48 DJ8u /ww#iMx_no<5z}>Ǘ{CҨuT*NaLSwFH[K}anцXAQ ?5q@l5㣋x.Xw4w˛ l+Yv:~x|>_ozAt2KD3Ζ6} 0u[}ٵ  z}mlb k_|_fj)Q ɦ`M?j&<@2cƋshyVӹE(#*a]f4 tlۥ>I^nĦ71Fcb#Dɇ9^ɋ;m⦈k,0 Iܑd\7F䮭Uw5.y2oP6Xo85T[t7GI-8LyD5avΓ2n.z{Ͼ`wz"RF/4_U| X.dp׮(6 9i΁TU J2l uudӆ-zV ҡ6n]/ߕDi]y*Zc[U) h7kE~^7S3G,Oq:򲊢C޳Y rJ3?Lp&zWQ3b]+fׇ̄+J/RePoIEHtya!JF Cij["gh O,w/*7=5&$U=|KN2ڴK4$6Sa /9 p\3fZceaБ灍+Žy8<%g7^#oP UU܊817A Gډ<ɭ4ڰX*?LD?͎n v"3B&70AIm7mmv YWAz%)@ZI¯{A,:*lr{[pWfgIR1\ 2%e+H`[=@A $ֈ@%qTG{udLt; 'ML2G_o!MD_7nHR]h:HÁYMkq!tF>y}IuaJl>(JBzRGA5P\K|$;6QXw7?KPgrmI@R GډuD8w0RP!m x߃Ĝ_"_~ɨkj]=3GQ]AQh7sV,[8ƶ R1HP#{brA\Acx5)VWd8Hrd +!.ڮ wńHC;gxJo!(~٦IHKef#sr|u$9dYle" efxz O&~(wJ™_ g$_\|x. Rl)(`2]I_DjRQF :|zC@0뮻>܌O^tQ~]\Gg+}K\}A?}ɖ pxdH_E vrکB7%1:OP滰Ujy?8*Vo"=p#'7U;4yïḂf"6O3QIZ O4Sah$z:>O_}YY$O,)׍9vepnN-RhD!ܳ(N%h[EI:!kwols1FT1B25r=+bl6J|kxNZI@R ^MҍPky5,['n d>/@/Ƚ$װEĢJaqO@bH8/@,W%2m͊6<@VIb/z3a__uՖ(R-Tp7v(JZ|`ziΩ)7[@ȩzbXxPlc)Sꚯ'lZFb\L,<ݽ0zό M&޾!<̀q"=(QoXǢ,I (i+EzmK$B:B8D똻ׂnftzWt"6Rʡc7-# Vȭhs.'dz8e'18##n Ug0SÛ\LdHeťP,RGcE\#D;|f/<$n}1g3#y);&pFy7R.4PbZIW|et ^qJZ1},A9 +h%gӍ* H` #Fdjߵw!ןFE=um9ٌoÙH-ZN[ц7P̒gLЍw 7u5r Rn h+p1wetE:= jRǔKM݇w&W_n#˂(%1(8FD=eiH6&t(YhL>đfQrL`ֻwg'TfQۖ~B:V^WpxK~%z m.Lʍ'5Ij9( }c$ 7I80H:A@+Y\OPbh`OPɧDYvAaIUM S&T 0eO[cf*axd0fsE +Rj[Z§gL5KU U˅+vk 7SQ$) f<߬Bxq-F`b:K7@,aMpo+sknFv>^#5/;~|d42>ށ>qqX,Ϫܰ2N$@B6 }tX u]Q/G6ta>nnrsy+; / ZayгOL uPW{\,KW ,)"Fڱ"#FB/5osdVXƌp/ޔ ! 1Vb^;TK21x2Ti}Fu j|CTH`h .u_^x6 S^*%Dgwsu#ȟ;fe-[q!YR)huo=&fIv==Ӧ2"RUovRn#rC SW5{Ѣj y8!d xC' #di_B!w.,W%8GãhL,lAoXO+:'jy i)W_@$=eh&p),!'%V0E0XHwzKRxMx6s(z)BػPLXH3vMs! C&W(5,ģ:I Ji"+RV/>zubVY#XI; ?77gnՠ\.Q[>+y0!r;+3\naB. ),g vF_8bԵb@:4!A;#ZYk kܖ{;~o+p𚤾JN!QEf6 ~ކ vUsӱ{;sGm)CT $JK$^gfk!9ӆ6:F[SLm#sc ڎqƟ{?nrWϱwU_RRm?F!Єoo|""M}sDo!uk̔/"*^iGx3FLBĩRib=T9׭]Y?RfȖ^L9"Q̡ӠJq Qtmqb^s܇Zvq 'Mb$2e ̯uB:pL $3^JժbMEd!"!AV'&-ba?)dd #אmTCŤEWT'L6b35q9"׷@]O{V EXtL)!x3⟉'ht-vmgR'暡$yҰ&~:[5Rђ ~ fuZ3g3&kM'2t4v-!" ^nP`!0އܗk1%|QD .\)_PZrgY[!N<hrYq@202Z8zw~wz-絉xt #e=\LZ )AEdBZ5V[0tl򍐈 ʸ,:^ޥk[`)q8g(_3,# cZPe\Y6עZú*NsFRjte K!Dg,o 09yėl}tCc4EԠ "%4 3s(`kc\#nB :)՗-8:׮Y{qR y[XT 3UYďHcG h B4?n3 wA- ![VGb&!cZ_%l-,ـœ(oW3?gB"~b5Û?Os?tɽeGYȰtyQ| y+?ȝisypi7WmR C rܫsxG*wV[A~š3"𮡝Uh 7$ֲIO0oLl?#L-A%"9Ur2GMJ,ۡ#Oҹ^uq&_;= ;yuQHZĵKxۑ])Vn{1da缊#u`AJq%Jц +qNGČ:YV/_n6nDf& 3Z?ZBZlq5!+_X%m ){Alq@!eCkYtL} D 4 *Pc, zQ{{&Z&ޫi PNgbnا A*%AqC !F(:+^;S wWԽc2CDϮg)Z{xT뱲)HCG,, N/"01jޓ" ͟6ܫ"p!cz0dtVٮƉ KΡ+ܤoB[>t3wgүsM,pR#]t9j$$D8zԎB-u$u/Ԑ#c ;pXwhp郒 CY[GgXC ,Ix,1Z@9%LUțHM*8QDNK v%(@Ȕ0ge{QMooMJLuѓ:+:B]-(0NM(W褡RB%yD_#͵ 7d!þ%[xǥdc׋y fQ$5<<$S!C;P@+`|K엟/z _F g- ?)[\ډgP_=sq6"%$C7wƎ1ҙ:iEITDLC!_Z $1hhGTXZ1Y J-B:)~ҼVίyNuu )ԽRx*B_m Be@1{)-O=wuf[O&μةsV;[8j^@ cVOFGbuN /fIkЁrÒp"t*"-4V#u7C zXdȯGDu+u#i*w-R$ T »2izFzފ?\SH̦'1KN9.KPwErJĂI6[\kǍngx{?3zKbZK77Q; ޗ3fIv4@ޠɋ7E Zu&~Cs3y$6t1G;&lf-ǒ[vZZSyUQdh=VDѱ V:zD*𣤂acD(qz w[wlN6|z\Ka6zd0ʊU8Ϫk^AW_Ia4ӟ5մ~|Â,UuTe`.Sew͏6C$C)iH: "cûn{hTi0 zjka ͈;%~+#foE0BYBe;_̞Vܒ8(4P5`@iAI`z"Mw^y}=FӏT1zUU`nEܙiSc$-c}Oa{[li6P>Qx"LO=K-sgJU; t4 |[TOK?/]Xя R`bJ'P0a+Y66lZlqB Kqgkg˒%jNܡ4y+j܎;o!b9L^*xVk6X=E,k;:Iq*9<fhCv j`BtF/Qz*YpL4U:mҦS7QL42\EkzmyD{7ao7O~7p> >=<3(vkds 2QlXh]ce:X*MGDɖ^kK Ά"S-uvf8ώA*t7gv63z`at2MyFv)/VJ# U8p:!xkyzAEc юj9lMZ}dܱPw!=/< ]()VDRN֟Ukui!HamG9sYbbIПV`LH6A_އw}qp>QN{b|P LVDs AV)g*Am`3YB2tK<^mt^'9ο( V< %Ma9dK$֑%dtu4 o7 )VD.f|[s! 9x{oqzppǤ5'WcK9C;:*/bFI(Gb`%Wh[͔]T:U224؆pk} SO셔TZ] Vkɖɤa_M~ x&pZz1" } ZD :vF=F!)/GϋQ/<'۸W rdJ eTtLVS^m=5#[=n7VLe76Cbq#pe ~_"G1۵O(q_É!C器棢w<,>1Z +H#uH.BP{E|#8u)k6(Or†3OdP4`YShUl>0Ry^A;wF0Qw !L`w)+&>c'OXrT"ixW,ˉ,T¼؈tGn;<8"&4B Um$Q`e6QiKJxa[Qr6E"cU :9'1 FAAokNCƑ=$FI,OGW~&}7He0} S1Mo#61u/ dLfjA% *J$+F^DlsVP`}yE!i 0(ZNneCC }G" JҢd8f6 P<忈3ӊWV^]+Y6' WYQ%\M楺K6Hm5`oWdAۥR w̯Ǘ/W@ץeR0 JmAFu +ĵ|0 cB[БoۻhE&WwWEOF*-,7&(#,2nwǺD " 䁈l7~Ω9nC_3qphQбK?`#›9cDOR|CdDUsɇB&.N$-&CҨZΑZC *.9uSHz\7D. hOPQ0f4qzj-I(s7ݫO'=GDk{HF+lܓ5WɎ(C! Hzs##1N`C nOLf=^@ ,$#9FUfˀ5UbiZ)? ԧdPy3Qf4yw| ьw}8ˍcH=2=ǭȲX#Fݨ+B,ZG0c4?}ޥ|%ID2q A UEINb:38kv=t*$B6wyl>bpIᵘN7>w W]~mkR'X!50nnp5~*0d\v:TB}icKk;}#K>dh8_ ƒ;cF"wˌnї6TOdcikӛo񮉷ho2fV'ҳ,r]?Fc}̊(x_N{/~\^u xRxHYm2k):@Pe#B Y%Į)>p{q-g8+xk0zG3Ki Պ2ٲ09v KF$2҅ V o񯭶.B- %EN;dRhpC)e*jF}$qbk#Hݾ7"H?٬}ъ }^Z"-X1/jv"N$ u[.if47MGj;MJ>y:[,^MkA+ VzQ[L@"Cnӗ9[tKF^J0L0ȆX>ާ ίrM'Lɞ{oT:zJuC @157\ZYjZ9Usq`J %rLc hMV=ƅW;o`쾒E炎_F<+d@P_Z\}֙bmΎ_Ot=M}*6i %`mț쳅 C9n~)nǨ4>Kl\QVs/b,JX ӌ8r~j62f{'1Ӿ}"oip e寵̞U[w: Np~Xb^ǿr4eraڤeAiV,QIvGi]'(=|ׇ5&rW1]+F;ǀ+/&^ù7i~y?I+!Օ~8eՕ݂馨n ÛrPFdzԈ}qr ۰! ,PAx_Ikb&J "s4cv#3UԶ\1ng ߲x)MJ?h#ÕjK c qnx3[>,R>tDZn/\dձI녗րiH cgTx-4u\ 2dh71Wo3] w{ql~7n˵n'PC`cI+49̱dB4![SkTy¬EJXgTL 7.]$it JEN]FA\E+r>SUv})TH;,5;1_r/v5!l/e?4jeڑ+w`{Xg9ϤA1q j7I]qK1z9;&qsek+-xfOF?v/W}_eFvj.kg4 }H,*NDylRa } MꡅPaBA}Wd8yh7M8DQ6Kw""Ḳ+5qgF8/>X oP}*Y#hW(!m^FW˗\;`׎ XÒ KWU) K &jqG 3UO=l>Q;OEZ g N1CBJgZ ܬrn6-԰!w7m~qֻ|0;jvICHuOӋ"`?7[cA߇Km=UL;B^'B^++$e\I;JHASWJQ<OLluW4n]wG !IMf̚3 +Вd^XYs>< 8-BB_b17%6 2AԶ8fx{u0{N{nN1=60;P;@ڷdJ +.=9ʙ=좯W=Zܾy~vuM>}s$ܿW{(zka_u22$ɐ/]ԁ7V&CG5Y=I\T[U5i^ZF!^*D薕tB;U¹3ަ_5C %!̏.Ja#†R/ !MJja>n&/eX㧸\ӂnP\!%-x@1@0Li.Thot*6a5=s_>>wtT.=? 4& sf*^{GX2Uc}wx\(1D9yyk;7$T=gHIѕLa;3qI9 ;&kiBCRXEW7,"b8u$:lb!,`mĆ#)4׫D 'j\Q:m/0.E7:'y#TGhWp&R 9[kvDvh"TPn m!HYy̸\/^Lٹ(PV|ce@s(, Yܘ3,dj7M4TtՒ6O^^|hZ.<$iV-ZFXDeFMeipf.(V}Am]:۽!zd:.Tj‚M.ZA= P{<ڑcxv٥M W^v ֫+/-D=/rjH;aYY!l<8m$&?ۏ}4ٞH:U]NzpB6*\aFs襰y)ŁDigyW_(|Y#pRӉ0!WHɩla2%{[' [a%&`,ZPVV[7IhC2FVM,:[ƥh(zDzRV}L+ǡ];MyU6{aj>Dqtդjgl࿷zU9@ gq f{->o@F.: `Ui$ ]` 4C-mf4N6BJO*ouȇK.d;DV}L{qU+Tu"3W58 YOHKs S*vRoĵrM1g%\ZdTwL<)td%jSUG" 7oݮN" J필~Ȧov9Og/٦(y4nTG "p42LERAhUPb*r&@ "7QIs*\ZZy5ג3/G /h fR&^J]dRuabMN E hI\xv>_Le W/]C׃N3cPT"*oD-)'sY`A|Z^\|qe+p(0e| jj{m#5Hjt^U1j?D&EvKGy>v͢0bufӴױFr: 4ajwc ﴼa򋆬dn껛`B|ݜ\kvpeN45^A)D Q>\AٺAD7ҡ Pe$u4o%ړu4m?'4وwd#p5X` 䱬Q$Z~-݀@GgSvt"!9[]QP # zIijZ#{6{oxw{>|w?w9x (WF+-9O*[-c֍3`9{3 !ZvRPUUMH~RҶHIYT܅.Y_&ؽdJ}.V6ϸ0 j7C`AK&X:xmY@ ¬ͷ> d/[=@Daz 0Ran zWU2hS[M޺*Ju7![ Ib,(;Vd:zN {氶w~zy}>X*ABT/%"F Ap":(iGhrrN>ix4~SPR1癦;d[bŒR#XoYSz+JRo~{It])=v뉪dlM ]5#kb}}G|7% uY6b,bb-AvR[1i&lڴp4HxOe;Lv?p,v?zNd@SK4;o YO bh"GN9-P6L4vemkL= Цm?/7͓F }S#"/xF!+* mp2-OC,  >ec'$Rn-:*s;b eG#ͮ=ݘ<$BL[zQBgVH+iP'Z_ǧaPAf'-FcRe-)x)߱vbbJ>0=>||yrmOiCݙ dJ_AgA0APׂR魷^Ae-<' P"I2&=/ߩܟ>yI.pUKNw'R@jQZv;yI+۽ܱSό'P2Z26ʴ-mns;q$@ [7RZ𥚩ͽ8ZJ<>/Jι) |I@ weOX&l;${IK'c(j-T~&,?#W>fϊ$w,~!WT zޔtH=F"tvY.!4V-CunUoiѿ1Dys~^=~rE>Y=ΤSX*jp#=~#yҀ (ܖF,J4|'X']:KWpUB~k9;ГIƝ/GTe.^ee^QqʼnN5  vKI"*LmPҵL]0TNLzv%XMa%'6yZo3kiY:(JpOYƞG&$^ {&PGd[֎cЌO7myb\*5+5W%h&_mDk~ZWӂ=JeOaC:憪/A(sDVq欥b,,ƦOΨ!%H* k _N\EnAiyF!RiIXO2&OfNY~5m7/\+wӰ"୘SU8?VBU Y+T̫_ 0adQAy1Qe"";v.!>({J&8;>Ӈز&ԋUyBLd l3 5Ln {0R3_ 7y#xq#E)Ofg "S]K( v=2y+ta.%gm 삠[EZ+ӛH Z%u 1@7TV*RN⠆ҹlp)wa_554Z8nJs^@4?2?lil52,ֆy~;}Yz\QPQSgy"ؿ ,d3U_H2-Ϙ_+9͙ ggĻ*^y"eq9|49$!RsF"PP! B8p'E ipmyHKؠoTDeȩTW5ÆFT7ŌI @Iږ (KQRVh`{7UE%<ыΐ\Æќjq2Op|نV )mTN]_*;oa'!8)W jRV]\Kj \:eQ3Z[wy}X#sw M_3r3H9ral<1^/30%`#rQH=w--wtT&57HYG/oJ)ܶ Q'Da>5ߡq`.Q=1 e|&k%Id(7ّJq㵲?>`%xu] z};ĺ 3bPq=fJ3>US`F4DiPqc*g_vÚ7  / w,06Js* WnE4sN?T}3NOo?^䍷hx*sG"D: ~fYL#\`ǩùP^!n z34lhQe N)),Sd6Ž]YWNZSl& >>&g&9$  i<;O/xR⼶C_G~?Y) K)Z WKһGt+It ԏRYD ^XA!Kq!nYͽԿàY]ޏ\;r1rNe+֑Ղւ"Chq7E )/zWO*9WYF*V|˜UU$5>37jk/Z gq׎x(Ԅ-R,L-݄ <3q!i_FS'6[v$֥&jtP65DO+)] w9+*^ 6v-\ 86"j4 FeV}5sRԐ*%MZ0-{~k)NB!H7dBT~IM HVQJYy+VPvJqHE 'Ou~3ى %u9r-.3`9?CƇOhOǕD},q )}ȩ|^(5|;l&lK k5smuXQGN U-B&JGΒȆo Fx mrؖmAVvp ;D%}M7{ +3$9QevxxNFG:.{RZ/@6a[d\V<I%0v"_P`OJ ZbAh2 Z׋-%bCVg 8wYmGN=VW`_MCD#J=KHS;T.l쩆oiJ?|`LR_ՉH _V ٪;<hVטnWB!.vq,Fvf vAMhXZ3^59uHERXD,+ⷊ+D;}Z#dvLN+4HCpxtSsio?e^l7mO/D& jY4 ցt`c6I|o$H8`p~غk`؎0KS К79Xx{\a4VK`G:Iȏa,Ωx-H$&NzO4%$^ƕW~6\cÀ9ĔKʫ q LI2ĪbeU|_i Vqe'Ss}(1dEG߲eP# ~16-*ҾqR*؞~2v^u( MeE0<ܵp ~)v,)9Q.OĸNkW5:@(Ip8e)Ak '^R@*6"i)L~Z 79ʌzVe%{o  MzgX8Kب:>}[ MN#o{pNQe}Oybvx!~#;ZnI[&cU$+@F9A !^B?>6wK!\nHWycZ+ܤK)E+ov>kމ/3Om7^6zY?Ա;'V2ȗK}m_}}Qc#FZ@UJx[1z9X3ɱA/wg/hH_5*n?!= J*"t mj6$kǙBB9zgYS:~tʚd~aumtTzώÿx0ǻ8,cYhd>$5bս#c^y9풟_s%,!' %U{SgB'Hm+6a7S%:45X$W5Hq@QW0T`})Swȏ$@9Y@ //LqN5@U癕P_}w^6U>K"5X;4>4oTB*@ LӼI/PB. 'I N4@p%_<-+`قt]C8e Eoq^25ב%C(o^TQ%vAл@z-6PAo,.a5+vP}UCiA8 K31] .`ɩy:0$a2b⼎Nj꩕PS1\z0juv? Cg7"-D]}QY[4!X`JxE4:GB]*Qf @H'C򋨇kŪ'w0`U:tZJmJ`R?ýy[y㥼Kq??&( $)ZR8Vu=RCDŽ)Kd&ZJVb GČ 9S ,pD[hl?mtU)"^437mJn$w,9ۨ05*G4kGYc7!%Ȉfv~kJukSَ-JG[JWrQ"5-eg&Ѕm1zŰ&9K6 xE2TEmj9v |#EU-J8EcjŎxӳxdji`j8-ph:@V0 WP4N~TP<'!^hxPt_ۥͤ V01-h_M"l=؄jLji# @%? ej(|x![AB7/“c_pj/%4"讥g(۞1;b&s}[Yu{X_lAa5JXz1hqJum 雷P%~11Z~)ᩇ=bP^N(Z,U FT֥꤅֊D-PNwG_R<S*UqfGS*d֜!5lTMx "ԃ5U|tnuN˵Hյ.( ä03hT9nn alw(:4% M6I)j\WAVb4ɶuv I.bn-vu*qa9 4SJSl'}j%I܆PJ Ӑ_.Mp9ff:*QFZ sKl?E?} vpWw/˻ۄ}=/h4#l2ՌG}V @P&v"Z9" ˋP2nP/3_]dI Z* YZ?)8Y \쥀 X=x &a.oyosܐfKjGnZL_{p Vr_Ud\Q+T z8#(@ Q.hM0s3ԗs%Y=ej/P֦JOTs *#3V0slQ~jlFUA1yM\M"W)?t^4\ ݹt32kE*7$b.ac_M6Ξ$l#T ޠPkdd1e+]OIR4)tt#Ö*˞-18(1"\qҴa OhkGq YwA*+v;kX.Kj >*:$$P =h}(PXeáXףI(H"zr=Tpf6\&il4xӷ-8 /E$6jɡb}f1I"8KnKKZqRhIBf--eh]߶+|{Us( [ cFUx@P[t|Yx? a۽@ip0Na— #;Z2jŹzvG|SB?HqqxL5Qb3!Do*Bu Q 5BOBLvB'?(?w\f/K.|’8Ԅۤ@)a2K;'Caq]F/rc?I'ex{H+CpSM+6wZ l0VE]BXonQ 2cjC-Xz!/+_ Ki}L1!0g321$U?&^Af/n)3i>hyQ]}T<ԴEä//r^6&'+Ɛ:P0Qbi#1NjD86S ޶E} =[ w 4=^cnEec&' ?u`_Q1(D\%'ջ,>t=1}}汳͕ae%`31䨄RN x1ӵ* "q+Mױ: qmؿ7pW"n Wim8-fٮ/ 63P|t PGMpy}#5¢-뤊5Ce653kPv,#-kB!=@_VݶL͸ c Jh+CncZtUU t `v=݀W{D{=}j+^B}v2!tr@uNGݟ59n]h+=L=(Hrf-dYڪ_1sd2}"\ae h XUc["Mk~dfR|׿ouIoS>Rs1K9`~* b{2l˄ltJJ('p;b q6ܵPW?T'U>h93=A7Zstj7{GֿիrO})oU'~FcQ?wt%OF0J~ZobDQk ZbZɎ[#vl!a<(c} T%m=7j\gMrifӲ,iŚa; ȔGNhb3~R"&X6lwB WE&kC*ga&:BL| ˾r߻o]S Cz`f؀_<@ݙ*6GVV)/P(ZΈr*HCBc~"('!J4-)i IH~#g*:o%}rlFyqMB,mF.yr d }ZNgv$T*| 'xzg5O)D! ߠlKv2"Rm#Fd,][Jn"$P +t^αj됗ʓ=L6r z~9&D55 ^ l)xM[Ǚ^1ycLڙ8 GKVs`!Zij{ϏGCi$gcPOp3KN'?,dPJm[S,J/K'jm-|"y^o3MQ~:^Ќ6Gv>LcFYP='x9nKÍ_ST??QË{`$`$Ġx:sMGvJjPj4ZIPӭк(a3+S+›LM/@b9:׻=騾i=H>٧K0APCLlc (,!#-*Ͱ/V8NPA3jBL)H/9kmu>^]n*[>~H+E5uNl^Ȟ`4m͆%o˓;z#[uЁN[Fbivǟ쮜>W586-Bv{ՠN䴪\JjuѲj}ٲƚe<{-=ь*XwbIC_>??\)Lp66y:zHNk!a{dpkVIzlR%c2b72rM]^Ks:xY`zg1XMc/}n=k 3<:yHĹn1=};du(etj‘=#J}TfI=(C=!r.>YFp@FD زĪ&B `` iX$k@p/Ғ4糣 >e:qQ\hυ@ cgtmïq$ۏ˞2<)@]9t{a"Cd 7⑛*~461#v"KY/%5Ef#Żx@ ]y_ ՃƖU^)!VѸz;OVn\k6Mѐv- *VdڄزU%w+POJMgxT(-Zi/I=hk>9kH.ګc_M$T9!jAe=Nh2;fz$xlPhsWW8;3ŇcTR=؁Wҿ 0ZZ!Za|͝a]x|OyރSmy*WS"^ +)Y% |˜zG؍U7wrfW\ m=ŚO Bùu<䷔Ϻ!AR~Ʒa }A|8{{*h̿nr=1IRU1W![u1>is3J$G\ c/M]@)e;:|*νRH\bjZ %$Ke3.NԜ/lf\{[ kx[[E6v \,ԁ,Mo]qi ݴGTh煃~Sz90<.hH¦Q91#b/+W'1ry3lQPJ`FZp1X4<<}rL=uX4~ְfEik6S.gAy8Us/Lg:U} py/ j-q&gXIGP.+:1 \znۆj+ GIڢ!u [۵gSGFtAr΀9[E=TLT,=Og.Ilc帋ŀpm!v1zX31 aQ1ߪ5Np xЂQjs`c9HՋsF['RH9U9>N(U|ۿ]r2hhC7 'ڦχHa{~r w{u͹V !|XW0p.E/NgsZišːx_ѲD?D ąKj!kX<,|zY}=biZeϦ4DAY{K1!XQgB {x>}?W2qaҜxkB#1mGJ./{ d#37 Q2>56-Bj Ibo Lv6";Z ^\t}w}*wFDpyPH j6ıVzwx:Fj^)[AX#qq9]2BIZ Iʼ4c cHrS m#.+Pt])uK@hm@'dPcv[k~O{R%\B(t˒zI4p_]y=pniAuoW0~J6d~ܨթ.=ޛIL݊G+j7W7MWXܜ*ꋯi˖*|#Nqi>JL,H]gU5n[A6)* 0N}zE;5}z82ӠQ-l^lމ"FXG7{v}Ldpe&MZڐ&GHto"~B YF.*D2Dil2'Uo Dj7o ]Ѱ'`? }yʉ6a?L"96zN+`g܈^Z/Ƙ\FX}g In8njߔ{ρmǀu$mYT5j/wTs:U8#p0;(PEsF'yV85+f2}WI+*qȍ&)J ^ ^#B'vC8%N;^]L] Ì}†.>AEso/o:U y* MgU@>d%(7!U@r,_d!GjI9?Fl=,d1gutꦣ'2 а{zTR$_Be9jmo +܅~I .Z~D\.^}:-xLuvy#LƷEA޲"I<pґk l_Qß t҄)T aZ(-t|.Z򛊨.U-|1H]܁4-` nILHKYqrx hb1}rebEl[9s+b E:.:_Raޟo $q\ee߱0F{vH%vrJ@:v tw0~vyS_<'Bs\qNLj~-aN`Ji6'[=?<)K"I DHTo#m$/jxLMb-FAnrCi"n(7 a^_nk~3qux$ 'eA kOR>!“ Af>>j{R`g)>]>ε fʹK(Y r9 bkY{ G`2h^UjFXCo,i36w6k:#˯[*l`/tlWݘE\BBL,r]"cEԐ )iSbKq =z$hR/q]H+Z!2fiyYi]HЎvG '!heGhVoЛxǁ|jcbQ?(dd htB#qwd zL =0;Drr_65j)*㺥}$4g _݆bv7 n2WAv)$6T! o DJ8L$k'("s!IRפh|؈' BZoA[X@eq+?.Dǔg 9>Av?>kH"j߻e͍co*YpjF gY oOj=dXaˈK}һP= o)^ RV9)":P߯hrTHwm3)l Bő0a wO3<2RQCkiT;.b5cAP0m,;WC~$NȄL('>vC.b>^&MQ0jsxEّ+uZ[ FE0Li ɚq*5'W 2 0a*&5&c9KɎ@3&0*f ú&)0dP0V=]NkpқUjʊ$sUy%>O kEK?+Ǝ v[ W@/2$FyA.^}<쮒ev˗? Ã,զH&kl5Hj(ԗ~Q& SA4[zhYfATJr=xUP}w]Mwz?? rfT<55yHLb>!W"p15=KDTVEWX/%12]*r}{8" wOOmow+sM%)Y'bA<^.CTڢkT_0qo'v܎ĬϏqw}GC~q*ul K=W^xu6~ Y ׿KoPV)VSԼҶYGB])+\_jN٪l놩⭕\͟jmvlZh淪 L#׮|2^}X]ui:ei;yFa|nl7 tZPyuG3\ aŋ3ׯA"©c$c䴣Æ]ZY!ZbS!|ib}xss:7W_>G}00G3OꑫBooKY4*H y5,gt>lkXذ=7j_h/= *pdBH 5Ľv7]d=7|n\Op]v~e?ǡ H8Uw$ $:@SnJn@]Rޔk}ÏmZ\ÂF(Սr,qZm{][V랊3N1[|X:Th~-V\I}@qL63iJ538WVkMꗴ{?9q@Zٔ#MZT!jJ\gņ  hPӞmۏDӍWouWޭa}SGUh]:"jhxb,\n:TΌ/I̒Δ҇5PZ!# 4R!S#d-Yט@r+_]N$͌9H$% td0氬ڀ=(l!XY6ֿ[tQ @K8],4NigMod9% ^:Hn'{2*o XhR &vjBK;9ď~$:QNfƫu؞&+<~T ;Ϊ"RTuokΦPw!n*!x&Pf GXZO9W!;%Ku&dZF:Rtu&,Zd+(q떎8j[[ .JG@]^R4VNν8/q} #Xfkdab:*Oئ֢#3m,Jh#MKRlͅ RKG{z#3h>,xEGrH(@cUʹi 7lതŰc{:PF 3ʳN|1 E?j'qR+kQњQ%'_ڶ,YNHؖAr.^D_q.nTo~۽NxqnPɣFbƖ [%> (h X GE=N('hn ԌQ?!3( }$wIe>\HzN:Ց><4H oǙw~+pʊP])%s 9 "ƍXI;V` T+P >ݓ칻hϽ󭗕愰o+q s׊c!m8u* hVTV1imX?kL}R3O^hïsg \\%-;V[P)\QM߫"*=-[aV\zInQڛ}s's LjU+l+:m?Fj`&tRЎjU8Z VbXhD{+6Տ_1\34tKJQT*:N~Y9fD۷Q(P@`.tK~ WCug/+{*o,PM-XD&ϊҡlaӅ u-[i=V&$# Tp`챏7{{;.YqXçV'a9)ڹ !ۼ,ּ0Mi~dr77|_W6zy#`=V^=<٣EmQt"5DaC8) @p#+hh~{99?^⇗CJJYg8ijSNV􏅴Is)Z&ВPqL!r p:NkUqT%`gշCڂz~٩lcqN)D ŹڵD__߆.cao rMoKɀaZ p1E. ;1к lq;cVcϮ&]?z "P**oבhe%#hlQ9]-{;WoFh/AK< yWy~P6ŁG3 ҏݐᲴ[.R9!:*;K ͅtq`Y0Ӳ=Si .KگIp vg)J=mP_XJ[BneWG]HUwwC_?lϢo<1`ٴ/XB<$>^c!x 01BjNkJ3,i0C~Ner)2v*3_pWQ"5mvww!܆[+}3}mqiw/kΏ4\lZXy>^dkCa5] fugd}*+Hj+|U~=@ov6Zd+|`x'YDE!*+kq}NpffG| C;؝Q9{yPEXM0U2BF:5},XψDeTn윀puKΡ+ .yxO{LO1X#h2L\LB Lji%Dl[%_1]FHcfM 0H0U_R aYe(QLH&DIE;,)Ye1g%đT[//f =Cݟd h'_UeK|jrZPTY@NH"kNHv>ȯ%"V^F]eX6:R)$+94"*J$ҵ?غNJ憛lO.뗐8.rnb$8ϒHYI%ۭt@ZPŽUz:N<|Y\ 2ܸis3YA_L@5eI@T\ 8#9l$"LD@pQQtL4+g0~n{4? ,SJzkU6P2O\&*/ ۓ4D~m]t q;xjw՗\J+ S9L6Eג)+Clbp3ᚥ=H*-7[R&ǍGԶxc;H{YՎ,!;SQ>kv% XDj?Aᦌ;'k;q +VZm8O^Wkn(\)NT8Z‡SzW`'BIqmÚ;)AKymiHy-e$9kkի(j\H"kEKЈJG/٢~lEn!G aό\/A㠛I*%ݹ!a72f_o=T@M&RũswOkc7+45F-Xj[zu ڂ#KolEAX@ Qh&UJ,m$3%bf y;jJGBV틱5,{6$-SPL7mEe-2 XtIiNۇ! %@Hhk AO 4"S\bX6pJnll˰-*B* 22[̀I۳ϲ9 uJޭͯE=A+9nYۚK+c-F8؜jo{L)eϘº*^!|;U>.zw[W@- _;탨*C E 1 `RRK }+ .ax3 Ril֋ P_KYfm;a*)-`<6:|H! ``;x|WX|hzſEx0\<\̰b:8U:ѼiѾq`YM/VҽtHE_!=SǭfC02q=$1e wb0W|ys 0\КbDg (lS,4(P_QxCp9ׂ һ$kbg N[eP+VxHOHZɜ~/<>BF0}Z&ډty{1*R:?@ws(PbȄ$V`OJb$`20}d0J ֚  0N9TD<]=9tcXȶ͉~8p/l6Uz٧-B3a)hrAUOSIE(ՃpQ5ٿI K>,W?Plaipw7?7J97vM&rU'ۚ;Ժ'>'~[@^*dl+C#T/ǂ^+>|18g9vN~-[`bm5 ɑ *ll":ЫsJA,HY:(L*pcn|N*Z M'sF"}}mv[3S|]瑓Uem$o55Դ+ $ JVpg7bډ e;v6D K[N nc8,~ +VsV"4=Ǡ:Q.oIhZb;Z®~)XKL~.8.Z>us+>Jq-Id>s*;)gX"K3wc  ?O|eYZ0ԁbn4`P~,Eڦfij n4z7=GW:⼋bkAp~R΁=lKtUqrxrj!%fpx(ߛz}5_onc?>W+ 2p%[W,5Jd2QI-w֮!U/j cX%HDNGL"gN*/"T9`q٦Uv @h[ը OC~ç.;f=JS0-, 4$ x PߑW!%'[*\!4"J2O?`T-%0ȐQVw΄v"lOb/H-=0;'TAC9~<ɹю\C|\˅6כ#h_5uh/s%ԶGNNZk!KPA;+ l!O(y3Y~&-GN,E`ѣo}BrR|(}*jwEgZ,'eдBk r+SCH\$pݐ,wzj݀VI-H Lck|rĽj{_/O$v"#vI+8 efRr[+ib*kf&骙 'BNw8~ ݖ9q}j")Bf{a['SgR@^z+%MDPg&;kPktNZ[8a-}$]Ȉ~Y=Keqg޵“JNh7wa 5̲O^q1K*i[9kE2g? vH|8.K=@4s BjLDඳ񜭓2NM HeņU妱_ݓ0Ke4xֈݖ] |?_7E<ܾFx'='&k{,~Sf ODJa#;P\D" 0$/#db3,P06 G| g/Cޠˮ1}$Q=o_cRZ @Qjj98wu3]=OGg|Q2[z[y41i!t+0R b6QjFȱ3mKA[髢WƝFq#jeI5W>Pv^~ؾZ:w1G>du<~x!V{wWo |_0ꑣ.@2.qLn BU9Xa!((FZUٶKL]!]f|X,N݈xrPA?n>?^qh/Xvb;9 5y$TXhѰ*fAlDC{Ah5Vn˾rc aZg.sj+oR"ÕfP}(G\G#+J/AlEķmhM*i2jDQ4(ǡQXyVop}#=zOar]o7PP48gz=†Lx2STr_oF6&nSѻG'}*qa]+j84Ak¡V=yD mۋt [b&<!`8,5*ڒ斛 PkXCX^li|g$$4E|Q,oA˘q^` ksLAhs부Cr?ҁY#X5"h3Q Ƴj ^tp>=b6ŃtSQ&nHQpld.m#řs=G.wώM( ;RujIF"1ba)RSyeo:nz@l<QVe%f۰EKz,Y źj۵O>-5hy굂%zE4D!C~,)0uUv>Jѭ@D'H54{'F>bM}2Qu#'͌.CXi+ViK6ytEOq62L$WR8pXEeWaǗ $"x's'B2 5J:@lsܡ`NZhۅ`:=_2au':bμGͼ<|žXR3qԇ\ <I]Hk,o&^Mv)5o9jFI 6N`cg٢ ,+4i[G?tk6^|XJ+Ir ug`@t"#ٍUtޥE5%*x3 ?(8\6^M!TZ_b,6K46&תf`PJ|kJ*DlW ͧ]HL}=K&*^s.׊F۵ԗ?rRsZ"# 6\Tk'Ct)U_p_'<\+U`aPS%24/jHH@0.f &'/Qz1~LFێ 8˯emz ? H7o)`Gq@K('P~2ل,O\-ɂ~5J*1J%n{BGw8ȏԦI?KzāPw4e_%х t0ڨtDhS`!iv;Q?xrk]0㪧GCi')h'TOrvxЖ5{Vw.brWϹԠ},v 2,F{|8,?R  2AfībϹVįnLൎ_R&yt`j gkf.e)J4֏kbi/a]}Iԕ[kk]|}U0sL C9Fv>Og_PQPKe{K*口v>t4񋇃Xـzݶ:R lyڨ]̒LP'<Əx Ie^enTA2er7 ܃W6!r<]7ï7WOe>>ūKx=ωa/џxN QKSKQךs'RcHBpS@^0H%.3Kdx`Z#Ajnl*Cg@r8{؏Bİ%E44%Ny6t7xw*k-$J@6)%(a@.˰?]p8[|R'j=6<Ɋ7W<+' K#(U3(а+k(iةbuhD` ;F]/ \XuSfcj0 "Y=hgi*vdhɴ<xũ2րn-Oi!fs o~:m(`˼.갻_׾YT|ƹk L 6xv#CpޱDGxVR:q *@%p*.bv >z-m-}H{/RwR~ǒG/g~/6PQ_+6` K_+fK#Fھ/z'sgSSfl;'e۷li=Kfj,IQ)(cap$ԒiUxH1-7`UH3@-qVfIC7F u'j:@ g? v&P5Dh mႵWEE$jtFfcWNPRm/`tuջ;L*$o"j9 ]@n{X6kf%ڌM`/wV夲+1a8JκP׿~n=}Ke!KƬ9P"\ Z11=3ÙfNֆުB!2.?#3KMfSQ1{V$Ll,!6\ w2  Y-;uYKh&=GI Li^15N*I缜J{A9Y Ya8&T5eD K&vKv@Sg3k_N=(I E4Oљ@~s [;lP6YZa2)("xYpx63ήG`].ezuw%C/ẓ;Q9 :I,o<^Lu/F ɥ4bU qVD`BCƎYJ^e e*3x (T #úw%eO>]-.-P%UcnEkmEfkz#vv[>Qjw ?W`fڡQ2mpҐ޽4"_b/Kɤj3-8u/5{b͗M¦ rS[z-%ulvcK$ 0xT7 gbHH8d)''F"Qs,}sCY&ݨR'Yy5jTXKg3q <; J0V㌂5,2׶)(8y oyN"\m0X-6۾LvoO(4iF&r1z +NMlTg^%l1VK煇oWe~K>ҫnڌbSs|Pw(nRu[%S [eiQIaA;icV^4cfcp(^ U%Nj_3uڟ% p_e5L22ag%] 0Y#@Z_/<w(ė?t.%f.B= K 6c|٭wWTڠ\sRMnuJn^Vg nරV~}on֬2R|[|#>\L[ŇX?z:wTZ/Ӏ8_xK\|t;ipȧzLɽ)oN[ ޕ.6l4 9܅ SN$ }EΪz$ΫS1JLK5D|i GQ@3smu+/e^#=lQrX,|r6=1jRʆ-"[ (Yd2EAV"PؖdM 6*h&ʛAI6|HI\z[頍$C8<f>q*v74>}4z>T.{l\j`fUx6$\ @Dg!+mX,R?zlr}&>@]x qNnp8%2&)45KY+L*lTQfSrj Y_&0&Vd˸ZHDG/K!˨!"8.+>K|yZΔZ& *bD]kY-Cu21ث}q?o'OGB} Ll4; n{\H q X-̺!>MO)] 1*+ߣ?LT{?xDw-nIcFԚ@b=1+k˵f0 ް"d3{ ߭ PzZ/Z4+ʹO٬Rý5@Y_бaz!H3K클ĭ"ppn̙X8t'9wקۙC_|-IqE=buvXSKȁ!f#m1E$eH<&%)*I0f7ޞZM*׿e4Hå7DVD`ZqPɴrz'P,Q%Ƨ%䇵}(1Exms஫>P?^g<H.V7߂qY-fZ u2>j#\VCS!Ng]Jğ+*\ߴbx+nRl`_paȬV@W|q d.A(MT9fdXxtr3֊(wBfe]e2gͬ[Sk{{NiR^3/](wإ5e~̋/R,4%Rg_G2>B#!>zE;ym6Grf[)lc&JeT{]etP1gjURxV6;';!*}C(#:u@| s Jj#iC&a8E^s ҚF}6E9uM]0>О<<hIoN(qPALpdCv@*Ee_wmq8X׸1Utb7aCxF.J|zv@0 ԛe29 L? N&t<PZ8yd:פ9}hw3\Cr蓅⹔XX"gaцvZW2p͏x{<|ʇK2,ܥ7Ӓ%T}1)P^ 2zjad,=gu^PVt0K[Ӵ;؟K53R+:᳻VH֑X:z>l--ZL4aͶ_G8k6WCSng:dRըr?@~ʹtXHth};=ޚ~` /fc[ ~֍Q7lpj}&6 ^iX2/,T'Il(5,[wvֻn=."7˪̐g!yWa#mx).P6@No)!J!J:ŽfS>SӦ!c#zS[7_d/LhU ҵuq鹡ׄ/( e][ڑE-թF)9c==Z01=:}lWvy:ͳMf*:^UE'0AeH( , ـ"%(Yw[z믮)3;w[ASX@~"L)R-Hu."(Ơ}B{,YyWI@ RcRMU>`) 2v$,k5ך=WS`lF[3Ng{<<ǭ̅l)7|;.Fn!'K {2}9da |=8.!r6@TUAę#޹X$ڗw׆ەH+gio!g~͜ i01A-+Y)2%圙F.',H5h#/XdPG:= mʋU e,k]DeSM٠oHN>j >*\H ATWg˸Oΰn~-Ih&yBӮ'?j(gbaٚVa&Cޅ&臫~U<* &Xsb 0̼u8vF薓i%J6@K/U̪-UF/' R3E5nr7ibF!_*Aecz r%bL(9a,mLjţHRfd`ЏK}IG{<ơsL℞X[gwM<}8%]Op<2*轟A ԔD$a DjO1i R,3e,X  ^ݬ燻x a7§pFG C_Ythϥ[bZAIAܵrފgrjZen[T+t۶[_ݮwl\Gaol~|δ͇O;RyH<~xԚXH%A 9 &,JZM~2Ҵ<#|{uz RΡ+"P{mk A Iͮ7Ȭ#c\k 9'$#5i#P]D #[L3nbя&PJG{Gx.:| E MZ-Y+xےrVHl xb(;~,\q|E.g{YʦQ$93NR̩ȯ2'،mMTˣ :"&Yo+$1lY3b} y :ۯ5iAΟ)tS0\xu \IWNd}-"f Y{&Y8q={GN%R2zpv^d[ rP g76 j!;gɁHJ|dJ/?bXd. @%Ɔ>XcsQRBZH\9ͅym5kF))ή?zRhCa_8+rd0lw!TtT^ԦZ (;@1C٭&AԒ;gV!|FX:K+?: 3 M6L[3zfvz [` RDVC͖uAc)_,@I͘pI)gT /ط@:1\R ȐLu=Oj.jɐ֒!]Yudn|]aN?:L:Ԍ[n:)8cڌ}fyI(Jжv.z 5?TOhHƕ/qT (]x<]i3yzf:k V0i`z{,L, dUB M\>ܿNo|qFF2STk,)V zzJ%{]\֓^VH"(+0Pv-`QcWŶNsY)`+{V2_*-]Q~_wu7187šP7 >f>} }ap:,x3O\ԣVLZY2ˑyՕ,q Ҕ3,R_Bm˟¯WOclB’?9GC-jV=$zN=a>Z?1 Qc8U1$G(N^#Q匸@ 6 ׁ+@-[˄o0[U/ @^*zx i:Re]oZCI]pz8Q$`ֵtUA;Z]bD(J|<&-aS {񣏗$N};5ըT3Z&@t-լ7:vn!n\ǞfRn70#lAWfвbF}N QDW04b=p;UfOOJ0`P~s3#`L˕v"HGYV"hUEL39"8j㱪 b Q4QJQ)R)}Q7~F?,}Ltzvrћ:WF"fp7[@\lD"Z.3EG~?hʏ?^ǫ:\W)?Ѽ`?.w=|[Èx?"R+Q<(L>_w]_,Hōٍظ525rdB/ړ 6:4]0% Em h$e~qO4N^m,:e!a,9#^=M4U%[KP/d-p p]a},G4ךъjJhv31яblm3O QznퟲS8O$[&uiwmwuk>˪LRfs"F!.MJETZ6쐁Lt,Ĵp Pİuܥ`޸}ŊD^%P8'T>cS 'ŀ1[{n&E7wL{!hZ廫iCxppzDExo.N^?dV^PncD` ! [\#ޏ-OcSÙG<#y쵉 ɳhIҩ 3D *Y~ݨIQŚegTl>Ҩa[ѧ8Czl@{дuH9٢}?VZwZ锝m9̅xj`*&p]l+qvGyjD1tDXF+ v.fD vS56xSr-S!}CP~L\k:!dzCA Ҋ܍ÂBVm\?~ aw5\ބ]L=*bU݆*1+jSl7@J5\md!s-jZBSY6ixaZ\|n<QGO&ePZ3/D' VRyRcIͶr'r:;020dN~A?ҳ?Ez'5ϼei+; :n+`fCRcIle!OUx͆ < Ԛ{lb%b}j4]%C^`֌u׍>Bi(M'%=l1P}K*= ӈ4`ݸzD% SLgz  Ɔ 6-@@KS]YJ3K@+fRw]_ G:<e|u9HCv,d `C.#EZ%sUo&LB 6-h8@ t٣Bh])c){wc[%Y͇2u^-("Q䷆ &0a\ߖdKoŒZ)j,Badj Z&g8Pݕ/`]+VBGߵ) rdIpc].fZ.%SzCy _h*>:N0 Zvhu4*д%(;22,`[;;Q, UnZJ ъ#׹mOuo%J9t=+S{ +=wexkEJ@~-NɛCB!QIU{g4{Lup%$r^s[Rπ-t ʑN3WdY-ALzH %}ȮxK$9N^d**5qjZyXT,jS g3g4AQ2AEb+C OW*p[Z,bolB.ΤmLl6NB 3g 6gрS@B s H^ ~j%$>+gYZJf9Fs d׶BWxJ‡%D}Ԝ『ـ*qTFIS$( :Nj,(%bUt9ܲ"/]JQ=쭬r>8VPA d1ՊiL 6/Ez<`akdeY n )zq֞A[2y x|pU*\gz} i:7׻~ 7}A?NCpw΃ZkT%&H:i(3jK`bI4lt!=}݇_oLo`('=܆RōOFoI8MZx{ =VZS~,V-+o[6t#.*#k V.pB+H 6쥷3q$rw3@" Wd4춰Xf`%2ŏOH!8Iym}WG]gC&Ͻ!! | R hZJA%pAӧ(Ek#\< pz(LHynߤ.vYf)BboZ<WI6DG._b?21B?Iނkx;b;ˠV-:[r;ĉ0jXیDgCPlxnÐ'19I:\S`bLy%ضtkW+ފT <_<[Uħ.fUC0#r"@vb&Ad9ൠG : PB9icD:X2$,SǛxv~Ne@v Q{:kqyeO}pPtDʴ1휯B<'В9;jđΏvѫTzvmH?J!wib. -#?G@"moؠP;519(;wu<++vwmE9 [)FX,j㴬 XR܍ށX {MGj4It [XSgZXsU;cz+ܪ0a39qC ؾof !2@/V R$.H\w5(.~ֻ\exȔG~nur^Y`ukRaOսvznɛ&=RP[WHC57BI* ԫ4 {(=cոWO=XQ/I+,pc@٫o&]/ϸ9HKGkI)~~2 G7nr  .%-I|2L\^@ 8$q #Hq솟R1q,1bVhJGZ%%,# iC+7CgI&)̔q9u> )^;jBYgnZ\F5S%OmB/.PcmD,>qP9Sׄ[MmP`V20ɒy|8|$.sYQ!?R4{{cd2]4BAd)jFlhߢg |iwkJ4'S2G<ڂ`4u'(Yؚ) E_~>:&91suGpULM~N{"_=h);aD35$x`[&՞,e"9B3{qz. 2lBotHpРav?vHTA̬TܺPV Jq>ZeQxv{\P&/Y@:ҡI]ş yo<8=uęއl Sց"ʓIL.=z" JoeYVlMOk36$U4inޕˇ,r3)y4' @W|itnuwRJYѽ>yo &Y O?Ҡ O8vJrM,:co`-+I+#ʏ)ЬJAv:'Ȓjbm?' BR*u؝k^+k\ }[ذjt(u_@@f3d|X`(pLtAb$-`،[uXa !=fˑR i.kG1:*;b r D2N!ZDpgq'Xg=`3 H =3>X&+.PCr(O RN d>`@yu'2yIݯYpwʿTY@~0 <}w!-؀MdnP PasXAlQr#|#Ҹl4#w"wnZ,agȣNk Lv _J\3@; \dժ6p+a<!UMPj2/06](z.ua]E HHYt)?ͨFG<6&r>K1,^]G@8JVVb&98 A!e~{T`׎6y}?Go|sҒC_m$ܫ:j`̂խ8F4 P#1}-ؓ PZ(TmKD V TSBh[!NOKHRp2a?2I$3夳ҾeFMN5_JaP}㈸x%0W3"nږ((f]d+zƪf~O" |x [7<풒^ E 1:,L6 _Ӗqë́yn\۸?4Ow^;%o唵m^2A+>8:K+@!̪l$2d`V\B}oYpo3!i4+ɯRh\L[Vv)  @-Ń聂9}m*c1W,b(j| mm_r럟ĶW~&rOG3"3d>_?i?Ǔ*p l0L'XAGrGg"]L]qլ˟Ud[14㛠'ųrp 7Z9!!3zTN"b=% L^&`UH~>^]6b3%;rJdۨW1wL~ Ve>l0tP`%U }ͱS} JDF,  sWrsXu}>A%g5.cڞcuZ-k#Ɲ%tdoQ!_etQJP\ \/26WXFyw]}rp~].S M>nS/UuUI%٦],vݰ^^zm|^m:SO@0y @q7{e:i۔}|-_7qp=3)"[?[]}ܻus'\:b8Mu'?MFZsIIӞK[%F&)B Uу)+PD8ewM"X\ k%8?C2?Q'%4|:3oMNdgMƬ/hA2oPϗS 7FQE{XG}t;x5A3 @GkeSNKa;ѣvACEeP/h)q.i,*b) ?]+S&m{rn(z,Udi&{SSqZ6S%+H$Qv(%'  [r?x(@YH:?. W/]'%?A3Y9GC0rbXK[ k."bRL*//*5CyjU/RI"9~Ly'!d\B^drdSt߆e5x  ՜˟¡[ewĪCÕ$[55~.wB&ۤsQM@H~r {ܳJqQh,NJ!D֮gc8YG5sw5nb=+CcX?[0$_bO\G axL Jly6&)]U^6{ H~;];t_񷂆*'.%^Y;f.U+tJ* zŢ|D=TQ E“U|| Xn0zURΜGy]q@!+vH 7@0 ܧZEW@H"Rs(1 zvB.%"bv"$un5Hl ?auG1F}VeNO:p+9|؛ н8;.ݵ}@L00Wg2$[ wĝLmvA b%]_w]byci3LhTgQZdep$ѓ%3Xn #0ZbŢ*yjA=6F~~? ]*OUg9?:obGzj)Jf77z/J ܯϤNJt'Ƀ$KTal5Hy-iG>{F9z*Hy̎_y$KIܣKh"" P 'nWg$<՜-)JF u$TH5 wy~ 틵 VM*kcN.[Fy243MEP}D PSF;¾@XnHi>4߸љ`&'T^ =eޅp@! zl/<@gS(gX-Ã- B¥R[:ۤ7F`=ײOҖǥc6jl[:>d -ZZuO[*zRSI{IaQꌔK } 0}j0-\פ$7HQsWO3t UnV:ϭR^/"2bh-{49pIF/xj.VlūHYG@˘Ͱp̨'~@e񍇏Gg5vS!_<*vS&d&%ЄE֪tHY"}?glw&X'OWpM`à HOf-[;}pw}ϫTz1D!iᰓW󊠐%5?FV0'>PJ`B}t2HbURMHa$A‰wm%[T^ `jhKiV8cM)r0]t܄?t@5AO惤k{".& ܡDCظey|LrDf6R oNj۽ruۨS(漶 †Uvڑ.4ܟ_>5)o,H4gS&1%K v.`MpolmbJ5͒j#1>Of`I^3#fMnA8Khme[zcS9xuj-ahA[AuaUI;q:Q[/yUq֯T_ ;9EqC-Siͤ=S Iʎj#8-) 1$K"$ٶBmdFRQfi\K)v921clUtrSjn^Af8쏻߅'S~A-fҋUCl:Cs*Wͭ6rZLrtp'{. |Z Qi1MO~WSU{鄐GBy$:%U Go7c(w|lZe26UP7[;Z yJRPO] 1Dhz߆ j,Jjz?#8. TI%`h2-s8Aao{Z@}P݅|,"Fmy,7.~w?\~waw{e)Av:\cսv,3\Dͱtd)[|"ŕ 9):Sͦ:/I =& BqQ,Pcʅ^C(PH;E,@f3P}٧16enNɕ6{YUx[ d>ZF1$TRTYIbzp'*'g}R6 y놕ׅEgCo֍x fvJsf!8v"2 sw0\m~it!hH$:hyL9JVW)B",КfHf#Zrq#+4uN!{ԤB "D/=a)WiR&K3S^\&_=x5Tëm gh'*.s|1.^_s~o7@ɄwWz@VDQftz %d:/f$K^&m;[-:q 0+v~J_ǜ꨿u)ȁrp6hyǍ }L j}ݬӮlo. M^}bJ}?I™\ tbXs#RE"PnPγI{\s\ L(4vMvt.~c:\t)~b7l↶nm/fLp]6s?هoFG]>sC{ãHܵ ussf͵nu.4&܌J0(L̎n}dI~8M5VYd%2~IWB5,ugI򍯰K|V6(TK䪇A}L_'ev!7wwuѺ#_ oi*3]74QX?]HOUCmR#5)8BV6IC@Ͱgdag:\N|*U__LջgAdnl흑/bhvhǓgRWQ-҄b2'~mn߰n}8[M"w67kE'Bd 78Gn}jǣѦSFK$B$ pk2`dC:;곪90 ^r x6sNRBU]*mj y0ln2y qpeBI zhz!I3hxycvk e65lTVh |֟^Qo]9u</K r(gqz2!ވ{la >$txmX qnr=AOY7ҴCo>SPecfTl@Ђ8ZnĮCvz. f Hb@->~ fπ# ]],"y.A`)[K6+uuo 8ݷU|{.S޶ϣN&5ZcܩZV[mvRe [S39V\jp 1^z59I'P)3c@ kQ %aR%MouߏF K>`M9@/\.급9B`aM?UeUntx]Qq7h>@dz0U tTf5^*A*%Bdz.pI*dW(cJǃAw(e:Yީ˺0Mk|0vC U),ݿl<6Px:݈ ypZz,h2=PC!i qylc7xWF[:ޝDLI>%`| Ld0ش%9GJlpK ?_sIcbS )ɄfV:ȹj$QUD|n!̎F!cAJ]{FɦH,bm<ٴ );&M) :\\xCl:ut\Kl BOf&vT}DUn,Ѩ,5 F*')qşLQTro>xdjZ`=gBgъHi`Aa+|Q4,@ zP.8qw(r],޿*`b<<~j7.vOf0gu2jmϞ8̡LJK2; Tpbq⾎vrO5w k莳ou~xl[_;Io0g0hk*q9ZzRRo$+i "x>)UmZB@FS`\7 6g# PL98݂-0 *HV>H4gbB}J@\y(58CҰfIꮙ%/;ttRqxC5((b Wm/XS,M*GZHSO\Z=߶.\7i#Mܟ5-b8RNMk3SM@j婈J L" uڪ6 S0B [z%#-]B ][ S0-FT&uVRIdE1󔊅!PuoR0%,KHԶ8@F2h1 `9(.W/RzoiA{1}PLT9B$6 LsK_ &:xaIjFqa2q;?Plz]*.1 q'"+K)l,ҵmmAu!(ri+ou!/~fCdB_0H ֢NREa +08Is 9O/寯 F[yJu_׭ݏ|h\bO[ fWSTRX$q܋s9qf$k'-̭Orp-?īѻO?=H ~RPQD_UaH3KȵցvSewlg~*$#G!νbp/^]ݿ?z6!?=v &B=CX7ik"o6gU܏ګmf-(3Y4x; \w$.`>ՄP%8 0x#N z 7'pޥ"4+mz K6ri2&;|dM \j 5d#0By8رe:h<^ 7J˅S> afv2xd#FT.L$(5 j/1ֲl^6TYTb]\\u "B G ,Sq2̆Fq.^Ԙ5g4vIJWt(43%J_GVLyrFR0VԁJ?o%X;:_mKz+ġ 5 ilmBa8tf} D\ 5z}/w%nznB2MxI|_YP [2`I%'V%W椺iHWU:0>\=u#+S8x$tr,ZEN1%h[ Fu&VeI<] Ar?{@U5Kw sg ]) V,elP^ɑ9zC+v+HrgdY~|ҏs/\3noߘrh⯗mN0'#heaЄ@hmb+q%2.;m*s.qF_d$/?;*ӂ鳊v3j -baתc\-{AnsJ8v/ih"XX΁$=KH#H!Vbψpa}۲;N Z 4[Q5,c Bc +5zamXM_``5:+)Y`H<6]l[;<jDs@xH4mG]t:4LB(kpVl؏iP&: A k%nZ*$L𔋚 uhmS昶l'`g[$a1ͱmKS?} C]&VPb̵3 )S.xO,*ԙlI;v2Q3ⴙ^jZV:]ߚo?_{D,H ğo9Ĩ=-wgeUA5"ݨY'9h>>{XQs}=z6ԩ,Դ!bx۴(E䵦Db\;\XXp֒ΪAP/W=H1~zDKFs@rK״3.ej9حE:FhI;"]T YkNލXR'Chx{Azهf ?^x l}&txT(ZavOȚ:iTb&ux2ñr:,<>v zՌ"<%k֒ϻ]6,n AMȌ{xxCA\JV 3byٹ]Q@Hs.#sz崬!\r@JrFXH+. %_) 9%BOaQ:N;wAgNG8k32@lyՅԘGN9񆢫fԝeۭ5q ^鹴$RLzRAﮪx|vgu:݈@:SlU(@T nNf[o'"d*E4H>t%$R*xus#'̒k^KtoΗA_k$*A,֋a JY|PA#s)v/eD.TK!ffΤm}KO=>$ܩ%QK`ݤQDktZ:jU߬ML(N<,(INUߦapq.4B1!W)L68-?|ЯjTrm@ Y(p^?C'$ A4kiP9F}7nO!~ @F~uY%\ZB@.6ՀFx#:.nU)_ pR$`޽ٙrYK(<܊rvII#7pa/VN"ayԵոO<^9QrCP #mk4`(c7V%A+''pcO'@Ϭ3Гg"veҦaQ#[Ҵ`KªrA%d4/gvxi\]ۛOٽA@s|wl2=˥{:?1<&3<+bͰi1!Cw֣Ŕ.g!@"M2B|_^T[;?>.İ ^YX!| WEb \`h`O<#ttS,)}`;s}p;UKOCCWk*!>ML[=gEMd}|Sw[oc8 Skѓg)SdVq5d$Ǻ%-}LDˣA=υO&V,{x(rFg{fSqAJng]#:ԐJ`;PY }3,3`[Mб gZ0E" )C&C>CC0,JrLbzJCs9agGJf 0(w&UOЃ~4 r)(V߂sYQun]3)`aӌ΍k2ԴDAN5 TXI.Ju"KiLqZRC{Z5ِm;׀Xߧr{M)zwZ=(՞nhn;?xLEc7KpzHT9[km*۟F:d1QLUխJP7j 'h$¼Zk.'H[m)Uy-Fݏ>/t1DP4%2Mkbιb2_yE껰z[/R9+wg(nɻQVȒzlE^BaFBFoս-6K0  P X$p: ղaWqM cz`wwFݲ>Dtn{qzыBӘ>abL\Ȕ1D v܊9>5ZdW^8( vrg`~$R㬝 p/( PQȋHD?S1";;F$mC+Pur͕@WCH/>Xj3$#ށ*3`=PpT44E `|l8aAP+F—)x O%? m$}j+ʠ,v7 ,qyryuw < Bmׄ0VD/\;_C&|ez)Ғe>ҿ7V(tpxEIP9@Uz)J Iվ2ۮ$ >v7I],rt-F4]/OFG1{U2GICX܍ \#I(6V>aABj0]n&G?@5_QBr(63 ˠp늻13MWɬCR>$=B^#*R +( >pg̭xk Vkl(CiRD Jgż"fڦ7JXbA^s!sJK\SS4|&u9mZ}n!Ώ9k}FV͎$R7qyz|^t~ j~˝ٷ2zYae^\/|sfrqU}`e8OOȭF'4i"sq\,\-^ozz~hPm`¦m0Yc#!*5FN䦰`Ud0kAҜU!zK{Q7%ނ7W{jd4V<OuUVpHZ1oY拰CmBPP~*3GVzh1ѵCKbY$&p9LrsYEYi -$D+uC<3n_p*G%F׎M be=8\ذ }'C^xjoet2jOo7&ܔTj%[afNh8(Ժn,8q~rn9,ݳ=@#vƞsk*r\ҴmCH /[$vv"NN :BZf!a s4!^.=00Ǹ R ,ػDO7~vƘRkqI_W,Wqvv[>x6\ ȊH5j85"齼*D#g@?9֬V=Cg$bU˿Cuׄ&|:3*@m6PH F؍U!&XX&d^,^0.P m,^2 *.--a,ݖ`AȾ.ټ"EmhU0$65[\l7D=clBlʈa/'!I\AG*p8խ^ [` \>њv&z~ rq F@6bZ1HHtĚ!Ao9I :|w=>]]ZB~=\WofSRsI!& ~8jv#LZy@ڒDhllMH4U%vwi_swq!Hͱ(dGBѯo{ka˜0V!|2(I L Ec[i)R1w]Xf)jV :r5p:DA~C+5Ckݤ+R, TIrZA2a1s=(W}.*IWg*O鵼8bADwKhj:֒WS&L ة. λbKsg(f6!JI1HM]Ջ7`p=qtUxPFwe{gʤ].ūo.\5< 3J $ZY#dL7o`3xX KUQ*RH촻'V6iM?=@uۨ}CPoTE[Ql= ۙqm8.ߌ^MU|n~i*TB` }Lބu9DX@졣7U4lF#~?F~9mt*h#++,t i:ū{{D2rcsq@hF#(YQQĄ@k&^]Llub(0ƙf1Gz1K Tqn~ڥ rOE|̊,f5J2$ssno; & cgL֏:qe9//QՖgYR7I6*sVL i9dwH(RwrqեѨo.|Wgx7n_6_FygXL#ϷE p~`b.TB]PN8$ YϬ΍b֊T9wW__@ShKq\oԵ3aR5i_C' (|[Qbo@<$6ﻂJDRŽ n_π8g192oUp."t%rƦAuZmAC)3,iķ⡣ҠXq$DI4\11^o:$pbk#׼\̑T^x2D_EhE{([aLTPbo˲͙ J sm${1!jl kR@n1ʵjy*b .lm(ˠE b,]IvUdղUGك/WEnMX_*Yk-rga-b_G`#u/;,viԩJϢ^o.dzJ- Vd!0?m81Vv8ȏo}|tX?N_Jb8/B (dİ=-%b&\Orh 3N%Z,\xIlh-18W 5~ZZqg =X<ywr(: &Ts 5HJ?Z &K b "z.mhԒ:y3ՕMGJhe JZLt83ay*R0)esI pE4T&T%8uy^%Ȓֽ+įJK:ysIJ דF `ܦX$)_pW, 63y~eHAVg\y/GhK=wّ8ԼnZRV1eI-&lT-lI D 'i6|^fag!b#YjAM5п^Dlu%; RmʩB},!r%1 2UAP)r, phgQ)ɂqb,ɝ^2\ϰgZI\Ph'\/#9ȱ,ܝhYBF&F=cBϥh=>t۲KĮUeׯڠHq>Rimg4lxzǤ44f]˟[ YuYyJ:Sι'-!#¦켨l6jSdcy}D Vw&e8->;Z?h,{Mxd6}~u . rPbUJvTC- >',w5-Dz?!߻,}Z 2$6UHgO*4ghY$ *w% ԬxH=_i z@jzwF#&2>eӣ{R|$S[!āYE6`@HFFA )}Fj7гx0ŌP_2=~O/ʞFn}Ɉ69 jJ˾leKTD1qWTgsYsd,\9nDj7X dLq8F{[XxGr7f2]iYdqzJy1ރɆ9Q0֏6(cŻ<@}њh-ﳖ[(Q" 3OS W>BT~6/BlľRC?9o[@Gon&ɱ޻k;IBp3Q&Su`} m>O SkȶI_oF vppŸAǝ~Pˋm K2Nr3Z-BZ2hvh+LTIc~2y1m/A+Mũ_Kln'nvK(-!5E 1=Tam^%&ۗ)B$m-^_uLPs%ZrGεl8>3goR(<(Ti$$B&r_s@!R W. orC+*Ej+Vs)rMY#eSn1e)aĐBm*,MK ^4TK(NewkǼ{w,bJ G)\cκ8tz +-_bPP%f0+6 s7:Ɇ[,V!؎'U 1!YruTy쪉JiR#NT+4fzE>U=&AR b! a>`F^׻zxtsGO=wQ, "_pօ\M@%Ǽ[XIiKVC{s#x>SeOPR~M<[@޶^94'P["pfO&r{ܿk'Ѹa[Bx64sgers}Dҩ 9fG֍Np2?;Vϫj?磆0.J#3nYQ 1 }{#,Q$F(8\2 сrh?kIazzHe e_p>*AVSO)$c0P"m%?(36xMw\@B1ffA)& n"ۜdY#܅]9&U[njf{@݌@ V$VԘ܊[]L'Oߩ0+U+#U -s*}[`c*9ſ,e xԸ>A||\f3(MTRѰ`@G^}*&%֛<|-+ 󣳅ő*٢^5瑍:<9YH`^^,ײGr4[>r5e&<E/`QpzLH$-I,-b>~>-R qj5S7BV\'"fK29xم3'8Go*z%P5'>{dR"ᕫb0(, _Vz,Q36ya nh9Da;ɜ؃@mģĕm qvz~f Z@Mft 5Ԃ"tukXOG1r$񺊾ح4-b"!6]d˺[DO#Z0)*yU$&]r[{Olx Ծ⃠Ƴl\$Qf[^5a\27x k9q EWQ0zvYIc P &v{^=N?5uGt):۵,Nrzz,jV}hVB*>Fkwy \3O!V'm=&`cy2_}|q&<4 1RCӓeX.Dfd:Jȝa7l=:q"B:;UYc3櫓0@pėKн,qLe(J4DA@ .k9#o+;pު9Z+ 번yjO~s-#wJ}HiIlpi <&%v X$ǧuPu%秃TKQ$8Zr0#B.Y[/blTsy<wZ+^uķI6!1zCUAdFb僗y;ym.`ij"o>7P%kSYEWW}q߮Vp=ᅬʪx'?$t] 68>Jy[oA%t"+3R_9g:QY3KHaUӝ9=Ѩ1dIR[EKzT@NJ(uVE<-7됎e DBn\Ęx)` Ӧ'ڶ-5 zZ,SkKf@v6:\QUQvkަ=hΈzp65@o5MMJ "3GF0 MW)QY^221et.&sTϘ0@j+}ІvVdyc.+Xhfv򑜨6>ugmћmpj!a6r [/Gэ=G ۫CIHBvQiXUe$.Lܧ}ZK.+ki?KOͣKў5MD3Ҍk۬(D$>cЉ[MGA"Ipyn'0@z[ĝJlNc0#Lkd Ɗ/"i Q.NӣsS7߰쐧;<`TDj b\brP1"ݜ/'/ǵ3?aéb>{mu[u#ޒ*7)œmbPhĬ@IFg}>( VZYmb?iz1V_^|,2VJAGm⌮!DXjF0ktP{6NNαN~X!"5W jO 㙇M}M@[;x;<9#=HUJ 0lA/-E!=WIӌ lgAl?j,m$G^G33 kx@Js+_#o%|®|~>_42lIcÒogGcX Hc(39+`%mb+H+hLqEmrnSwMdG Wp>H%7rBIvwhl{TeEDf,/LUqwř+̏c>T q}vG{Añ,!2DM|z q&ge' pp<`NL¯ۑN 5 `@c:b)0!o:S';S30$hDeb;J[PN8ε"@i5 ӚMXڎԶaЙ iwi3omzB/d&XC3!JH8ߥm-R4C`5gC١G%Z՚ʑs--:[%!L I1'Og ,#_/*)ÔW\\`?;^mN>\vhM;G2/ 8b:io wb*hX*## =cC4IWP.H].L7jy@"ƴn8JdrMPKi vMET&Hf A3 E<9:r?DXD*v9~.M3+̖bHbxӦ!N# Т90 TJn&F.PNJ$w?7O}(#n?5QdmO"JM<2>%G["(X+J Nʇ4Rk,<n=Z58q.5,P7,zA8fWai4*vNYIzQK6U/.<vPy H&^f,Xل,iXG%(2 NTT,-V RˠG -jh7–%CEP2Z7Xxpo|Fpò/83Cma%uĎU(ļ #Kq`Ҥ ur[uREhtaPb_X^ Q}Zjz^MYX#AJ_"U9*XXBj KLM#GB6M^[YҎ0txKX6,!|6$/gʾaZ1OxDd m#@')U(e7=Xl -b<=JS 5f+uLЎps%Nbw䅇6i $kh~N*QbCW.@k J1ާ(.@MqU#+uVI/g :{vJ왉 pЄuR>RtSX[oB;ȅyQO˗_6lR9Q|Z6.uJ&x[j54 ORhB:&t< a˱TΆ`1.W̘CΫ S P'[t:]4sF+4$š.5aMdA +c]C L No4(CR9M;~?>Tq5}\4QxU\8FF5D8`m㌂f~ZVlgE<0 85i0ԩ  n"%%w%k*#9Ϲ$olT'{R6~H̔=1>fPѧV%UJEՊB7g&)CXꚵi7P!n⧢Cӽ3^Rc~E~ɽf~՞dPmd)q#)7T E>br=}94^2;'sAJ{sP kԋ"\PTY>ipDu#lĈ^Щ} q" xK5n`ޢM@vr͍= MF8V׶dzdlB"y tLrvCbm~|wyxf!8Fr8I4#%TpRVp3ƻ- Y5dw:5@b0~a3GU5a/ l#oZ$2l&>֚ͤdxi]u*,S) `ݱtGdea}!:xXmIww҅Bbc9H+j4tNU`mTuBէul?P¨8PE0螔;ш0u|%6 .|le*W_2G>dbcl w^}^H8İ\\WX ?LԪH X,f| By 3pە%<Su_O/QS"\cM8 Ej$fV6= )h;:MKC KAKiYG-bϹW pH+t,&^;m+2Z[7fxdt (}AwB(z i1i_SKfu$h=\H}!@ty,iyԏ?OdVni﷓ڿyR)wEry48 YGYa,x ,Vc<]0B.AmCH9K1@⧚s^ fjc2!ee'juc7+Çmfg.<9艵[>)bs(A ¤H 1.Le jU.). Z("0ŬB\[3".E*GRg9b]HC[i}@`2Gr0)u$ȅƆ^ʗxs׮qVrQl9cT`ɕP뚝*xJN5+*^1r-qTp9a X#Un~Cj2{*^$&*gb\;v[Sf(;ɦ%ةG:$m6P8Qy:n{zZi:Umcs; xvۀ.V+TPTK!|hyCg?]הY޻.U(CV|&dqb@F+h+pl.J}MrnN@ooWm,-bP dz5>TEƑ{"Y1 ]Q Umu0%9 5 , +߫ůovӣh-GV;b|겲2 kڥ/^~愬,6z$W4h2!A2ײcLOQ~_y~{l(Hb9p1v{_8"q[jGPJtrP!֪N^eQ#TpaI!%+HrB*AM:rNz !EndX\Q)3zțiL|Y[N IԤaB`T3|*in, 4N3`njsD0is)ЏKSĔjHx1^q+"նYp'q`tI2Uҋ( #f&_~ zD_踏i Utć 6TdN+CuV7Ќ#ch\b v}{5֠`>8%3ܛ TvEڞLt;JJ7?mq?tN^^GȖ:5+ʁx"`$_dj~Ra ǜ:R0:;26>ieDBEyS0s0'V7 E[rZb;%3jEg0d^|IuеQ͏Nm*՚<'&IԢ{i ԓi>V4c,0ZS]*W?L7<_e5';vTNđ삓쳧i uQvVqP74A>yb3 i40ӤxeJp@NX8r;e&>_YjePXx+)nJTP݂x1MY|?, _Y`m+r츛YA|]j&$lV{|ddm"W 2eTY;'"X?BfT?qp\vVD^˥t8Nfo6%pWQ}Vjwkb:>{22u+DWZQ5Vlh]3]Y)'ԔDz*`RֶStrvC,lGNpD;3~5y##.-+Y8f>΢<ʷ0)OO{I1. WfJɓ0vfsg _V= QL u Ȅyب'<"ˆm íG8%-ONE,W3d&ظ(>b>{eyLks"q PXu')Ο|G{y_k YFbtKr"Nd&/&#'r"G3jw٥}L٨kLT^my(K@gu7>`1u_=˖ݻ^'(yskj.e)x(#̌,B\D~/*/~;CO.li@e33_ԑyCcoxUq 帚J7`qqVj͖Q=O7rv4# k%R̙\74㜜;,u iܰnͦ6z؋&^/Mt6a` JY-^pP;g88L:zLZёmT.]mn39d6\VNjgZl9wcQ\,9 jQX(U.! W rs4(>ݼjEC& CvJTDXZ)/2"(`yqA\!.@rj\Gy`: #R [:ISck~?ꔓzVͱ{g8*'%YT%p``HZ `9Ӱ 4OdiUgT'ﴊ;Aw4l^rIOU6A^Kk5, jQ_Rf z9% >Al_%7d z_6i5gEW j='x PzR'Sq G=1# ٳ_g.7.y ᅋwmX\NF$LUlkx4RcԎ?xLJ~|隴5ԛͺ&JR9h[mksPk V'ȇ@Tg擦|r xY DMPhDzY=NV* qh/7,:qQ&4cB&*XKy(%譮e{#TabNa<ŏp8,jmji]%M`4jg@W>!hT1ցuXVAW˲f8u;Lo Y@ꊙhv.ɲ5Uܴc, ɴRu77pUtǚ1 {A:(Y9b6oTSӳ2WvqM,o@l6{r["0 KtRrS5Yd6o u %7jWY Xһ=d@h6 L;* |LZfdHЄV#Ahr'(dysu2߽FJqzgAmFIG" DuK NZ4vP<1y>7g^K|8ULWoV ku'*?w?x_<ß~s'fj_ߋco$2v o{5TpkȢ8 q&{u7m%7$ώ]捸1L`Km5zHC{74VH50bԣdFJFb-R O@rPj61w>]ߴqȲ1A&xP e=h]'0,<ڻ-1T/ hSԹ:QOw⡛*c_։s^޸id?TxJ%P/PdxDuN5o_nxAas1cpt-ᡋ٬]7)Lo(٥8f&0oNOs̝Fb,v 34:hWXFqeB!,X@fլ +=hU H-1U.Z1[(o0H[Ahqo*LJ7ʯO_TP;%8DlBTxƻ3``v,V9=;(8T /H|])ם$|/UDѭY-7;w}# >Q}KG2mVp*Ӧ<=Nf_i1Nw`d.9給rPhΗ~`qf*wRrY?@rΔz;fPidi ?cCYǶ]8ElnHp\75Q%hPNbQ0X7à )G]'3RHgP FAX-Q3rNŐq ePAsM 3bTM d0]\(k9W}3[p?bm̓kj e@"p_E+H7s > |hdh(Joh(hd$,k&vCઉ$7Mr@ŏ9xҫh?2;7ߗ-3'5ۍ[u#8QFt Wi)߷`h_ͤt yoy9euNNC1jb Xʋ6e(eVnF_6rT9Ӗ rP{%ɖw_, HFhKS8a(T}j#U6lV@ 0́1S M uT2h@ݫlzj(M`sCɵVS+kq/1TW\$-s%5%'GLxn)5ӻIoH.U' 9luBd>[Rl[*iwoQ$7ҠMfz"a5\__aUj&˿ksa"hUd_(͈.Mu*0HiKr@RȦL<ғOK\Ky] ?H zz M8xP&;., 0)6CA'X"p$0+>j4Om n@= oA}A$H1 .l`9[9Sp6u\O_?n>}^_橻 GI/aVIYc BQ%TH)u*̆9ONQ|df" ZK+ӴfIH ^Y{bb"$}΁Ηn{8jPݱW$Gfx0Ax_tD)*"GjlE-|fVYyiM)upCQ¶ѱ3LM+m =p3$lOŷFop5ܬ5=Ft7[˥ogh|p,4)F.]Mݰ-;} Vf3j7kaN1KWGmJ0 9ym sbEFK rpEfg11;VB7U/VX}nU9o #0#PgXח;*z {Zj@@8Qh! 6I:ƽLV}_HH k>CYB%"Kvؾ H^h,EW+Sl7WFh7W BhI9ª{j&4 5Z/&"pPƖ^>k/ܑ1f.9w7 M*]X0êl"VV#8~vV="7j(¹6WjlpTrq,%Np[=)qKCB#f%+Lg bceI1L ,L`;i pE-QLdd3xcx,YGX! SYiv)G\I`>Xj 0H:zTw :NRkp+4{1oX'{Ojynj/LE"IBDhmH j0pa7B띠h/:[glIg0L@f`+kFQ ^%o52Q]%z:PWq߼8/ErjȊx@ 6xRvPBg2 zس;% }h`)]50E<`^gZ^'hO, x҃N8Gͽ ^ʕ,SS &orF[qN%֕*/qNzL@Vf$fox E6J2N핖 ?:@3o.!6WfXeTE3K1t/M̷e8}gJC!)Ps߹8[K GAΙHE >\U"M6W&^geD;B0ASu7 L;\l&y3ѵORav}_FDF4S9(,"%:Q(PN/5:I;I6&% W8hNZPͯ2e9|ڞj cM;v&mu< Rcy6eoɘ4CyS!pԖ rIO_T}P<'[7=OȨ-3ɺ~/gmˊjmA#F0ƙʴ𬙶(ټȣYL!I;mpRtcr,t-GaTBc4 ڭRG+muqeei2K1"jiEP0@|AbV!Ulk R٨T<~:葀v+\6WF@^,C*YGQf6dyU v 6]nlUq >24wfǮ&KDsa#jBS +}5b^qRH`e Te{?yKb{Zg5X`V~K} G/@9nh^2`ͥU0󨱮5Ǻ ed!*@m!k%Xh^͍;Q%e%T_7 !sjwt14\)/I7L'm+3^ T_R.$X$eNj^x ֗ʣ[&F42|=[U;x.~JcԖ3,*MᦷEeOjQYWSpǯX bg 5/H5y%;zMj+JКQ] T I i$~Pz4Kч,Ua\=TӿC&iF}Ԇ4:Lt]DbI;KG&"4xvqY`a[I#5UN;F.wE&p;txs Uc6BA(znf)>u(Z~@dSDg/Qt9֝b^kіh-H',0첁-Ӈ΂"M6 t٣f;l? D3<}0!GzzmA"u\d)umOIOLeV_0e g jcڅ +NUu@}MM`bcBln |HśCMXLCjމ/@!c"!f(GZP!H-k |F -[D>jO)cԘeNKkVCl ۫%yX2{ӑ Jy@c :,Ly~XaǖagIC:Tl(]Kv7 L ET@vq(=XlB @N??~o ''ߠPHѮa$1n8Q%1$ZN.r'?`Ԯ5 ذkŸtPbxvijfāDCEuk;48`S}sR0-53&WlXY~h9FNgtu CQYJP8isEӗcY<JQqu: :rx/~̽y2{ 5wm8K%(XA{1 #c-?;v[) & j fzAwSI:΃$In(Iԛ!3@uPI@!_h/CNLB<HSks? &RZ~a6S$-9鸪-pB)[/MSМ׿W n^(!aZe=TvEӬ }*z!8`h f9[p& e!iZg/oۍ(5ʁ_HЧ:m=CmX] Ɓ4yƆҋ۴nSl<}(#v)3Z]3me$w4,"SoSr. 5v3u98L@0}Aplj.OE&A(<;>4\19p߉ux΀J U=4!Y:)rLwM|'BF !xTφ!^əpe J "q~|:UHc -.T#YjA͝ZA!yB9G#kQ!x; [ɐw`j-xojj0&C OEa wvٲ0 aIif޽x"e<NvppCo)F/I)' n6vaX Ez [tt3|HxDAO2+%}<+T![ qi~ pаˑGd& +}8XfeJVf5. )?O[NwǏw}}=z{LLY3& 4ȉd. tL0dznYkX`s[cCO6JizAi SqScO3 l"b<ŗ$UB}guW;Ɋ 3SmlQ5S{6&5,A|>qJЛq`[%>w&:Y}YØ|ޓ<]Vi#㞑(C[r !ELuEN8Ռ7"mEK*ni0cv:ٷF1ÿ%%7f&U]eIJgdYۡn WrF7eW=d-}͉[6^$TbFq,#+/`w}1Dl>lVѾ#,UoY7M #MLYIjm*An^j[{9k!0'6 )8iVH>qzŕzl攪QK(nI"OBeBvVh= csro=^~GBͷꯣ5a-DӵKe{'mvq=,Fՙ頂R0#?o='$C CZ[ =[:=Pj mSGE TtjY@5=1=JjXP;?i91Uko,LCK()ЃE}`D ;ъL ^W m`'Ό1zPW hy-k'D8Yo1d@u~%-m1rTcm>[S`Oik/a}z^Er}M4/)%o{Os,۪֠= .B)5BzsSEu6Hk '%,`=G0]v=*0bnCڋ$שf=?Kjv|8L;QUY# ZZ}V^:QGF,WLqxp)~be:=5:˂3hbA\%Xf >{Z9xpsA_u)t=ML9è'SQ쨕Qҩjjl|Ԗd+^DsX:.61rK>a-! w9MrDpƧFivQIaYn.:\ wB_`/:t?Xf)5R*르<p=pƄQ d1McuP yRf_Gsxzj)plp)2/{>؄@]6 U.o-c7gFd-RE* >v O1l]*)JFX:ҢmQ^%Ze!:sKO T -WxkRgo ]uthFn!J#BȤտ<>}Y=fvBP6;|}ңmׁ/g͠WLuWH?d'Ylb!Gr{M}$4*B)'o¬P!/֣3ӭ0(`\NGγfB6À,UDedυ9bpOYW̓(^)|zϏ?N̈́^t' 9[uGOȆp߅ʀ|]{#1$쎃4> XqdC1+9q<?^ EPLЇfΝf'Z}[``Yt쩧kx)ɻ" |Q[G> dB=, 6u#R5(98QivlΫ8` -cH%=FF;ڄ;J2n9d|zTl XȄau73KE|~#H:5 pVەHgu0HɎQJVsv%' \ a9#VOrf.[ |q[/`2(5˘38.m+f(A'"d,Ȏ >ٙ٢wזZ+<⍨Dl:$(BjOrX~ee#DT ߑR0h20٠%[NɁC-_)mt .ǖ݃'7l=2Ӣ`0X3%&FhcS9~T8P9@ϫ X}VbfZe6w>c3~;\0Rܓ XK;h3WP~h+$96ً]foJRss=Z80\K:?}}Շd/O_Ϗ7ǟWBgtw{LIգ9HkсXuնO2jňm=3.H2T6<oe5LϭCo 86̓wþuX #3Y3֘%ơ8@(T|߾ۿcXBJǻ%r -0Yh =HQpݵFQ@'/{$pꂂP.DM{=#,㚇wP_>_סڷ?xt#tJJX;]S隯 ^p׿E#8^se䣪l/B~YkqD{nj0t^X8-(V E%x̧<{.:9퐨 (ϴpAr м1{6`d3^>=Z4}KvXTp^ P/P??7_>}>i3_S竈FgjVQkRj5i(df)8P0}XHިw?[QU@(p]_SHwZѢlamb` -'kUE:6ܮD_8|QlR?>a6*p@nm造 j bsTb$mS9EfFfL&~Ҙ7 4rR(dfYȝV]6$2^w"t.*~7b;DkO CCFGVQ^0g?ߗgsexOӍ%لЉ6 w 䩄  UZ Pņ6Bm&*k/阐q2}rta֍ZZNޞx|0i>$y05nDiR 2-s8`d1|`\dG k1^{.ڄ)( 8UE!60(*>1sG~:_ bs}] }d'/CT3\[}4 E3#GQKP)d lE^^Io!}LwAhEU|@iA`gwP=2#C} &)-<6-綯VkL_T~B",КA q^?7O??}*9]S/b(XXM0Ph~$\) 0J\ ӊ!Q Tjh^B.v*(tΖZE$@@ZAnO  CKDK,)0"0+.}nnwWVM#܆jEITGfYyD\몹ŕ:p4PrӕQ9/mYgc N yr/?7'<R)Xn7ޅ(QUp(IAAOg,SZ()$:rbeXm2ǜ ĥ l;Mn/|Hg-> QAt )w.zZ b`2oK77 :j_W.M-ޛN eN7ӛHE-xqOmtGdblHk/`3gQz JI8'N-ދ)Tj*\7/:.-ɢ*'t<~Ը0DHssFjqW[.Ռ"q󚿷v>Z=5 HMl fq8<DbϦ~tʜ<&WPZ# w97,2.52fnL ׮TbaR8W7 (p`yqݪO'w|/%9GYBUiA>;vkgB4񏂊KC.yWL}REes&8(U,L\r^k&  +X1jM+M7Gr} IU aR|Mi=qi߽ۖJBt ;GYpPDzdE2)GR3VMjvmZQl~+`߅阝2{O.wdT1dj Σdi(pƉ|3(L7$SM}:-w",n+"z[HHWT2X!gWI-Up\KK>>I a:v:5K6*yM$*gx*l!Z7oi0RLG76>ؤ*r^uqDޡsg P3(㞟0׆O@d{M& َDCGnۑŮ0vXA59}R A'J-Ecsg91z|S}0iDXU_,Ȯb4jdGBZs"G$ұf/qL6ɦRns*#\ƳS G91nV_9߼Of~^%o5"6rX,if>Ӑn;ؖc4 j^"!^)+[LI4#ˋbV=QV,PAkg eQ&k-g}abSy͑JBE5Ve[v$$~ێQqiQ^K{HY>;;vbJ样}0=i|aKYXD,Hb퇥Gc9$hF|j+jϱc=ʗJǦF@_7].oGTkC{쓕(ؚ,y#NPY0N]_H=&`|PUKu\zw# Мqis*܍ԥDh)3Ż\fFE2r{AP\KD*Z[ ghb#y۾ьzQm+BM=8w. YʇfPJ9vGNbアG!bN uMKmk6L V__6s܊9m(U . #.4K0};6ٜ0M+91VU-b>;L'Cz%C)e;sGJUI'9;3$"3 82*5  p%l7HZ ȨT%vS:3|0o5q*%e)Jh\-qQXP sN? /e`h2YsȐPpؤ,'`WmGDe-)dgBf; y=Z=25r6j9 %6W7UJOi2m\9N`Ѽ\I}$~Wv5Ud?[(kG pΧ2]@4;>:^& m2]X?eU&>@48w)KbϚ)+~.>5?LUNp$仄/K yKErAZ&f}DOWy4]R§&j-gFZK& g뢵Q.}li; ,&W%Ho;g [x+Ҡ5F ]K&MƋ9;A`/3K#:_ չG@)=̀ZJJqǓ?3V]O_nY]' >  \V Ӄ~ԏO1ۙ3Sӽ)J gʘKvN/0;Qŭ.SEy8~e|)><0J@)$)V q:*t38z F++;2Ek`<;綡V'r#zHLl*hko8@:5?8c|?YV2䞑|a.m_ *bC.f(сWe{ :L{-֢'tk+{80D~C1`A~Pn˔dPpqm#Ze; W!-[H(hwg5H0<4OUܲ%u $|lQB*48=ݒ_Zbљƞd![.=vy-RLh}ذ#a,5擲JԬ R]k^T"R{yM:fr, h ?=_FuLϛz53^mYsWr=KJW"DRHnB $ٓXD-_ϡE 쬳vi:xu(V . qJFd6ai:JUF%*l –;`5$_UT^2!=US~]׳ZXP:rhʶ3z0|Jeر$5C_]KNn]'ĿO ^1RׄM9}cMbFֽB \pHtT$ni q8˗Ogw R|r}6yr7\wTT mP񾳑$%ZH[1Rv!2%%!x,%^CEG5eBp+&A*i*;5pM3MCG$&B8B0V0M8)YM!WH#>h%:I훼>޴t/:sc" S̖<ǒbRmy@`0ø1Z $^kK4Su?%t7<64"I7Xeauxmkq- R*PLlm31s]2S h 14 Tp"Ciݘp0MBqkqcjr"oN Rg.؍#\I[ql*"tJtLĦkzշ!jD( AZZL!!DZ<#2c$M 'v%CˆVID9L/;yZXc2ELmFUj,kVy~@8OVݮ5*k820bģzy d@ 0p dh_3"*B`COنvlQ,4a8Pgrbą2Œ۱oR|ݧnMLbqB.Ojz`@+Wq..=TТiby=/n*xZcP&ֈWK5ѥD= &|lDA 5KԪ7$ 0ߧ7ȷwzkN#<l̡_e& M<#d,zݮ/j^̪WUl>*HIf=L? s'1ʸ[fiYK'lUBvv;۳p qЂa@yErbGB.QG#: ;}ꏏ?5_?C|NJ -mb\gT^:5zr S 2Yj lˁYoْ+L]NOCMO*=8A\;Zr/!W`k4,֗: C5㫎[daXk +090SNѐNH[AT$oI?K..gLN)*~FxT:SkOb4 Nl qzСbzQ:+5v;=[{OZeקy޼[ӏ7_Lbhe#Yάs> 0/Gqa|Lb%@>:ḓf %qvJv-W{ə.25Z>`Ԅ;}F3Uk^>󤩸'= 6^هucxyqQ,}di}ǩ׬d&W͹^()T7'Hߜ`adB-_±eQ3%{zhHvGˏHpwOŏsBW.U`xIU]Qȋɞ¬ѲXiy)=~א'bzܐPݿSf-YG&{[vx S#]:_P%bx\Ij7Rҡռ]v)͸l[v)]zmӣkU ژ:}enпvpi9{;x 0(&p,f7irUQ ^ .Bּ>F*x諠$ 6|\J>Φ߫x?{ǟ~1Y9Xg,A{N>ce`BaZ2@z3th xO33#W1d/FXoħ 1aʌ.d8j 9 F8*x<:l]=)$VSOa/s3v\D0KN.ؖ[U@r7zO2'&#*'ǚF f3 JrBctד:yjIęF} L9^(Pšgz,Y;5>p 78b~,F4|%\lkIʩN9hIҠJQE SaCv;0T L*60\e hes~ap[R A|D?dpi60$A;Uo;y>,edGʚB5ARS7(O޾UORx7S_U5\kFT2H-=Ս()5\fSfo-pNJܭzP5劙НdԾ[򽓂Qcؽ`^چ?8nX]T>/k-#zob$4U6߰)r>rkwCpjkA9Ć(V:j_SqKՋlŸ<upS!,ᩞyx;F׮.m=* w6tW -!~RiKg \ K2DA.ؙ_hiL&G7{U!ዼ/R,:5}w e={\ "iya,apEUٕ7;MFZ$y6su8O+!!EI9sTv>7LInF-*:JT+wpsvs)&`ᨲث7'~WD0D)& ۦWC3q1]ࢅЮ2B˫tIDtv !.gYA'B/'aX,f&- KuP'Dȿq2|Ú_j.M L2(!~$UQG,$ͫizGLTnN{G'Tn*{t(.`VyQ 3gz&vԨIˆiFba#K\KjVX66_0S*ʷa_3z=9Z=P15un**FBqgK{X#NRE*9+QGVztp4=tj"RO*{D2n5bj/˞3À{2( ɾTLTdWE4ijxQ@I,QXq%pnn\?+20.pr y]v$k2<Ճ /` (FqMh#4lV S3VKfPx 5TC۫W H9գ+șKo ; G+CU7BK$-bXf[e=QA'LC7v/YgmuP$Gou_bjT*+8hլZcki(!=LejzBKH[k 4jى~*̃D4,CܙwiÜ\yFI)3;E钕 iAdpl uǍl4l[bB|,r^$nK9OBS#&f~ |KsMKSj'LF]`C|rǖ۵ R0^5>K#qA;@4,VCCD;N{*Kb 5ȹ!.U $X8X8TYE_q?5(һ/q{;/!=ύTnj5H ^K8e3r|5dD-U νzr>ʋ.a[Vs(+vAa*u?T|RPewq|͋J64RIXtOcPKyhX)rh$)L%KL<7hNͨ,/T8a(땤-UV_^Ipj3 (e{qH +$tǼxk dP˟~KމY{λ RSG׏<B#1٣& ;$rg^ƍt>mL,#Ƌ\S\Lv]7uRg؋`D~sZ-o_%yq/Yu#[kB]B҂5qⲷKr2}pvK'^mUyuj3ZסCUJ5hqN% pvZ6tTl35+u]u -,#~M =SKuIXi?Yym2% =,\nl$2E|,S2B, %WTҚM0VՔݳ句ssyki1[zwq>gGR]ńC6jNH3rajh4L,BsQ828D +!8TA`ISPs/z *)٠kՅR_|Z "reoå<0.$%`r Uy "G T5 'uCwjgkZ(+Q/г@O@tԟdCҨK8Ҕ.%[ytuTKuU]1'ծ;2v>[co5,FY)vtOTƵ>ػ󠎒:<;M JeN#3bzfV:)gDsVj0ڱe:աnC9Tg:-;IJE|".+`,{D R K짠~6|=-1R+naj3VZO҅DjC+KPmQQSA_θvcC򷋢dkL!skL8[jH izW./ 3\ J6ĩrB(փO"}Zfpsu#.8 ګfM; cY܂J^f{`QU'FިDzB[SRҎvJf`>C8]څ͠2 ʉ (QV#")@n쉲şܭص,l)3MLKLͶED3 . wK /,>2Ѫj@mrgqb?uܶ N jٿ<-"r:hOQMA*Wi eD>NzaIٙau&  !'Qe5|Ik'x#a7,Qr"U8 pLsU2i9r}_~.׫}}zן.VS&I[?xUKc7!k`0A5j{pf3TdtE qLH$'<ftH+]o␌`ǹB 9/Ioa63][F] PYv6/X bEݛl'{:%ElX]Tg$LՔ_ XP M~ ;Mڈ4U L B]US1i(Qp/kh5+%I 2K:f)PhT2Qp+)QS`bGY N{LMQNƌ,3$8$&lO(UaXgye+D!j GF Em]C ,7r4ϱ,oh@brv<>52)`s,4ٚSZґ(1!7lTLh-ٍ䑺mCD):Q\qx~G , w0p3:i=_PdVoڼl[B$#g϶0SK74yP!iHKX$?^5_%w*Xg"xpi2 Dq-mxsN6tNV7cUf&Y~anT6C\ZS ضIڈŐISKBC]БaTd'peKl+ `6 3-,k,0piFI8nl2' pְʮu\Ά+(a #4=3g/#aIԚe@5>$Č/*7%dLp>5yNJtnBv9 J`)q8JxP{YT$kz1RP:cC8H= \'"I=jBOܴDSB0o''&8&,!,wKyd4ʼn\arʸcĚE8%%gZĦUϒl X˔u, :2% &rv.WWj[ S&d j@Xˀjn20qЌ7”o2F0AЄLźUwV=Ǔ*}uiwX4 s54b<$k؎m d%,:K<=fs|}zZj#s:z ۏ Q^z>nmSL[mg9ea&NswhE:w0ɻH]n:i1M.ֲN[4ǧ껏{@YmfWxs»@C1q<푲'ۧ(v"|0\dxQ ݣ`gg#OLϻ// ^K«zZQ4Վ6`>9 Y}xS}*JpWD3ՕOGs^p &EP f+A%qߚ RSj(ê(V43)}o=y+ׁAӗ>Oo>Wlu(>urNNf0p#oV]'zIv~(OԼO{/4N5Ŝ{bxN[;تPN@ÀԬ.% *j$1HٕzwZ7;?;Ip;_ Y6bt\Yl.2wKcVi[95mz~+,||vyT"af)%(;w×AZdQ"L?]ܡ`CzG1"95Sؠ稖dם։Kί%K>-]ֺ`jfbYGسZnhYk&1Ћ U3-]}h>|:wҤ>'֞j~aHASCB }K8*Y 6Ffi`e ֵ:`p4:)C6 KsF D,:i=_J4?Rna +![ ^<8tu?4^dW 5Ih3WFdgY:ۺ8ڪen|,XA8o:f\LlBmk!(}O{baPb=RI~4ShUK{5}?1JiZQh86=)u}PHɄdҬ01];|l(up`lpex{-DZb9Z?>i¿~C]|ZǟZsa}C9VǯZanWat??{*~|?ѩ;߿[kE@ _CAI*~͞"d5/&n+͎Aw6vT.:5`xcͦzù ]}]M 0H}YM%MO\\|\k)#TG@4tT z^b:sOg*/ v"&Y̨W{bP35ZwAbE+= KЈeGK'},BS_SIN05/m. ibhy]ZЙm;A`L!HN"'{}{˪ܮkJ^z|1w)wQWG{͝-͡#f'aη-AxadZLw3X㠠$ϯc *P՛UfL/30sT(қӬ^ea+ih.JZw9J@Ǐ^*RiFܑh7"س{ /k#K݋ )?y 'JzoG|j9A"=^JKƁOlsQ`agO&K!b08ݢ: >߬ z|0 [qE6Ԅ`vkpbSwtF:/&F֥j_ytE=N6ͧ>!MZmǶ?):Hܞ\BKE f2p9׶}>N~>TyL-㣄cX$7ZŅ@MlPٻh^f-S z iLplS?Ԕ::<šcK;ǟ$0\fLQ;~<ۧˑsCO:ߧN RY2S+_oY|=((a6<6/*fZ9ޮ)y,>(~&ODX^Qmc~3ƫV.Tc!]6kUHR;UK/R2oH~pşD'qJva鶕E(z+fը&}zܿ{!ɵ ؂+H3LD^4 w7;* O] B1%!!R;edo9&[V,[Y쉹nOfYh> ѩW5.Y腉WBonMeiP籥{I7{Ru<Nu7vN/ 1!ضPćk}z<~_}wOSQ kLKwHx eÒyGOq! Nr.sYk׼MfF׭}͊nWl Ղ{Kl=wzO32.gW_C5;Պě}vH{l[e|Q_E.XÇy:LϪ*w$"ѦΉr[`&yk‚MCD瀗cl崟zr'=ȇ^xx4/~nx*~ќ۟ɟAi a BMR5?Q՜DjjzI%eyfto{C oJA)LEP((.ݫzEפW;M6׬;_Q[ 3\7[Y:0y#f^J{Z}OYN>xmm閱TS,i_ͭ7 gȄx]$S+JC3KWoQZޠo!6byMuap @:(kgwjg!jXђ("Ey3>X/ZjkT*>il'=SPg#:9d_EMEF4svO}%PjB{⪛!,2q]2~$ Y=K!f3Ϸ7kd- PCM,+0\[LYʃ kNyqXq2tCFUwdғn!V=l5сv=SYՃwO 56Wm@o/}}hi=g(=JCnqPO]S!g~ivW(X. 7CU@*XϖTkhM:1u9`{]'q #Ъ) &M4OSgM֢JaHfb?cO K[ 5mܒrcTZ\k/C@| }P$m/t FФUBRBs9hlQAR"Mۗ.^1FkxĄ.EBJ Ȅ҇S+.  # @rD+8QӞ^Ş9xŽ*=YǍ5T|yȬϔ=+`GMV#'UAԄ280i')b붷PEK԰u ("e Wx1)? RJGBe{Lflz0}+'݋_^N3WD$/SPkb0MbSfeԫevy-H؄AA~w :Saa#.Phm*4#Bd|LGia/]sHH}t@SAH0)dII3qg|E_fz.쾽dlLI@A7O_?|gM^MBm6}/l:2[Ր8|QE!U?V(z9h}/j:} ?hX_Ji3]񿏢MY,t{?a[Ae$R I]TSsv?GP;ؼh[ 5+îFw#BdDxJ`$&*payz(}m7S'CPޒ*8r%hZ)eh@5/(ms +"SÍOek-a跠Z` 8!o6fYtn ؑ?n>,o?&I#`jEp̸L$ok# ӪeU LӖsqJ7+ 1Ǩ5zZZ ITl͵]2YCcf|vc^%-sf\e1g[^1ۻKHV>g7L>h$)DutdMGP!o=spCla8ݎtB&(|@~!Y [{L KJￊ;ҧ]I$Iv4ENjPTaB\e!Je.\l -K}+yW WnJNkR(dNABtVk&W@ɉ8hLSֺ\X}ZΩ(*dQ) /8;c R , B`b&Yߒ<;ߐ}^^A)F]Y Un/2/_Ao_,3@.T6!B|XFz~7glGIm?QF9SSujg vc8gA)賅m՛XvYPwS^5گ;;D糃,nE7\22d3&Ny)s녲d7~iD^[e*ss֒w8z]<)qM]6Ow1 ^tfTm ܤO2٥`N V+1C_el{fM y@! NqQJc~i9'?$4(ر-yQ!CRwS!gݵbHThϧU;R{Q LnU=a9h`qc ! ҈3҅]I&Ⱦ:,m}\g>5U j(^IUL*ͥQgj 樹=1;&FrQ^DwtM/ڥ^M{MyyOB(U1Mjᮁn1Ȝ"3)!yiDU_oʎOȨ>{˷09R9 `+o[TC9t,lh9hfnɖX?h#p/wAhԙ9vN]l/n;W-2cWy[XNhT>.bNvBX_lOjw>L)*֋٪OSYRd%]v/GFɛbVÛ3 8@XA=dUF<`Eu^[h(^}X{S /m,5יk4Ġ?w4j/6?IZPUS FCCq.28bPv~}~ާ}wYp{rQf n/94e2 m=^q 'k : `lō> Jo++wSb4~Ξ훩KM(c=,)9I!G . H-h y ;7_Xz\5O iq58U8u'aPV+wJ 阢VjD0j- m\ke65w@IX\Q{v44 u»u6i^j*+0Iei &EfXڭ[͑RȇPFe@.j4D) @ig]z>{dnxxE a ku{||*َꅗ/>?=?055Mݹ7l} ZDq Wip:_8~Baw|d*{-tÎ/׾n`V3(9+&(P5#lBOދn>, HoT'%n$՚6u^Q]mн>YK! |lk[9[vKP %aT(_]/۪Npt(q[u支yPvj }"KM ΀o)YS9Dz5{Uz"WC&#|*Y)T2 /]f簘. AKlPNZ|տ 7\+~tg*sRf詜G:/}1ܗ׫??~ꊧwۅ*{^`%?iGk_>_/RЪؗ07,=/[Mx mWkg4wǧj>ln~27zHx 06m& kЪXN +(]NoZCE JjV'H%#%|տGьvi..dhY y]Xq e==o:8Pآc+UF)'pj"ũu/}g[p>8?ܿxcݟN)b_(鼜ĝ@wtl-J8G` N[Q5%T󸌚Zo\*M8~ddTLTAqM%P{RBeLZgRxCyi,I^~W^Rsπ¨a 9GrV^T}tҳ|1SzYA KCi?C*fM<)< zyvz} ~O/ _eu_P$3/2:,ec0#0f9727@yUiP13ӀdkrQ4D2@ SO?FkcGs8c5\LC T8dRLODq)J%sx1r~ +?:"m Aa P[y.S2./kVk(%kY"Aba17SD}U-2126ũ_,}{HElA0oa4H'`9:%.T^1ҵO'?œWwϩc_,_Ge^h1%޼r<)S߶? ի)F52_ ^*w;UClvzq)9c!@ >䋳蛽^Q b`-)>ja.hDtiʗl-s> gc5OMQooz㣰0pS cg#6>XfhA,kmM3zJtY"|N`2Hڪ#AAu?($q/ehռ.\հx!|~Lҋ`$Wr45åmCӗ4ג78͜sq+SqA(Ţ|HloXwWPun䲒Ԍ 6(hppJf.ׇ7n8,* $kg&ZlhB$f=PCˀ?'gp>O7xyZKXwk\A{F>aZrZ3e{R;V-aDgZ=- pa 7l'k`ڣlUJ^nk(2|>om;{0rgFUA>Mﳕi*fX/vl}dl]IhQURzA5~wZy}y*aH]aǫfu8bHqa e5oLm^?\f9dzkBCG0Q~9F %Ive%T hbI(7k:TolE{G,kHys܁5=[VD>`aO"z9˪e^ثx-Ko;Bo6=reˑhZ~% 0ɟ3kKaW:jzطcU2O] ^ 9tGS ]$$`lzc -6^G„{;m[FxIaGӥdHTٯV[a&]jw!2lǭ"Vܝ忹O?*>}z| yC4Z^,[j“P-LoR%CXwh7#^?VCTBm^fa̡yzXdeL)N`*n`4TYIXl!5~z}xٿ'U.0+1]`P7P܃&R *oվo& ?Y9OF T7{C^AUtWa3 \Ї  "j~1/y$? 5<ͩ]EF$tRs'!P,g}~Y %'e-(4j'lTR Pt[|quG?TbV_K|F7U@r.6ӡ\g 7g~Cy[-K*bvs£ |nͺbyw`9_So4-ݸ*>k2/uc/}>zoj,9  ڢ֘|_T' h8:Ǫuoˆ /Iϲ& 5P ڞ~bB}ޑ2,e$T>J(;əCS./yG*^H.Vs,8ٔ ,r7,#NZ]CZh ;gCx_Ÿ/.9!68qfۮ7f?W0_AuKξK׳ү~s/ 㟠Uǻ_;c["W7ه\ Gzy)sxJֶ/FxMsd9opBF/┘ĭ|K⩕\> ԧ@7s1RR`$q8D~Ptqǟn9Un))շ w ~^yϸaܜBz1V'CJET:yq}_S\L꽥h ?vɈ̤`E_kfO 8H(wҤAM8s;: GI*m|YPEFDДr*N Y*I`5 N>WSSvCVkV:v,k5XvGi9A [42&y1&y3O2NXUOj[\CK𾞠W::5>,4h'}Xd rM9کGB ِ sL1sol|֩Gxiev !5Q; rF28U]gR{qM&9ni "UKWUe!7IiPȉ;ԡ w"f̀0tlL)u{ߙc;-8|ft=E0#56Oir?Fӳ#LĔ)nI;LR,A Jʶ5)>u@yk۝(ߋO} | "HBVښŧ_g /_w/{N[OAOjP?{)m^Uu.Gae!4! b%>xp}&vfTlb%1>41^bATwz̛<#5ZL}1nENkN[Z:UR !0Gh2y}%w oulzJ4Qof}r$McopK*l]lW<^W|.; PET`[Vc`ݧ̢٪{uΆw6 [e0'[δ?gXE36 ޙfGonp,t,6?&e.Vsiz›1,>GYQ1 ѓo|Hԣpj}X@Aaf[`VIڪ m0R7\ڬ,ys'k{Z:"Q1FQ7â(^` GۆCo ƦF1{l*)eg nt~#>zp'G@%\x0Yfkvz}:Xv+\TJǎ`YXy3HmHY-*L-T6\ ;j? 깾ˏzFe}+4*؟#HQP6˵J%Sl@[Bx2FX˯#ܼ-+0ZxEvhLȨb) ҔFKjw9763%zМu֔0e7:RަA?Nn92B>s۰J؈{Mo1H;4]W{g, C?P:X^^]hMժ>~/נeKuK _11Nc*Tjw*(j@svQ_MVr8A \"egtA^]o+i;ue;&6]A~Ϗ? g_\2W}{MEvj̅5BIq./Ӱm(6ھȐM?Hj1ps} ;0:4:&- . [bޫS6@T+Y'9Ĭ62\4$tF+ #o;6k/r;`˦V>1a8l!g4(PHWT6- yҵ͇l_]u˛jAcH<R"=WM|O߾k5O|C}Zʈ&UH97Y-sTHPم6 L"/#` n_螮_=Ui3YlFDթ0z%rVKQ#'dfIM(3IԚYI 1q'J&m*A D>mkgOz͌qq^M%KX> G3縜\yJ±'*Q?و`qxzS鋁wzrv} cV|fQ]䘇;`tT;W߮ԼFwoMbPby7Gs:bT:4c{hXAǹ8tCkW4?oDl~QD<$r[=ح75KAcIV]5o7iJ;Ra? !N=**0iuD9a"zv~#)^<`V\b(eTPi.#{ahrE i%M" Ʊ+ RQ+EEk{ޘVޔ\1weƙ%x*gXlR$/T_e68y [nx!gE-@ Sɾ-sIФ6x0x1x]m7Co^<kڣƓ9I׉D<(5Hqfl^cYjd{4 a>ڥXjK?/ߒ'pu AJD ׾~= ƖD56 ''w̨ԛ#c8xDj5X’JG_skGc)RW\3v݇>Xt+8BJO"/qk>}Yק{L:xt"zأnuî^Qq=#b^ނMwNY>hOnl>랽l5=4/2bUƚe<8\[AA/ﹺ )~8#6hm7Xp(JJ-,#^T^4HG/h:]̪d*/#ކ)Sh'.bױXhvjc <>G@z('=k;P~ey=%ӢHTlMC ac A G=G&>=#Ix%Po^y5D"hULKHȭxLQ2Kt~c9lPJ ofNCJCFnx|T%>ZP3fQU^TK{#&ŖG^TX>PJԾ+b^G^ V 3W(Dj\NX"'Ɇvq@LJ"SjaYrj ~:G C (sZU9-Zl>,CXsvăADՂsa '@~-6.f$ʔ\HDcMl&Ri>ǀ! {EB4:r77@@ph/V ES9N謻.Z:&t @z!@OhBGSh:!{B[)+~tǪl4y^>39+&Ķʔxцo`h?|0:<`DzŻE(!0ϋ ?\EKNtݟ/=RAA(adΪg)Uez? C,DdBt׻zkgL*G}^\%,VHܘGh(hkˡԥ^sB+[vAsbIM|,7ڪ k;DlLd;r!:ew t647dO|}^5φm>ko[UسS]<4wǯYn+;U$"hvpIh Ijw{>m}$v- /#RFOɂReS#CM#κe );cuj/uL 9),J-h:.J` aFڱJzo Ѭ\-Q< KfZq 9_j>ciԥzK;'i;,NvNv 4E-Ey,S!Z5{yov4 3{q6C+ &ZE*;i|u#nrWmѣO {_`mXXꑈ5`-,ޢS8Vr~_nzvrR}{ ƕM=h/eyPlC>5ZuWL{8d/SastSa,u}* lW-86ì'6R Y ԶX%kP0@"'ļ]xP Ȥ1< ;(;L5/!cj3y4e4ءo-w9/ V3 a lP݆<^ QBl)1Zk/#s.\OJYfF: I$'Hr}bNp$$[l39f!x.t_џ/-)k.L뉪k%f~q20؈v0 &=)"텖&Pq4z <`nTBoPDlV!c lL<s8C=gi ݬ`v70>qsAF}LA#ګ Qtj|1OlZP{n M*yb_T0DN&Rm/5A[xwW[?ٿI qړ%`M7XJ0R@!xaśH#E˽}٦3߭°/Þp^00L plP3諶Q٤ӹzz I%D&* .,(`o9矪$Vݰ ھTXӏm^xEy- 3I=SX}efP0yViڽ%zQhr܍ RXfMˇ]JGlK2a_,9jqڬPshIhT (tMKU'tb{/mX#4<FT=dqٞ57LgT됬;k.55Q&q "!rPF9Y7p?O?8 OȕZ´H,vg@T Zb}D5=Uz6ƌ82S_31 ݂:dq}';g 9͝'TˆLL|! ǙvһUaae,渀\0c#]{6xDV3S5LB. yn"NܻlPk؍Gbm47cYk.zZ # ̵/TNofRͦMN{@AN<;YS1S71%t[%t6V ,<:v}ίz{Y1a[J.)`PTn/di(|f32D2u[mJW-ly(E{;r);.٪BkBhD撹85v]?KټHVO(^jݡ6ɔz S%i ?>7F&װ] Rx)7P/_bAr{Т #Yzڎ sO&i, h޿Znag1xC/Q.(dY%Q\|;d0;Wo㋆ƃ-C R nX^6~X0憙Nj" ]_pPX3KI@!kSKi22޴7္vFLa}. ?9'wO4svncq=#;Q}, %f6\O\ Z~Ljb "`;si dƶ#s"'ü2## !֒ *Lk8n.e/\6ՙM"FF`^M}hbxV*ګ瘮t? E,ny $;Al(qZ_K>c2R8]mP-%:&,.$m{Q-R2BYѰ|pY-YpK 3dR(ЎAL fqO0 J]s5<.hz̝Up#-oV('St'SBIT淵ci,g}OMp_~W?8yT~u.!CuTtz)l%5ܦz9I$yy^R_ґʔ $0PYLG샆zW9~ɒ@ HUPSRBD 3ma ]R_jnX72]A=!>8cK#We W!oZۤKx l 5WɮzPPb&H7"Zi,OЯ.Y1h6хGa2H3=d.[·:7op I#TSK|YtN-zV,|V# SG!:n_QWtax(0Ȫ߬]CJL 3tNT>Tt`xnkylA_]*UpbyRbP.Y  9)|,ɪl ; ɖsnDydgx鶜B!j5/ݢ6RLͼtKqu\O'B[Gf۷>4莔zl6Z>˶Bjzv+t":56a0g@qNARMP(t*)(i-u>&!wiEd=r)XHД9NXJK,gC1XfX ٿE(-bSao4&W5պ@igQ '(7k pEno,-)Ne;38bεa[._aSҾܚnjZY!xٴr=~NLF Vо>C|mK .|<}/&vֹDl{(Fx߆<^1ytͿvEb5c)'ec^.VXVd " ]`nbn۪Rd/ &{NJ 0]wcã eFJUE4Q'w f߲p92w nnA@K=2ctȮ veP;x_ \0ȣnܹzb1;eB֔e!E =X;o^C=̤ynO痓*[A EX Y~PX}xwr?tbhY4:3^2q]tl\5p?0cy?{ ۣ^J[V'j0*Tg+9*vFNJ>K9PgR:P$ |ǖ !Q,^ߐvSp.ΰ'FIꘖ|os{asǵ2iS5 Ak]*Љk*{b"|ao ͆I5v0al͎$80q"}Y4mo@1C# %5L'C`DJ~D+BNnW!|+B$D U&5 ɔQQ3| 5O]qzkyL(>S"piQpɘq^~X 9+f2FGw*QGY~h+';N=V3{K]j$M0l9H5 o6^nf){l2Ұw#O_ڞmCdT.Ž^ 8&7 ֓57xv y[Lp)٢l4OU\\%SO֣Q3]gyhG/4kw@!; ]qR:l\gVFfފ°C!*+kBK 6d~۳ܮ+N\V kZDPm5{Ajq@ato0;_x27/um*/7Ɛ˵ӳ1RT|_/a?cz3aEu! qxh1޷o ܖb;w !>Gr &[ib})N[IfiK"9M < yaMdkݶUN]o%i]M>Z3(PD[@sNB]z]!| ^ރ%'NDUhSNF|c娞z.ZdQ*rHRt`)8 2inFƝi J\U4qF5ui?W-'kI$vj[K -!vbK*IiEӜm_sZO%ܤ%WĽétCCc*-z.ѠyIGg3_\3۱ +IcoM. b^wi4d:ϚV/e0pwV^jmlg\u;GO'W} u6djџrI_jg1tpݣh^2i2]a #T˦E4HhdIzdIeEXGGvV)ZG_z6Q#BF^UFazSOڃtv\)c)v_1;w-'3h  6uxdjTCw`Euq}z>$ S(9Hlo8\ Gݣ~S ÒE ?Jei&ƸIج/"!ul8x. ˖/|U{iUzV$c(\@Jz͡2ٞ7oGV&_WVKRqhyEa,*a#6Lly* Œ `t4!vUyIŁGbcf6 Qȉ-=L,t{Xtl Ɠ?fl5s+ 3zU~ rҨJW 4py5 Zc-u^1Ჩ$İ| 7lNUn&l{e/ߝ%|ԍrlCL!'ږUT]a ?\F;HE#Okn/52StbtNoq]-4/SsAuNh?[#C'wNeҀ)qE XNJh.8w>iQ閗RgӔ?u>/nИ4A>uTt"T'4Zz}:TFp,2] "t|;w8 Wlc;Oz%Filj-k=\Rv8A{,) X`dEpHgmeQAM!+ID-\ymE< > 3CgP <5nsԮ* a8=<5#i U?VSbLVlq ,PzLsQYeHj?ؓ?OP2!~"Nbs| kʹ3A"F5ST3uFW{^zQ43ޖ{]W7$pe$W`δMq؆V^~W224.ֹrA^TsZwQ1bD%\iIQ0vYC/7Ihy*Hl2Cm;~23[8C v) OZ^l/Um;9C0Ѵؾ#|-G=\)Ş Dxq/)?<}mHgB*?Ng稵~!ǣz[YEǜj;7CDRZDl~ ߫ DklL@wf\(UH{.Q 5!6Qy 按"V [IGzk6誤ATu 70 m#5q!$35a7&ň=.X"^fEoѣBHbn2T C6s U +>I3,'C ڡ"Biǩގ0lo/տ~)>/Б^GA5Î]| ʀ(LrNs0;d$:_cO㽡67%83Dn]Ԓťt4yCjIKHKn8žew7 nb!}|RX84X3H7?$9 }̦@U}Aثh^iMz{qC!Gڱ?GVVޕd6I"*+32.><Fxw??eh.ZBїנ`-k6$x!/RS(E((+ ZOΛ Xs/wGX*9B+A-FRT31@Rb{~"l! -^J>Cu?ZFςy[p"oxPmǮc38v~=g_۽*FW^aSHKZyJŃNQoۓǻ_>yt% L4~̥:8g-!?p!HJ7Du6FNL{9-oM'Q!=Rٝ`;wO\xyl.kJXGa&hqnEatZwqb_XvCRaC55>>E@`B}GkNrVqsqʲohIBد3cv-ԔuL_9m_:M*5"qxX/0^"E qP'\n.@0ߍE-B?k^|\Xx Џn;+ՏEc^ҢB$'PK"XT%C &7`W챛\`ҽ3@"[iĘf5ˁUSL R*vJ{I1]үrheU [Ϥ^Uo_1ǩBW]Zlc ;T'שQ;bs ^ yfתPqimĝsl?`6n,}reo=Kz 3 p075+z[l(އvo.0pRkq$'4uzUTфj0L.} w fAGpS+MT^4<)e(v\bo:U ciI[4M^S*︊; K3bf Ot@VZb?m4ݝ_)//N?T?};}n/^B|t^V$++o536R 'e/Co󓤦,Kd/c|ý).\ ~ 1kJ\~Sa@>qXHo1dpV xӠvsz-1tl3ga.8SkIஒ1h\;0dlG]JL/w/Ovza˖ obH{ra88ЇFi+ KQdHϘ_flkWKvY{W?ѡ(pcĮcW/_/?JyQJZ@Q!_Pd.ٯd\p4g7TDXh/`:pu2:SbQsDd?82%%-E Wp}a{Š«*Ţ'D.)1W+d7xDLt>+J@!8q6S +| H-O7&B"eõG̜s}]gfЖNQƖɓ!@]\&kkJjmC;ڣkǨQa/Z}_iV $ |Ks t+¶u&9I |@+\뛯?<e+LGO^&wc׻m^-R֏b`^`4q *ǻL*KMWݸM'HVN}ҁk`iM.`_c׸'`5;ДP-h_뿾croYoy$sn⽀.<>T3K*v3֬іbKLMHԪ@:Uu dj!UrHT&TedOP?\R5@-HPKJP($Saeb9 A/bTnh4i(]̘!8RN<x̕*}L7 )hhЛB.Gd:by}ɚ:MHT:W^)JقۏYmhS}9c<m P$J+>ӮIIf91_oXߖ'aǣE#akdy{v<)%+Ar X]O9uaE.nkd$s ;8}_.jkkKEጣU9 \'L KƆ;Bxg78 B#.B{'&SfaRB'CI [T뵾)w:U꺞K9|z}x{ǟoO۟?750f"]/tPƀ[7pme\=k UnN 6|)XIPo !Y pޕmw IEXIPӄ0?%qT3z%5e.oƩh(pHe3'yzz}:*W~,FS 7>{ fsj2->j+n \¹~M0ˇeշOo±\^"c0y%Cy<uEH%"~PR-%QhҕFј!l;F5x/@x ~E9^Յ s-U}P 클)DH F1]nܱkWSA`.gW:y}M 찥e$GmS`Wto׷e~=:._!/{"OfzZHO \N>@VbD 0T7MfͰ!5 nfP'y$_eg3>yum2 #UF{ܭKg3o9:Q5WX$fGJCV͝ڸVA7VM z#k#ځlXHK"*)ƍ rbrkgoZ$Qe~1xQL0y] Nd'~hVLVY2}M4m=!$=&԰bxVݪ.Vl cq)c> ~}+x?;z;= y6Ԣ6uz"<a WDC{ zr͙}32UeW\}nir:sJˡʲN.E8.U. :Cם?|*=uMuV"EЁF:n-8}1$1.EiꩽzӏlFŦHK MխoN'N{I?s3104Tui{2EGvt)#+$Y%">pkAAhLNc>9ejG7.UNSPְszj8=7y axF-qU%HX p Y)657ȻfD6(x7i#AoŖI!IഭxnO4VQ.CUqDj`Y#WfpR ,AUrI^@?ogkaL>G `` R$08B|V~!WސU4 s`:*N}rY Aȇ7Oa v?c;~zꯌi s_Q!i%+[G=]&jzDi?UJ1XF [F Jƈ2UpaDY3SS)f5Z*FiwfD5PΒA;lzN>[w?r/?|ِYZβcZO*kvKdB[ )gȕvȮP7+vGoT(-PpC VkN %:A7a\+Yl@Ic-0>I**65"7%Bbyb9SjtMb pAT,sU#Mu;ofFlұ0co&}QRV8KISFnAaL۟: u cv5^aA\,Ʃ*uXpggzgM5TaU:0iAC c9 a:ϥs^O }3O8b Pu `s,L<2LId;U|2AtLGSvn+?Y]㶨rV<*~&yP}Q1A(p9+JI7qT_!F[CLz_kD~rȁBUˌ,$1 w+ -ێݰ{gvO߿$̞.A3~ =60DzCk{@sϢX@j':;0R&$Ks&6 x?!TW _KjQm8-BP]LLt^| }n2c;0^E ]-fĔT^p@&MC` da&NB$)3g*.΋%`qgt#5a<}>ټ `:L09<ʮ]:N/U7up|s~˷=jT5wۯdCN1!$}1f#9fr8jE꯹X 0J*Ib>vU3l -SP~)^fA(r,Ѫ>c[Op{eEڃc"&%<9,e8 A^k½בf+$]}dV869IgfnͳiTÍ:U R)iCnqxSM#AjGnV ;ٻOMr)-XC_lAoLDnCskIHKؠ굹՟˧E~Yϑ |10<ID5S=́`ZH%%-e@Lv)%(i_Fk~ {:l #kw.E"O%Qqẻit(pϚVjU]GJNIO'y ': {kob|s({|C-k &Ƹ1)H]vh yZKG@5Bpc i^I6*~o0U{W% J5MO5^k!( v<_SRvZQ>OG *;}i"fۉ ^~;dx:K'0",XF Zg,CV_]hYQGXҁ'7t s9xmQ=QU3UǖG"}XMr`< WWV7e'z\iu"i o3lX #W/LhohׯhDZkhБfoޜŔ#dŚFGl_ckY[JFc1` 9MYF^ n\mm3,# n/y@~~l2)+n3rfAz2`:}9q>{x,_Ǿ1>cZ_v8u༖ҿ;wWwX 24dh}G.^k_z5aGc . |5ۯ*__SL$tK$T!l˵ 63+:]% y{ ÒְXi$Alt?_뚾S^TN{L A3?ĖGSW[V R0*} `}ͭy"B^{}Lѯ p6B"]Ss|kl|) ZU''DZj&7=757%uc$Uk'99 >7@o(^4N YIdZ ,4 'fg_:[ )~9W;HlU@8`,EYj4Zd.lC )ɹ%clp[SZMX[QpRIX^ jg45L'zWɅf3v]* n{V+Rhհ}\K~6B5TEZ~KF91jn`č;,PdMY:~;m":ȭYau0XOFά 3_4g3Ϭtd++}EU̺ ha0m @+ 0MzVa3Ձ)ΡZ >dCq;z^WǶ5N' -H@Te=(ǯo\ҭ+gpJ:Ey"Y*O<{}iEk| 'W-Ji&&TMpM- )p P=[b kxG"To; QwXl[_y:.YLk)zVҠ[E!μW=X :u\jS;e؏_ʸ&<7`Y]G r:mZۑ[juceDqx q]4"$If Gt)jMd֗F2^4vӤɠU֋wyۇſ珷ۇk?D%Ycp<^ { I H҃ЫSdxc t⺍5m|t/?D}tH5TT4IU{w.Cګ/ھ4! \cbNrl<]|Lbet^%(y{E<\#Sc ^h%U nvwAhjm֋B=W>ٺ܁Qci]#[yv}8Pœ WB}O[*MQ2`/n̈́<{N> >5D( 8>mM}y}j3kYjn DǟL5/ ^e$ >NWʪZ.Ge[>Q2LaπmzA*s50=YP9X3{/L{U42WScdB$*` Hia%ԫ"c x~yISN죊Lb0Vs͗K0 @&~=STj?@`}uՎ!XeTqoxءˈ76JܯԩPEn7S[Y[X.Yrl5 8}!+x}M}E_ 3  dN~/ϤTg+!kAkӆPE¶Tg=p! q{#b#;i0ls -5ݷ{wΨ84 2[-, `ɇ:.VC籧*]2oPBf8ViUjZj$FsuO"eOᨡhe7[_nH4H>m5QGH ,>͏NZV'3*\Zyt~8i?NE'L,K(lpvط܋=S dinh8 q yiX'Зjз=D4"àoGča3P9m 0Nyߦ.NVE݊a}Q m薥 ̟P"@leszw|_.>?_4qôׂ;)r8ذ5 V=1N 9wf뿾~1$3gX<ФbGF~*ǢO8p`g֪" hO"نla-6@]ңR$Wpѱ~꟞>O<<~Z?^mtQDϕe ! oD>9s4W @.nhsVYM%ueQy`1,aqJij@bo~iδoة;Ly:@T0CUn'> ɸa QԎ1=IzE&ϹHbpv՞;s)u&ZYj}ZꊫN[!i2 f}IY\uh$"4կm/w\*c{M5y-j^[c,rڬW#CjT{z)EPR|KvUcĎ֊J`\IyU.pZW16bEޖmx~/Yh&.,ٍ `~ c;KFUYrެv zu\ k2-,y6G X *Pu-?x^3pi)uXr  I_ns'Tr*-ʟC4q0$ү-`Ev>p.c@K`jg(g v8S5 (3g،cSzh^HR0K%[y7PP CIO S8< @E#~z}Atd$ QHASBV(H>#U*mCd4^(%>#>k;`DhC9qJaʗ CmqxК&*q ԟo)V뵵2Bh2\w/rh4f)V}jQ<~^w'Wˣz|J0DagGq挍})#Un:PA.VJ0L@,t.QX߀`|v\^W؊e})5#tIw j=r@;\hzJQT7BLCd8wּ[RM!X;^a =Ys2Ϛs %JY]F?,2^KTD3 ߂90jKj0?n~ь͠y!\B=iT`b{6Û+x߿S-OϷϟ̙]ܗhpku}IBJ]ك.B+c]EѴk_r$.{)T~+ai8; $0 mZlp.p+ryãh5ߐ-.yL(ypشbyCÕ⚹}h8kݰ~|rE¯2~^ w'+36s(y;՗~mQ.  ,}̤]: &UT==RЛ񔈿]4j>\vACDC]C ~i`PEdj||SCwu2;v:6[bOF宊54~W:Up撺6;cKjOUJev SA#,6HLbyfce,=_,,D`C~_z)y1暪nuU`g8@7%V.D~zF5q jJ*W"TT16zPFTh*`$k rr{' I~ߧ*Mcvz&g:MM%N">LBCX06؆P{?tf.4!/ݾ^n }}h_&5mk^.K5 [Kc=)lk rmũ'܀E7|.Tl5 9(ފ,@pA72iZo]ۻBy!T#Q}T;滔>[U5[ELMn3H}  Z/@|h"݃U@C % jȕ U ,lDM\(jG}_ͥu(KRlXjj#r9=As24{m1VOB`'Y#;MeUSslM9Ele ,'G,~?VOAsڢ} :a3נa;{zd^:Rƒt e*-/m}[\/T>,=Qu-QOCvu`!`IylSe]}ϷΰԽ΁1(w@@)&Y <.ʨDV-"1vFc~ 8eEV˼ޟϦwYPK%A1DU`]zK@La]`mK/krֈjGp-;X=ɱKUJe\2lnִiC%!z .>Tل|:Tkj_iYppg72n꘣1?~dT̘٦y8>3R]Y/g%V@ ?9 &lUm55jJ|&rө{)=k&cæw|6F1}*`XRn, s*)XN0ʯ٪H)cG.}t/K_c[_;G\\W[hYDKN}6\b|UI.V~pqA˚fX }Vz5h$g 92Uω:ux.V[o6vp:6-}ͱϸ7c=wԆ;cj>{^3̮4.HtX&Ao`mM&rro@W:4)M6<-\Pyh]CH#l/EC,ʫ;g=@ä_>?]~_-~Ǘ]adG`8F]^LE"V^I bI}3k>7h*} ͪ9,ï)I U+\ՇufvK`0מS)_.݈A,M2\90;pB H857@cdjn3ynBM?O!Yqxfa|KT7,tj7*֪ yQ+ds^dQ.nku:uP,u v.gԜUGiz8tZ|[m: N/*A3;c2ToRSèY`HQEVuRs[xeNbʾޯ>Bn;F0{+Q9~#q 7dc+UDqRKL;icb!rećည J>=Gv/eCCm_X9z{zcP͵cRKOFLld@l i$k&D+Ȏ;Jlt|~ss*V:3@Sn5\鲅GMӝʳ/|b)TiXL= . BV,Iy&1gAoo|}"Ewҳ}.jRm g[Pz5VL!vUzF;9qDx,|;[N U8p0}6POLM%=HEF^LgF,FeM놑xcA!|LJw>gm2\!dZ^ @ Z$*o?[C1,\rŢx> -5t=\Q ՗:E*~yj΢]=!i`iW$Jr#Q7GGW32͌] dʩ"T*^B*mX$ъ\wd7^gV-{c潑'^|tA g#x3cH@ZܡI֌gr -MWzVg9Qx+NU1 (뵀"c\,1{~52|Iq%'RK4KiDSRp*-Q*r3Tt&/i|9ϯ e,,g`h'MKCBMS뵸?֛<䱯 ߧS\Ѻ)\1W1p_[hnY SxZ鬱:{.U]8lf"klFIڡb|x|0e'RbbRz5P+"ۧooyL:CCⶌLUM}l,ȬyO?jk(hQ*Q XH &dص#Fؖ:amKI<$RɇU+0+az+hތn^ٲU<済e6 p@X &4'e`!e4tf gHyK"fƆ7IlQ+ OmYmn׸Zrs,\󁔵<y*jJkN*ᣲ h,B80 hÙwWTGwR^.X6u{M1lPb_d#pVφ&gxOFf]|W޷yճ 뉡&?%'hln*]]tmq2c4--u3K01GK7#=`-O?xT{h5n8a6=|Wb9՘ -ף"0{IiJ).+)G!X->/~ۇǿTdx j^SsT7{GC_j!\E%6B.Huٞm|9O=q [bPw!Aυ^ɧ߹ꜭg`1<ѯzTeH89v&(Rm 08Ҩ/ţ e NnU;}+yol(tj|PA>)ߊ3Edh0hdn޷ªxm ;@`=e7V 1NӁjYS21D} GooqbP^%҉>̼t5iSXPPΎ^H&a(00V2E @iUo-jW-='Ƌ}Hn#a5a~GY9ˁXp0D1O)su;2_jL]NM^javl^0Ʊckʕ)4X(ſ}x\`f8cx8Ȣbdo4o{C/kDGyOVzޙN9UG?ǡ *cށOidPYkHYJ{vIQܖl>Cr6("冃vo_?*g4<="˥[r"Fͦ*RoY!|N<B# \8 ?3n]&·Ļɨ?-n٫ QV#?OS|^,g0p<&<jneCS!'ܓ*ngl3==xr~tMuH%{84oֹaѪ҅8@pTfiˇoiV~x|&Z|=1 vt~+VxwvPܫ~c9N;By[¼xǶܒR W0h"V3-F[U$ɎW qoY;'VnT 'yTj9MDb˖%CĄRGNMU%.H> .є@@Aeë$ ' ,kFs3tߩHSDBv1dL;ڇwpC;;",d6[KsN]dl54NN\I֢^bKCtCoݡp1io[zR896tgu>wjh#Ϻ,osd03=$6"cR gm'Iij }DZBpP;kz t>)whΚZJAnWϨ O wO6<_?~M_/-m'6F6}8I͇3n3TDIw' 4 c.F#[>k6hd ɒe@]Y^13(5*%Fr>aػ$;Ŷwh R9's Gjxd<[\~؜U2mޮ :uN%YG7Op:c+jtҖQ'uhYK'NچUIm"9zVW_z̅/[,^QTN’ Na(9 UrЁ̷djܵO8Cptn7x{ ղU۪* bէ5kpq/B‹i,>vϷ<~8.Jy`\&A ]`ǼeZ%ݾM`!ZH|bq*uyeV%>ԜB"+? +9@NQݜc yR:ѕ&%vv D/!B>u}w/s ӗ@{HITkNfhT #Lݰ\Qlb08V=UOMӁlXf7a~ {uښux6ޙκj;lIv÷/~iu ~\ 4 7Ağ=x#5X.B{E3)}icE` {ϔ__B/!Ǔh@a9u=lc5.OG0lZ䠐<% w Wz `)t-ymupnc@޿OB2D\RNsx@.4ϒӻR>8 ȱPlī3}wcSj y#ⶪSyC{ܾ͠JcH J!7M6o4j+lmHLlyiJa) >$C0ǁ{x FnF tA ~Y~&׵ԾuZ<*^| pCT&_09ɉPCv)\"j=^>cv3N|>:fcA)]mHa%٘* E-lt=)7W̓WoրL h;aV"90qwqN yzx>]=q.^,2[ 8264{(Hvhüe}"a3InZc3\[ +n.-pJj݀!OXZ6vʞ-ZB%UKaR{cl7Jj Dg c_cV'k bvj(k-t}GH&+|#]ʙn/iAbPYW.H Po| 54gf $$:͐gUX*. )(7ef%7mOd|mhfX^5E"\+_tRֹrW_dF8$ .b;_xwBSJpz=_6SquϻiCWlߟ6wz?nmO+Yφp+mZ \ rbgD Mkeh?5ռ{iyeQn5\!Аo0q9f֢jPDb0bFyC?f i/9w?>chz+P_\`kYA8^{zP1+ tx{{o"o,ƉMZJwQuyi B#p<\XVQ߉5Yj@& <1،',l Cm \" q[q\3ԳJ*6YGwzEc% CiMHP-1. YJb蠺ƒaa'7Yq30fU4\\Ӄɖ|6dh~_}0k-3uǬt9:o,6Zc^ >afLtf!% E|Nˍ 'a,$|9Wҫ_Nw{ƣfcu l Rr4(WFi]+Ynɇ19S (Avva"$cfuEڔBP𝦦RIbHXHL F3W6޵ BR/P5uv;t -%{M>t\V9n08PCM`WZyT}ԂCJe+رa0^mo?2xDoDVe'Nf@B)sդcLmf%7d aԛ mcZ $r TWlϐ7c>ex ..uMƴܮSNup-nHٱ ʊ-7z񺞿F-SčLjv"%8#jRLCHul_VQ?C?Z]Ǩ[ ^h5'Z<礑ZIZ+OM?iA)7:;*nk.aۨ`'sN y};sCgn3Tl(uħz7lPs&֎/o3ՙ kb]0in5he^8J nR3b]fD%;&L4ӡ8+ZܖBB8 ܃>n|9xvI~nw|!f1ltԏt 0IDD,K]'ի[[=3 qx I$k Bch-"TB' u$xӰۜhL6ۑQޗ;3!1u{q6Όm^,}5w%sMP&mV7҅K^4m^Ng7K1 mx#T)ZQ:AvNEH彤ѶHu,b!["ZY4Ub|,_.ԷMS?y>RN껧O4a|ڧeN ^;uz]ULukTeϨr?4TBP.;SffJ<5agAOޯ IGl PZ-IR)ܬ^schtFˤ9V+[m䧍{%8 E#7c^#%zK9xSg=wOtq:X_ۊU ycٷk-7z2=#oӯasZl,E3PiP3A1\Zװ*,vHa.?=3]Ue(V|I˗qVERNa_1$:Ϛya7J G5A)"Ta+C7PWNnۇSpTCݞZUJJ,P( %NX5V[|WKp WGVQtI<;_.vӧ?}o?~ )4< l蔦g+Ej^2&Y skBd'$.E;[i aQdkOVS6ppՑov@ "YۢJBe~/NG _/i@yNWR$Q$bofXԞ)n"笽uʼ!eW{{XWq0Ӌqu CoYC˰>0ژhd nڽG RAe6)O6m6j1yY'{(7Zf{^t/R{sM⒱nP_E-j2zxzU||IWhND* `Eu $RxOdVjBecEtKJSA-W/2.ҮfRTVVAk!0|'{Ud_^ unTIknF:]rdV J ~!m[큖%%jT@Ӑ:^Rth+s Dz\\<$OWo*ȧߘazG)FO@ *T r#=2ӿIv,M4kU3F-3[̈́B;T0)L;`L35)`+*t/FMפXoaxC^-cfWfD_Pzj!m'E#OhVˆR iตAKV(E[zqPJ1XIW!c렁Ssf<TMG ) }Nt8qs!PfUTj9};OB.*E[m-5=KJu8cbm."=̎fF3:DxTdO0j;p&y[Un74Kbt߆\ ggtP8r 1Y>kZ|!8l\G2v 9)Us cN7i3+tğ1X;iRGHj7X{eu]cE>?oNF$4B3g|Y:S6wWp#̫7d-]#IeѬXnD$*cIG`n 9IA6θ?_ort5t ߭uͭ9˱mΰVcv>hn+$kN!$ >x}HJ59[8d%<^|Xb2UhA:#\ v~u9YXia 6#z8cޤ45s0Jݰy Z#ՙU8xml1Np-]Х"M?EgY30K01XtG;KyKY:=`[yls,eB"O}/[f shcԷ'<Oda$O:+OO[ġCME~n'nr_irX6vL(d-EiXVE#8 u[vêެ[Ӑ Hϟ7MpN Z;&FLP:$FB}ɡ_tQDg:64iDi?s`yϗ O3Ǿ+7,| GN`AŨ&_P˙\QakV DNs$^~?'fؾ/Yx˰% •k D3ğ};"+&g9h|Vt7`(9уحN5}(U|FcrJ4$F D\[:G\{4F1PW謭s _-_LL-8KwdqKNYV ˾"nB5q@%]洔k :!{+:[dOy[YAގleqp"%9ݝX6+,(pR>gְN{|tǃ@׫qS뼝m dE0*p0,,g[ìVR v,Xf4HSв #LQFؗ,U`HgR[[}M&$bvtLg˲+V=Xbnk-[3*{֖qdra1)] 34sgdY؅я}}a_9/b01xhedqUùOU FYcq=] 4m 7LM 8TNȔ C*SOE.0^ :tikn{T%sA.˼[?7{ޘ߃vj 8B& '&xc\aB] Ԋӡ}WQk.,: rix00c^ۍ1]X8Q]Z\(xUmT~s*r H{Иu/{%pPեJSfΧB@HҺLg)&-9f``!F0cW )Bmv\mԒ) u)CccҠ*yJesǤ[ra%.v_ ūX`Y(9+AR4pؘߥO<&1:ƚLٸnәxd0$K㢤cc ZOҟ2nuRQqm8%t筮]ۆ({3ck=^܁Qh1(4|peN!Ɲl~VuGY'yk EM]v\ HhYq-c= C2Շ;ֵn]Pd7*Đ򬱢V5ry4 z1QT?wJ;Lc:jqʋAtv8\oW;@{tP<"7}YAF!@X&r5%/٣-y=h^ lC3{%[/t"5T-(:lʵ8'"^l``P!> H}dXgjjY9݌r"(KTJ|ȅ)*ht7pHtv, !CMB|OOVCe8x\d,%oŌx&i؍I#qѩ$.fWތG3(7t|f vJT|0TGM4Ƙ*hCj݀|{ԛšYXR5$dK=8?$D`r5T ,Z^Ɏ ukN"qˏm~ {?|[, "`QwOOէq{kV>s=T:ua OZ k$8xQ%nJpԎ0#͔ZϰFfSI6ԀS 핀>؉􍌏Ma#y" n˧E/uߜy:#2șv'a=9,pқD5avL[#ۘ$zu4a'!$(j,âԌ)̢Eh {uF Q/()8oJvB , o9AXxY_>A^6iUq84nTnU K84;Tqj8ToW9u?;zgLD}kx9vAFUPYڐۑZZ#}DWHex P 8 ~aeOaEIjc`ģO}o3:s$P:f,bB$n/%CqϨs5>o}Z0+[0ʛPXٱ;~OJz=l.SZ{q;-Z 7y |tă ^QM+/:*Nɏ?ſg@ +. [020ZLa(sdVSZc!p@__)!UQEEw.'U)$.4&ϙچeޗg̨݇R]pGkDaYhZx[?Ħ lݬG>:rw_YsԭBPRٓ:+lz:sDvK:BۇMp|m}nF) @\G #/qgMK;$2߾N;'zc˛2Ax9BO&>wmThxS\P"z1<^ԗ7TkE')'pHO3 Z0-NO+Fo;61֩. Bd\= 쎸(ȞjXr߱ Y6utVT89pȃ#GF|d>B?!%.~d:/ƭk"pCB{}pnpRCJK(>gshLFƚ#lֳ ֢S#|;zքyi^t=Ư }5çXa90ix^:#qꡣ5 %ݴ$_F֜b+8c '4DG0b1iT5mӀWd㽛dYnp4d[6Z=ϴ5SS{k U[`tb8m'U쌔%Hz#{sQV~KGrLrF `MmȠ3 [Eē8F:PpMF< D3̸z{x/5tJ;uX%/ٵڗSG0;8SvqQth"DNo2g#4{}[p{a9r#E!$R FGq^ogGrzؚ̳ Kc3vzq oHC<#C(F= rUp4o~~-/Oi/^X@iXmXn\| ?zNG%ydsg$n }& C\S!D_Y]SwO bϚ~8JsmDm(^h(͖jz}ط+n~<7a+ N8s,_rR4]jxɮ8>/iQ-׃q#^Ʈ5&Y.#xR musը ãdc.}84Tm7Ն*ʞI iT'F^hj3F4ji8oF*V"m2(!B`! tP>gd/fDWA'8QcL6;iXM#S+2Ϛ:h4K)3V/Y36 e~0+◦=YPFkěg/X8VQE]1G rf:NU3V6}3\:M[M΃U)M5" |"y8TO,Pg*O;NpuW*l'} r-6۶vNŦuٺ AV~_qukvjʝs?Ow?~yrU6+.=}@F`#F$judA`:ބNtp$d!Ij?^ h6gSq!H;@kޖM!CgVLfq]YTM>@]NN JN؜U>Om;-Zo:]e!}\Ğ>O;owQo?=]q1姩џ!iy!2jgL XNwVWW: YRnA@ZWcTgzFa~3/ c P\1P[j>Nfv% ho_hnmjN:71k/#3e>l]/餹bWFjDU;/l@ 7?hf;2[WqPxAxz-ZzUy>cy#T<fڞIՖWjCC7{ܛ9lckߋ̂z>T 7;#My)ц1!o*;p߸=3?s| \=y;q4"A_(-jب׿-yOgĉJ3Ӂz4N @/[WlpBMK9"̔I*nTWj 30m8F@Kη&S&yҀٞ3};]=>47kiw$6,Oşr>}m_^ayvITĮ9mn%'#1Ԗ1Y*)'?zTTTc:͉4ͦ꾣 [@+24kWrL~>Qlz4Y%/Ô),43(/98;k%rn,1."~cӓϻpC$ hTگB`bdjfoNcO]`q!bEUŠ6fvcAa zkcREOpH$pmhpηbzQ_z}CZ[,iߩf> _ۗμsՕnՌWaJ~ROWhq**\t (X O+H2c?$NqyĖ$cMί1l2+-L;\m\i%w^Rj: 6Yn74OF^U7rFNL$Tr3TLq,P;v_Pw$F6jiכ4LN9 {7O/_,>~Yﾔ/ߗ>:}u/.˗/VlG.~oShvS߿[b 'x8 &pKV%K1l2{9W+m$8pA < <-2mMXEtaݫqo׌)Zؾʥ-U}͌J~Cس婰1HqOh7?*w"8cp%k "\6C7jhLgϯ6"7BCcO,<4j tݯҹ ZĂZONk XlBoݽ$4- SWԷݮ5vG6lk兀5iBj6zbDZpr- h5G-Da+FY/AF_ Xm⦼Dϳ3J @H@#z:q$%C?r6Z8k<ǂgDH5ύJTr~Fd/#yi-Gnd׆^=Oj_\j|)_x~=`YJ()|R ۲[|X/spo}߾$Q8SQbՠkHHti5Tk<53 I)[ tDv~LÕi@r28v(neA*WyK<) mRu b "eb~.]kֶ` 1w hdf^IayƓ9ު -oF J"ฆc+γGV&`;18z´V3 yȜ6+t5+c]T:7W0#M[\Ges*tPjN#8gw2FvB> LBt^T[ O?"Be%+Vw;)"/=_Fml=ox1 篈Ȭ)E(ޡlo%@n,m.pcIZBKoߌ7Nvf(E Rh=@^렉UJ>A˖=]t(W79>մD˦u<7j;Lڢ33gE%ɀ^yť$9ND3Ӕ?.xMYH%sđLA6u< lX :$ؙNggU{_R(OgGg=i q+,mS/iMqdUK1'hvtSo%#S(YR.ӬYgb.?\נH'dhTbgG,k;4Ϭ3v02z̷h4SS<H=0xoZQյ36sޑgf:4kEТL2q'-p{ rPsl4Dz+!",E;V`i@bϵW/'U琾kw*9 Ӱs[)NG @i3'rt܋o"rDk3|p! rHtE8YsI:aXc>7/:SbMem)*Y 1v. ~WDOKՉ,DmƜM.m>4h!2> `s362M Vi$DBTkꮮ+C!ݸyt^mdh[]mҝphnl%ZNǎ=;3 W ˝~*y}R *y@dUe[5))%+y%+qG]!,o˱T\ UOL+p[҂ 9SbT `PI<&5 aÞh!t3)]);PwQ]{-ldBؓO^\JST  O&2SuQKg NRۆ]ZlCbGS H$QJ˪j|Rd4MVfX{k]}>q5 (]N hO˕wB>&|鶴 ۯf2&KŔ bUm+Qc9s(J*)k,g'>]v,aX袊;Z!6 4T2PhLR_G<%9b, yE;>X#V@0 gϡB4kD YtY# Zn /R xȂWǞ 0&'jP40@x(-KX>j{F[:V1^ JN P'l {'?cLe=ui dEmW&cǫFݱ`z9S1u̬ N)Sͤ;7W_l5]GD! i($=uDcc3 a>Roműׁ~,\#($vhag g֣?ioVidЄd): hp,@Sf7"zg˭ӧl sk(~2xnܜ|fϨd' K#,tq4;.&nPbl-ǁհ,'ˑQ_f K46u:oQqDMXdN*thKxX㔗OP?OJB&3aQrHPdU\jIVȖ!{I&lw0 FXPTo׫G'>o~{ߦt]#[TUZ̚APZx8)nBP}Ӛ_x:< (<;(Lܘ:IxlGv(`x2ѤCY4fXYn\-r;&xi5 ]}լ˻ !P|t.#^ wg.#||"c-~GӊC 7 zBr fv|yn>:a aED^/gj15Y6vf)WXDDka}m\Yż^+v/0紐cA׃wIg3(3m[d^{2^d߆(>"vI.O̕-mÀ rc 3@p:JP6@)xzNd]L9]x %Iu$K-ģ'a  {J/<pSRеevF\/(dC'2+g;*scA]\g|9Fɦ*d';K[_Ku&i]!`E(ŔOf2/ >F$趭#ܵ&d8\s ʤM?+S=}ԯKx\蒴DPzڭ{?9TXe1| h6?%AS^,݄W(9A`ERo AN{*zvuyx\v?xJoǿ=󩝦d_ل?w_>W?I.4<\)[!=EdʘosI0!뺱x#ݼ‰1hq5ZC2,]Mx f(v ~}Mh_^GKWL|D |-}{[P%OWѐ)u5F# Z9`ƷoOHzC;&νEd@afZi% \Px3Masok(c:}x}̍sYIJ 5w$!vpX.\ Ĥ|{Q'ŕ*ZUl1Sr `WYXN_ /X3 =q S,1qsSgYۙ«sC8n?EG5RkF2P ==eЛJW!#<C?[5.;9>?P'@ QO?]%bRͨfg_i'9oqEh"g'y܄z[bf{> II"Ll/=оB&MӧqڄõўT^PBF$sćf0`J_ǡ7n+ $1NO-YDAXFQdm3(v#ILЙCKAKZwl-EQÊ!2'0=KD3S(p ہ@[AR?/g|W޷y(w]7nM<<+*@BU\3['dU LӾ6yu|ܡPCDѦ}-^K%67FΧ]oOvy_ܱ oMQN!@SRk̜ o9V7·hPt:ز*b:r+x 4u,Wi`^Jm 'ԬJ3#S0*6P6D9#PD ׵*f +1^Է{ě7'\8矶k:)eoRq&z> cRD=3VH'yKs^ߗ٦/:8Eh\s=1Fv1v 9c"ydޑGQb'xQz^x{sa!;Qv߶>ԩ6xi|]n-l'8йE G ,}kE\5f"VzlxklWqWij6[/ %3+C4K@/W%rPݺV8 {~҃#NNG\CU}_*Uv0:e*Vյ/8d7p7(v̝0\x?{Pw̍^ WM*Z%k>69s `7vTA8d A͐鴭?>AI6m꿥fzg6ۊ 8(]]:t(#X1X擗y7! k bgMqVv?F`̫Zp؀!K,F&G7LE5Yal9o&dsux 'yX3…fN}1OU,4\g>:Vm5Q%4֫3mElM2yxR 9նGn޺M1ث}P8!x8H&L+dK8bh5.bY)1_K6zlDij=SlMjEtٝkG8yzkߛIx>H;xvul{$< ۛ& lUujuaϾ^Ыz-g;s[kQ՟j_,,x¬eM Bc ǩ&8vΆ*nN=HiKs- * ȝIuOb8ϜT,1VI~o|} )}|QvY^M6>Sc?c׳:p$h>Mfw⼆Qa\eo r~&寪a69c֊L@'ҥhyiZ ØrHu* R+/du ܑy $.Td5 pNJK 11>w>/lI)-+~DۂȖCٷ|n={IJz qSQ&CSˠ}=ڷ0{I迪S4Iqu5Z⑽C6lX022SumLA0 t'GQT a"z}YSC~mުrYO#>NX~1{OZbӻJYC'4 j@L|SI5yy,uuO77Q{uQP1k ₘfWk]Ս7Gسo )Gz"P5qn=,RUWVX`FX/#;ݤnH,B9 aYzH_,mZ @-!BJ%ovЛm_ԂW+e=chhiΉfMfCdIY`'9ٚ1ۻ~!ⳟAYTƬlZaFsl:s]~0#unURU#1ITklG&`x'd.m'ƻpq8*-q~c>ݪ:<5ȡ5WfՠoƽD .o>LamcYezsqŷ|ߌo>빙n _hߘE"a7?MYBdꏖW]h7Cwr吻R09>7!uڇ wm60L8)(*|4Bz~{H4t9#DMES /& > 7~kd q4Y`/x BŊf_eNlud#P{E!RoxXMD0_y:;Y$ا4cP6< x׮t}_wju#[g?k G(VG5فF2`k>C P,L侚6sWj{]潹HkPS+ Q1( ɒ 4],iL߽C~TQ|I/ Qk4ՏA3"jIhȚX)6K?1ZlEŘmo tE {>Ky,l͚4ZK;!k0O@lګd "f=*_vig2UX]vC:32Jl0^6u?6EPH롗sY2`nƖt'W<4"#|z Ť6!a;{ɸ؄؟Ag_#:ր0 [z5[MzA1kˢ n܅~FLͼmY]} tKa@CoT4b{+xٟM-iEAG5BkxâSE)E`whPh5UaAJa85 _eA\VB{J $>*<`КE_i.hpki?nB,$ZTDu/'k܆U ;:pm6:$o**4|M왏kN*L"P- iVM7Q*SQB}@K|SaU!U5P $tUB!1r/=2OeoN>/?a9Q~)} ";1+HByB"(PۀZ}9|ɚcvTd4l5߽ƿjWO{iI]s Urxh]W#ԋժWhce.-=Q1uo7YBID).@L2{8XDUikNqe:\SNI;K6jMw g+rP#`xt7,;Yy!bDz'^;pezЧ,uZpa18!$?]b$Yb6#dM_$:V[W'HoZ 11ts]KU{=yGN @6tñum]mLmx[6gꝆbSyLF$N:;ʨY|g.$7YnyFkfhe_0?hccih><wEҲeGT{l̓o{ZF9J7Vsu bԖX2*֜8mrr`h5%B,`3S;_P qeȸtz;Gh+v6OZR޺Aw_ʋB]IWf)_Bojݗ~BVm+Bf g:XLh٫,{C.PO$ E*)6ƞG󃄎Gh $GZnK 2))KtF cMFI2-Fvv+6?1c;7w a^ei81;' MP?X~~}n9ؼ&ciͅ#RuFiUf5;Q$QvrQ[ѓ3;*QSK$*\GyF mV,%V%Q#@(%$}Y=n3đSgU89.NwrS#JlpEˈ;R2yatd =`ti9_g) oҰѪk.*4خ .W/gGU6-)[%Dtz6U0]ݱ^$4x=6F;0,UKk3>:Px~LY{Wؓʅvazt\RՌftȩѴU0R˹id.%aϢTcs Aڋi2„)z9;dW4Viա;16PE۬&e :E9o:=Ė-ՔAdhYsVX9(v Fo_VyGG5DpD킣ȠY2Mn[8t7X4h Y|yvC:aW *xZ( ARti]ֻٕpuip ]r<icD9:7ahw$YXx >|:qju3J9HJQrg+e#s̽p} ML&G&n^g8}*韫_{"|+ql*}z/SRV+fGJ^ Bg!pQOx\̈#mxma2A :^!^Y \\2zgGF.H]F+r7!eĒ먚UU0iqցH$d&.hg4Cf[f? $kKۨUAzuL)4T9-l8N\//[:\49Ě5 1QNGӯYdr |hr )aI9˳[ǯPw*!+w@߸QC@ ti0Ur}6 y2Ge쉩Z/0ZdCmtR(@O9kE`?ݼM!NyӣX$FX4@TMVmPf`aQMWށ yXm#v 꽶9vz$?%EW^ *3QT'lIE 8nQ8g ^d$b6DO+z +uRPqPޞ&\1J nNBwq%w珷\|1XEF>kK₆C7,xN l{.yڃ6xm#}`;`H#\L2Æ=FjYQ1(Qa (w%wk&5-ӿ%"xC⧜l y yXuG4H >I˺2^^3~0;oxJy0)@{니c~ _w(Hom x2 %tv5{ֆ71fXP񠳌 ?V 4P{Yd,A'.nscH*c]zke,߽Q*cˀ,0xwBǪ$ r,Š΄Z/_$M2#Ǡar9:]A -/Gn)=T(i)*}WI bºuQ#5 cpP?atVRbw˛o0fsE%_f]AzK{B$QMˊslR0 nKHJblA*ѦS$yY%S{rC)[I6iHCb >k˜$xGv`W7TUOAM7cH xM_01ZbCaEk`imAbSނOdo3"ͦN+C{J'%bv `- b:C}}?ouf0s΃a&̡}1&e+ mz@6+ݾؓB"~£hTd{|\T~Y(OXnw {gXIؗoX[ qc R97Xޥ}av90fQ$Rڎ-b ,g /F҆r+ڪRA?ҍ,_E}} X;%Gb"GTкتM*"diDLEΆ:*HyӰ9eA Zch)Aiuo LH$ٙRX~iΘ" [%)]DPPyz+X"+5k ]EUTB(LEݵ,F =f6 BxL4ۨQHi꣦i |:1? Z]è*1%55?_=Ƕ{ ZLm0Q{1{݁ذ6Uh|^7 8ɦae@CjS{})G!>CG}}El%L.UMȋD*-֋ `q-(q a?G`m)Y,YLE_C*V1I_ 肁*mJs̸jy՚O V>\3&󰊸~9WЏرȎ~BRc ,meVE'Hmunl*ɴU UR xݝQRӧKַ9c:|󧇟K7?C̴; ص~CisD+8Ntɇ76]Vm=M-fHJc1޵W vx$;g{,{!D6G5nP zsE^~7@?[I$V_$>%o^ȯ-D RGp^s:4Omkbz^>.}\6Yd@K >oK" (o}^'qUr*6oCǤvFe:i3sFEubGE8zeY; B%=. aTRwMyKٺe !éhƜHJd>+ϒY^jyiÑ&,54!^j+}+O26*=AaáD+1 ,laKJ*[Մ'+GbLzگi`K*|Y˭#3 &tten$P V,'a?˓+h#&R?!5e\IaxbTLn6Kp8ĉ t;Ob뷑z4}ONՖhݎG /oT!X/J!2av^5/kGb=Q14)B1n#-62)o![I1 DkU@'T[fͬEW`˄_"ېe%gem&eAUT1Yy'7۴Bi@h$~K| o41G`FaEJ ?̠򓻜AQU,^+!fCs0w%cz)G'aT|z̩ dN^5EM7#|"^*gW6^YKŒuCrrv5\Qr+Rv>uwn/kȅZ&"Ӵh;!y Z/tZQ[=df:o_W}ԒEƾvVR eRZ{G/Ǵ&*iNzIj5Rvpx!KN'l4KDyo&)n}$؞P[;32~ec`⊙S=y,{+M(B*öjn NUgcMa"E5qD`$=vF2s_sa >86S2vrhj6  R<3 lcƯS]E*3nsISV涮h`- R T^aUX!]ڽꡟ2OF6Nˢf[0?Pzm?/_o|~` >KˑXס=3eݗױanل}yuJ8P\Ҳ0g]un7OFCG}qIak|(`1RW*6mW%S%dܷ<Z!qq|y7&Kd?"6(73b. OS᧧Oqe6zF83~yoDKtqJ{WmiRQZvyh9@Hrbv [UqQ)5rK/fL}x̪ QN$ڌaR8amiCd4kaV&7/2̘<- 1,Shm`VKdELOaZz&W}%:_98^^_pJC]O7y3:<ػ\5OYVZGSw}yգHC N17=e9EmCo s g~m] ٘ɪbL2I\ hl(ld@|,p܌i4نU^Vo&y:Q 8,ë-) ?=޷?y1lW)sv FqܒшrrmΊ);^HuOa_82,zh?Z¡3IzJ- O!ȴ2Wǀ,Jn (J$(b7 5o:2Mt>*97kȼcՐ-=NyӅ52MN APFo-6#=)0MBb ƫ~/s"e"Qv2> ot==-׌-+((ہcoT66'׌%Ǫ{eq W4?eaIrS5οl:*2{g˸FDՒ+guƔ`2Q,@їcDQf[i=^ eh ""C?짢/ e*R;%﷟nſ|y!Cyc-26 |pm-IROwŗ 'AWGJiq# ~ٌ3нzfqg0U^H}y:_e?@WZu8ݛ#KW3A+a^w=VFy\f^}Q)x,18!R~*; x{3#+x7!/kފ=P|["<{6oy;zT8kcC}jC;\6?} 蜷d1[e{-F^Ͼ ѪҒVmt"ar2x~4Z!B!.֠wh2 T"ʔԜ2}۳Ӄ;Uةg6/7y/nLO _e~/X?8sI` @R봰U}>aʎ^*J:e*#[[y˄%m%` |#/\J{j鍫yjcNE Q7 xp5V׹~`}nAC߅z ~HJPsLMe:ڥWWk*@p $owrŘ斂(`=;15W[jࣺv?Jr`\G|72m|5vBڻ#j]WM dDT^&˻IȚ*˜j 6<͗aN2CXJXgGOɢ"/+Jŧ!Bc"ߎPdr}ICćԥĮDLpHkqρl#3'YMP= 6Tmxmd&r֯XЦWvAkx-%(i4ENy :o~P1цۡ/䶂T5O- Fq^w.*&J`I}훍4'n~?TbN4aq0%wx@geкcwn4$u--"ἄjjQ V$DBاϠ W!3>Wo0V  VUMF8E},B掮 L.V5@`Uz l'1ܳ&ȣ$e2Ȋpv:Tu0Ϸda0%2|QGikl0ΔS= %::;RHiwFn"█jU;(cc^<{+ZcZ;AsMN5S4!u[TSUQ|vҐmEk;p:;T<936;ՆᕬϡR(Or u`AgΚ=q}'@kFNsƭo|`2ۯIFƷm?.bŦ)/ٽrWDV^kzf]͗1;r uڕ1)@V7%gT@VTs9ohsfN|' Flq{D{pEt8j88;W*-4-W[fw";"-Y^{\jUJФ[, $(Fh0p# .y5~Α?f}a_[jFIC?nY!NWe3 ܷ,Q5kk%wB`I,_G襓ǪY1WMEt }=5`P^Ƿ{ P9#>p`y4zV GsTes&'m,s:qZbRMA$:1H&1|i?-vwl.sxDyִ&*$KZ{&$ K~MtE::F]h8*/yaȰS 0[g/;.,WxRYi)*66=r}rsG}O'T?} bW`FF О-5;5QK'Ӥ'EPPo_t+ XY8WS]|e u;_w^U.[e q+\\Og9uW m9(ɵ5ςM/?"ZAwO+F`x-ʒ:U;ĵc2_|I/i[21`Z[H%8htZ?PcdioۨbP}{O.4JB3Q\sq#1TgN}DZ* 6$+k>EuX CqGċR>WDOX>kS;ʶ&g5e} 45-|3+L ERUʇ?Pe8akގ- `FxA_K)E76b*A oU,iN#grZ\M@72J},_mOH e96u\#":@}tX~jV#AHSەUcbImYcmTYج'ԵP+a#3'3:m/KA+2đ!aZh1#釹)4/g$p \\ y {Y3,t-9SOasC5 xSԧٕqŽߩ HS׼sÛK-NcdZh,<,gDFs` P:d-U7Zm!0?t39R[^2,tN[q#ށv.QVL=CN>63giN,ROf<&bt#ʂu13ug䀣[ʼMlC5$-[ bgv |Mk'P]X2`np-dbvF|%jhLF#tWdL$TP×%_Ѱ8 -nNm* ~3S?<*'9N3<tȰ 4æ%oϔvvbDLdgN Jkz!)*=ImiafGp5I#s,c`5݂Qs O} 51U$J\J4=ŨE1V-7B|"qk>׏=Tj9E:}(cS2(r!)ţ5I§$|*]^ϒ%GM}Rr8)bHJ@l7| nZ~eZAv'±TK-t˨)m! TN_f&D%S(oꂽP^h1ʶQi*Q,MAeW$(M^c3jLfahfN;k"ł99 Hm3-2fy8n63_}⺙5&7nwUgL73;"XzVke9)ܟYP+@ 2zS&:sEk{:Yv"h]0 H2"ۺ z3s䳖'{ EK @/i4Ic8gl[zվqV̤=koT7mN7-z)&.^yMM_!5Qͬ~+ѥ5{syF[q;"Lf] СcŪ RkzВ1UBj& 2Uab00ZRc ze ,Fg5lt⬡D贘9]l2FB`j?fXٽ5&lfuGy^uQh89P:-- G~݈q׼ZҌrEnm5e.׆Ѻ-VFo Э{Mo׷"TGNuPovsDe(֡ylzto7 p).hN6ߣQ ZY*.~ ZǏF}9t̡W5,glWlz hcTKϡ)9AQNd1 7FIl> GxD̸;XzE֫Zܑ=SDd]5`l_ ]dbl_p4p;ưdC{3n,Su"zP.G\P+vY3 ]4#de=̅h,1ksikM@G-TniH ?I #}S-&Hg+x*FS+ ˒ r*,0B]U\1?}m8g}'`ڷ" 'Y<[( * p@ J !>zF7'1B\ssȵ禦:7$M@7.Isol@'IBhd(wf3G[Nج{QK)_ޘ7LHƵ̘m3o0p7 /X%c5@Yn|SsD4~fa:l^}7gC{a!?J7 U ' -Gx񘊓]oaٺS_neyDTy5鴹N?c RLőe}66% +;T;'ql•:;t) >J| T F*l/oc 4 cU$ca*#[63[s=wL-Ն;KsL(tPMxifef vGL6 ,LvXt6bՁ"ԥftfZA#;nJ5.;iTkOYY,qm@ߩ'#En.@d[).m4bN7▭ O^!S7*5wTQZp`m,o]ڞCs n,M@^ԙLddUu/vURũy0C?vٿ/_?ݖ6$X_n?]r|d iI“k&x(9{Pݛ*㞈\ >D fq2 /,!0[)$BT[;.&vL29 86 DOUZ՟Â5t ͖xRv}?ۇ~V _<,&f6#}pV*8b¡84>OQ Γ@}e\232p.< MLeE"&Y ΐ r>a HI,O&^_k"J瑉(YZc9U;yE #5*1%iR54Ď7̀olBȄkb uGT]2{dx]̀{QstؾbWxYq賭 &}dB(F":СR J_0AeeǫcX: oP`xӲɾ=4~1 )j$>Iߢu,A84u;sM Z xVUB"^}㤢oٕPP mGY"q@`T]>U&~7DHRQ6݄1 ]ԑGmĖ(Ґ"`.6CMEW35y6 j.Elof//K5!6@;NSztVږa=Z_;y?`OSٽ);n7R1#l# sD彑78fY)ܵfSo͍$W0W`sΌYPiC #u=/Tެ,w_ Y̆*Xb]|\xX򙴱wh)CE! Rn!aK3pxd/1"RB% x+# -[ޣ t(#J긙ba]CDҲ`1P%j^66$ar cHcSҸffLk(dJtM^QbN)Hp}aNGcZOڷ8 &r0C?ޝWԍcM5xX$7⟎Ϲi887P3  +w:ߎk{vQ' a@R0Z8ݒw3Y";eU8h0hHqQs;2 }Mޤ]:٪,6NTY5Rh)fԚ) ǁy|OSq{wvQv>"0^<] zۛ6vSy;$e=­lcpZ9]UKXb 7|Y].~%폟N x]KX<+Lb=_LCjV`r8Uo6x®a^'ab xF!E*  g\D"T֋?t[~ _mxee7Rj^,4 DnErjU}hJ><>xYb[V^;aZA@zrbG,lYwR5f<@n|өf۶%1(GC.j My 8ܥ"=ࡘ0S%>^ kv?}z_|=qjI #zz!P";[\!xTJ1׷czϟћ6̞To97ʘ{޾q8+{~d ˹QXtZr[֡ u/6b]맇wR|pwC3gl4^"sXЍuqPiV6aLF5kfXs'*O">#Y|Q̯ DEKR7伇Ҭj{up#B{=j.討: _*>}R좜ct!"?0> smnYv=I)xɇ1Mi_#"^3Rh7|(Zђ/k@C(٫kf|Ycn4n$0'V?Ո \;A‰(Uä>Uڨ8HfG:QqV7ܰo]`Q-xื-[65`ܘ9;^٫Qگ aU- %8;^z^>v&-D~13گ;h<ŹtIZ%bWVp_ܙݝ/?!Լ 9j_."i _@йYI*m| @KBt'R*e/n-}[Ժ*832gkVi4~v6Ίyːo!4 e=t\"˼{QyJa9e? >]P~`: "MBѫc)*q37N ˝s+sw.ݥo4uBX#{?O(:tf0;x(٦ ~qX!͕ݸzzWC=-VזCF8Qrr HmȢqI6S"]Ջ_XXpת.hpkILgd+J t=C:RDr1T£OA'[ڧmEˍ)y "@•mY-9>arX˼=hvM+5J`[b%a{U*ti)@mw s%|ji$ !l`wU0;H۝m.Up4؟=W@<<L-ƆC:?h!̡N+qRIdylR y|([86r'X7*"mR\]Q.aT\1u;XdVpC;ؓ"ޱVsNl&+nXvz}m>=[v,(yC*Cs|[; 8PDrhvr t4ج 0U Dq<<RB2K]xX<+q3Cd&_{&$AS$'~bkRGwZ,\FiKF.4IQEvaS_T |f J8TKe匜b'hdKl{c9wQA`[W8Ҟc~'0BtaI;u_g#[㟰!69EDPۢ>@RL:>A5qc@$D[Ol>ءq4? luq[{B2h*wo:fׇf~?6[)4E|kB|1!KđuK>F9XKDaK橡\~FP`'+^>r3%KVoL鈆\dvI1 a1u`Zz\#Q~̆hiznt$PƍE>6!^]ޠ۫lU{Y`Ki |ԛ|~/R(X ODnl3*PjsQT ~O ScӲԬ= W胭 ]1v> k%Q9`$DX7}.@ͫMrmqqmEYx˽^F~d).h0/:u 0ժҁ&m03aޝo,Q{`! u! 69G5C0KUۖѕ(+% M_Ovw?>290~(]軌)!˫lIZMZc/Tn*$튛}ĜkTLW{nIe+8 3Gdxq`1 }l'cɫ]l+0#GKxdC6-TǻJS#=gxZ%C"ۿs;@ mR8;7oo1tS\i F :J密sF׺ⷷeoՕ͍^,Q_pB^k{ML0+TppC)cK yбC_6WE`ht&z¡BaX~|dbNHtvy0Sƽ>zvz6 u}&zhnUJAnP0 j2b842__no|ZW24ZcX`-i:0'\?K:pp-ChhFqS*ҫ)"㚸# q6Ӱ5ms-;! ,N>]E[ñ??O1fϮwwxw ?yz3xGJobxm²>8AN -Z"JJ`}zC~iK/@bT%c)&jV@Gb.EG#7H .Zp[Zu *$P9iSp>2ؓ7-TQǶnw.,@7帖y酷i[(UܳQ' rv\H)7V(L ,d쯸Ji8 "j Jicz;Ʈ2.,w#Oe2<6U* S(k4^tDFN}W)VN{QYr}6zgY<+,\ _j۵ykԖۉyyB?2gELB2it;dKj,ѳiR+ '~LuXj Qc<*%RbvaPWz5@T-)b hH6?Vvڋ&!yN_5 d研״3TvPTc->h+xƽޓħ1vx+r;Wd_/V-T1 wBh!erM-ZXR)_M&Soi;m7Vq 3ozbB1@q QngBmul}9\isuMrVSl}Y u' HpBs(Sf~yKe"h}'SbswZG2Ov.u3X%@:rK=?`ƴn ,>VDs˲ 67/I>.t'Uj9L%O !ӽw7,dc+G=}aUqf~E%t^Rvo:c7 >G_ck,:g@JȻn@L1 l+'7oEH7Q!etDhb= p [ڪ&{_W>´\(D}oބA$]͞iizG`U|?k:&כ30d,EkkNU c5gZ^] m9/٨&S$!Rm]͉': dDleo}XB>|z{Wl|;u#\6 0:nztiC|J-@-|)(,` kqG=XF 64(n3 ,"֒7%hM3M57)Ivv/_%:i@E'z 0 Dg]Jml_;j+^8Ҍ'iOor0}xxZM&>V0ܽ\ױ/1nsp,{>6dyq=J=No|L) 9 2ʎ]8e=]9vcMe6,ApR]fhk64Ct3{gSw^lCJa7#psVYMJ2"^M-iD9h&Au` WƒpV9r ;r1t|0| K[|?>=|/}Ygdq3tKe*Dd|Gm0@vgOz%NYzz8 [L2FZf\ FuGao$LgRaVMHAK?m"<[Өq"2 DnK3}UPR/)-GA[&N)+u4dl$.M2O5fNS5,vY k9o⴯3C#a M;سG迉Ӗ$v9;8lϞ|zu@ى,L_eB/ϿAPM @R|M/, ʨaϿCC$AYj% nJg57?NӬ%oYX4%_l\Se2g{c3%~)[VM ֐?^dmqBb%oJ} ;RD@ iRb:Tv靶x(tu5[e[Xʜ7Z6fOaxok:\˚F !670fc /XHJ}@=OzT8,Q9=Koz5`>Ћk\|1j7|7?6kD @̝jzgY.[1jK5MdkxMNuh'q͇<bԙNmDclMuWBJa8X)&2guc1wd.]yN>)6[; ClZGIm:rjlg(7ԾL `߷ge[9p3;d/:Ilɿ7"燭?Y j6h9m@/2tpˎ:^џ)4rJ梡7l fi#uib`j~%e!4Erv)2!Ӳ@̴ȘU˂<^zLuK)G>=);Y+t%V ?a"jV0ly4[:s9ӽߍ j~<;ip]X#3Кܥ~nۇ01z5 'kTֿYP_4v˞}5^Q'3z6%1Q'P,٤6"tLKNmw􍵷=B-7\~GX# x7OMB +sdɳfen +ހaQ-)+ 7i0`kEݛ 3Tz |"OV'-!b5s.(2%= kOѫ̫$OooU}(IXZX6}ٟ={p)<Kɵc ir keS5 8}.!{ҫ<'ȿ w06dލ}ZLhn T h5h-,{nb!u1)O ߲tW/+$d uyD:UYn-OLT$>_v5*=bHvp/=/R,`H eܬ&,n:]8{"L4+9&n!AZ 'nV׎۽(1jæNOھ:5K-0T}ѵk/xQ2Z6eec4 \mI3B&!UFsHn#/ ,SqAW˾ g ]ZD&+ﯜ-vW§Q.y/%I$s+a\uL9ֶ+|}:w)b\ª?kKJ\ {NxNdg/PO 8jNi/ܴSSAӫ0GoDp@T -ÜW7$ikabAɣSz&rn*;2:|Cf;n$ՈylX^Y yH] -^&` IpȂW'>Bv6H52od*N5aEalg PLrW6B/z:#fj[uFe~R+*S\z s x۹:gt5QރJʢRV!Ƿ u$^hugrgVtGW`T` Աz]䌡}2uk5V!OCWž DžioreVO>+Cdr RrtTo~wI0Py܄ISj798>iHZ\3k_ j;9Q1ȆU7;(Zu2߿/o?-~u_w_|,~ۿ/?|H~?}k/7>_/:}{߿[Ϲ65)PNR_Xb v]÷7?IiAcd<#Segl^Y]ojR%X3q;݌XC::5UNOG26C/ׯ1 ߦ" WЄL>"'ҧMk Μh|24V KsrnDD^2b\nIF'?rؒ@L~ #H'&W2j&ɥ="AJYruoȢzx]}KBϑ&m9lь.+%*oAziCՂ>z"y| v }ͰP*:t߮Hx< JL!a=cfdztaݚ& &H~!Vx|/ ,>roWkք#ݎ_fd#[ʱMbw‚Hhড—$giXߖGgJf`|\pUraf6+ѹfoYs͝VC/uuG$MuRF Mvf;_90tҞ`Rh ǖ:xLARG[ P=myF%ƾ⿶$wyQT۠d }%wwahg_N5\M'n=U%\NN,r;zˢ^0 z4ڜbšwkΤ anT.tywupeRD݇A3-/ihI- 0]УʰvZ06=#ȴv%$JIʋtv^u^up֖/wkZ~ҷ8f'Gܘ5@{أze6fކĊCzn*6ƣӟr£Dfo€g[ M5NepEӝRZOQ$t8+ lL)=cm,5qVĂWB)EHr#qs}O8mݺh `^@PL`m2֗Q2k oپDzQs5o75ʃ7巟O5 -ub7{Nc)X㖲 cy%eĆ |Jy5&o+oeӦ6"]J%;C9xÖ͒hJeJ' Dpy%%+隉G(Adgf7 +Y5N}?O]$&>u_>]~ H.,oG_eR{{v37bmъM9KFg"*F[dvdyukj .ްpi31K ̮-gB~y}=jh5tR7B݅M*@+G./[QaQEjKrڍPd0V2V U{/AY4{Eֳ:,ijyFR @ͣ}O`_ޘLaaXZh A×a˲ ;*"D)^JL}=w!,S8!R8+Ι`%e ^HB˶($a|_V++XY![0bDz-bh l'Lغe<3Җ#ĭ^ɰ*T/n g.ڄZv"P>) ^ɗ~XNPgjU P6D;zd&o}P*6gdB=ez>cWP;IgЌ"wֲ[Y$,TQD;t /#]u!@p혗NW7ۓ}P:s:xrWYW,dLgT} oĦքWDM6S&zU0Pi' 46nւO7m?4&[x} l4 *¦0ONO_O~%<Z5!vS9W2]\~Byl~5PH9zEl a81ƀ I\~;il$ &ieS+JB1 XϬ8>=obfe+՟OXRO}t<>\{R*|6Z紬vD/D6K7GELc#ߚc#5r.wbP'Ω2h/օ"$vw>2]G=APaHER UƵw+J~!"gGn 'ԯWpUVT4%pv@ )IUHa>-&j?{ڪO9΃ oYWu@e@viYC`4|y V  .k\ +՞4:? d& yQhF%Z!>v~hqЖoGE6r6jk\ig#fRm]b X]j95>pg!R A^D1%jTbp|Z&bu],tԨ .Tà۫NU%55 \͕rH6H$Qo4۵2HP$طPV/ؑS3dxM"1bKj/P&W PkKG9Gb*$9rx/ vt$[~W3F Y؛'$ f)S {µspdDk4ϱ$&DӸɋzЮ׮={@+X᪢K4`rFmkɕz;wCmpEkgen*tԣ&Z7B-_䜇n%w uN> AحX?9귋@RmZ"IhbX-ufLJ`p3ɸ< [fā}yOYz/^r\/;ne,87P%z6*C{LZ ﳗ]" ;Q'A咎$gi w}{m =T-ūe`۟#s]C B.>ڳW,UHT{? ,8 cGtO[&4G߫}5MOzkQPfq%y}r봇៞zĊ[(kj@j7 l͎#VF8R剴B-wQ֓R0E(;"Þqrݙ|4+7T}Zئ "-ғ( f]!A㰨LJ/m^_~*׹֦+p5hX|=g*Xeͨ2jҾ$qrdl3I1{vi؉; (e0#FI9'O,H_a*"6 ;DE q.fny*J7mR&0Wd'7ٷ-bΨ] )}[S-fYaoYa%x#3׹,7FA6KT]먭OeE_z})o /vE7l[g;5( RXSŰk Ʀ^2k5 3}k3,,rRhMʍ/omkX‘Ÿ E,$2E!'_Z#NfbYh@&}ů5U9uN+ffcre*$;7~46?Vm,d_o DF8+98^lj!o.ՔNi^nx%5KZV Ņ;H9F c_gK#-aR7BKztUJW(ۡ*8vozq8 uQܘ!B"=BK?z%+m" bk!7MwT;SM_]8 ,mۉR9k)n^- 3&:73NX۴&txSB,2A03 4{zǩQmһWF]im`KԆk Z!z-%QWuJis)+6ìLh:t!]9v3Ï^qR=o&d㹐u'Wm5֤ڒC{XOb?P-e2 SZJtQIzZ Zj\&!侹Rq 5Ba]ˍmUVvqw2.VhU8CufiW*S ̡޸!`q1K967ڔ7:W.щټ>`nUs* \{vU`2JkLm B FfF)$ȹC.6#zvM);ƒ/F̑JI!)~箾75|3W8lѥ^SK3{{w/cur旋oS߾3Ɨn81 {6Bv# B* MX?c7LgWcGdGR"訯yWKe42˴8md2|* ,(J [RF?~r77b6br7T }O7 m6 9Xᨰҹ1qwCD_FF2=quY"X~z4U);JՖv4$BE޻i~|L tvP ƎNSm3f<}LHHyot w8>`'nfY7}fgWӻ/"kl.S'TWW;50cWmWݻĦɕr Ȇbگŵl/Ӌ3nM'`CEq鷷e.ܗTwpg\Wu6i>{ pQrEè$;=(U;[Fh>76#6PO[LOEܽzy "vaTA!m}^sޞ/~^ ,p?VvK>>""n N?^:[P׶Glm'ǻӧ^,KP S#ּ.#w~eAHA!w9jz;^FfKj6ȋsVD).p*bŸfk,6[X!Ӏ'Ƥ,t2>}R~yzп/Ï}_=7QU\2z 'kS_4n!wYw1_lQ VqsٵC g鶖̾wu:ea'#(73Z&q.O͙i柳xo H%R +ع7eQ̓&`eEўFA1q2l6al"E-ge51ddi3uhZT^j bqvm.B[qXPPZy=$sq{{QY7ݭA;8з,P3ڃT p ۺ*c:^b}x[tƳa=%quju%A4B5Ɗe]cqGty.IB]u뻩OrvwhЃ7f2l$rc~Jf3yp;v H/)WvPx[.t{W|ylg7"'Y),o|JgL@i璡85ġ "-ɩB3c&ӣOކ[]6 |Al8'K7:yCjRt Wg5iJb0-ĭGj*[Ӏ.J}ʶ"'>Bc!7Eē]V+I& +H(1=,3ة:*[L5dLn֋205w_ڇ?̦'iF8g]gls\ Һΰ";W"oF29Wk+#[gVvBƳፒKބJ (6vfkej 9.->X v~lTgJA{sa͞A$7Dq-1spFDmTʓ&,S)pd98IJbz0\2.{9o>Hz w gPm3mѪ,&33TYёaTBp0f\_Kr{TY`̸pudq휞xl;q-̧lT%Q %$k_9ȜG~6j S߱NT.v30Y%6SNÂ=+B޲4|(xސ RB%Qcbb' MF8ngBcK(Qz[$SНVshךLctwNr^av*ןnpU57ܫHΖ1>\YYdaOcnjjo%V_\_Ko=tl؄$u_|~o7*v3TJ#:1?K,66eNRKcc꒧ǮmKgj!LU ,SOSJzr1rه 0XdOpY "0Wv}W:IQ.,RauQ&H#'&5K@-(r7z;R2.DP0"IWjI9ɓׄNњ.,\N~̬o OcC r'е佐7p,*0q!CyB~o<؉k]kA2fO?"tSUUM_B'+uᄢN/GLOyM qx-$8C(4y8`fm ByMS:h`ct ,/wpY1ђ:ykveR>hvMAq6>_mYU4ƾ%*hzqqO# LR2f'kQJ;ܸ]X% {P6laLCчYdcC V# 2sh5!\:wN鷷?k% j#2 Z$;qа(VhüU(OK-i:rDL>Q TVkpf;~-XPOPh3L̋" y#Gד+xxlxI[$6 ?̚㉬ <ݨ0A=йB΍įqhYC㉣tspliqn,ߪ(@҇IڪUgY\[:Oʃ>4w^&,d/E;Yixܶ*hЎ[Cs}n;ݷvbo↍^:+⍳͊Urؑ@e1LblO:J ݆[g~B[5 %^ ]y3:b 攌q }lNZeݮOTpSJ!V* /Cf\D1fc1&k_f} .scX ^0XEyxBѾg MonEֻ|%:U)EPV\P1_J/>adEfx59d)ZHDBZgjܯ[N,K|i\}HZrQaLAR0B [p YD8|ZT}?}ň/8nnyȅm|w]fcJuew_V~ 7Ï'G/em]йا- w]8Q$=rXALRoKs`2i(㕜: ճfk/$pIl15 L,+,HC6;rɡ(OJ6FfIFr5t^Ch/]H]ɸj>Hd2*Pe"i(d6<}HB4LV'i߯ G$Mck.}aRT&,i7.F!a]Rum؆f )C=튨If;ejzg^LYدP+Rk Km0öo~MrnlZꞞn`'Ez'SԏY1t- oe4`ww@K߿@.3U g"Ͳ?CPjUԼ`Q57 Z]Q m1Ec0QHW/B3Y.Uee[0@菮sΓO ;br 2uf{av):EC&$bG_(2@RñP 8lvB.Jrl0fRj1)ϵ{VlŠDRh&ab<atM=lue.>D9;ʦ˸>vs%8L2*GT뾸7E_G/YB_:dcsBгt$cCK*Yެa) q󒕀N؞TUelu>;v1Žpޢ%׈ =ֹgm`>gƻ_%aGPuߍh4gMyEgFxt'TH GJjm'/UwzŞkzƞ;}-9Wl̝զO2zžiBNKBb^Qw@Z /4[%Siqjy ;Qe6BޤfO }Q99Q35NG\}RX>"y6 tArYDJ*Fz ׮gqS3]2D]5ֶN6f  &u6ke3aY آ` l~|Qvf9]ʋsE](G]W4p!Y6&^W}$9̀p] [N=۱x1[)rrxD !hd(ȎW@oh <Ō]/,}3e& y(Ҟb^pc{~$y(yӃx`PTό0R KMw3Cb9$EO g&|3.-LFy5(](fc? -&a'e[u(mS_,ېNs&HJb~Y8¥t#FVd%4߂)ˢhI pC?a꼘B,̓$0g2+֜|݊ͬEYK'?i`+[9|&@?P[]nY-^H26ło|xUE蠟 렴my+nM̮,SW yڮ["Fvƒ-@{ͭF_4rS~<4j燳8Ff @3LȈ\Pخl]*c:R~;Xy.) XNQ;t*؋[AϸF*+Y̛q.8㦝9#[~4I_*tbD'Iw2g 02Z!V˺}pXG4+aC$ӴaV Nm0e&r.t jl5l5!CㅽOyceޫ^ˬ9. oڏ5s/.tUJmi#ϖ鋰 m=s}=Q O`gsp8/W۽3u$|:elazӆT|Ld3g1I̻%Ro(3<73qR ~h%V9"WE7T93@gH/Vs!g8ڞ*IWd*H FN;dIpqWt!zTm'/Eoq64}[͹`2w^ YzMH%(I6WNq%UwQ!=N t#6\s){`桊Α,gIoP.|σ}gK+}n[ᤏCIBhR!Q T3L/#H,%":Ss+,'u!fuT(PY,"؜#%i̝kxIqP nL wK}zCQ3)bPb6BDX=lG٩׎)I}<`,eiu+d'0E%FWj|YxYuɼ-$.cFPeހy2>wkjtUXsJ5i4  9ka(+lxyYlk%s!t%A& JNU JDg:=Dɯqytfp:b 8Q`pUd[vO@%%Z$e lEÄ j7%S]i䶲 7iRtf"1"emi7ˁH-_7+uM[J-^f ujЏ+&-ݠ,c},Za綼ޝ6ߪevRq_,ET7nQx<",*\2'8pNւ' ΘZ]$?mBEj =mO>k{%yd,.gl,-p>j!3sdZ6|llh삩-d1t> "`QW+Yศ>ej;dA6Ƌ5OT_4`hXvF\l̙} _/گʧYwd.l&^5l1"Oi74)޵07)lfp8Cn ]|ȉ 9UduxUog,͔. n&jU\LEJcXsOyhT)9fE+M>smvI0iSj}{ݙF\Clsg,7~5/o]][ H+2t>MYSBHWe-g;!1{kJfuOx JPVaZ&f)*ti_8Tӥnrҭ:G}%)< T{]$w16s=\h)Rmל% *-G8K^'zΉ{V^{00orheY KC9'Pq|s E>]8kV%0!I"b+W[j?M;@sTogdDf#[>3hw*ˤ뵯!YX|yӱaszhlZmSl%K) )Ӓ41 l6zVX ;0Ee5 %ٙ`6@[GiO'zxhKA9%[9ړioʖ0LN*foФĺkTkyg6tHF:ؚqQJ LRszϚzSt>?ކvol26tE:mXD+с/"ii[l>_"n4tcm2EՅݚLUaZD؄B˨ Adfⷷʮ~x=e??ĭ9 o%}&j1+ue/HgTXpq5&p[T8M7YT dA*l 0lCg;ż|v!n=>bje0 L7tp\(b0`y6[o>mA' Inz3jĆ!F=vіcE PR&AGc%tּ 76;Ǥ3\%Kd0Nd&-:Q1YhL&MucIQ HrvVA-w+( xo?֋|=v7} kx]}1&_;e D%w2h+;c7\Ȁ.^mr;mGo^} jd`;9q^i/銷`%J kl[(b{!]Lmk@{ 0-d[]fyR,ѴN)Xl2P(]|M/bĦ^E^oz Bph9l{^Ҥ0ɲ{E3jWgɱcls ztu!ĩOX"@hQPQ5*)j(-~pCWn>\{xC k;r즢q[9R͵C)=v~Orjp 3wvzV>ՐQY{EF9[l8jPbd$^'y@|ݷ~, Chb_g15 W&&x< 40^Y74XqQ$#xp]5 AdImXoq/,e5Zm1|Uu Qq)y @XQz#yFT&0t z{Х R"@()y>fMcSu>M p: N,σc@l>w>mh=Q; ר^` .)i~M9&CFz:>w^i,WiHC mwx*mVF͕ٙSm44 uFUk:)'v)μ3Pf5!:Y?GeU&>fvr;ಡQxu̙8լ#*,j^SFQ)?:bG˰lOldK}:Ɔh/By5hˣg,|vac";TO'raŶ|[5p0>fnX˖?D=$^^]6txC)֠h@mQT#2<+;I='@JirvH2JmyU# "TTC2lASq!D92;Noy+zcqtU" ] O6ܣfӬGo53)yf xp#2N%e&[GK`WɹAC>fAv̨it Vhթ ioks\[^nL; F&$A*\MZ)LdSC#>D'b{ 9ux!`6@Ul?\88opp[21_Ȏt),N]D3&xaW*ߗ1 -.N0TIuz_ \؀yI ENҸlj"Lh-eJd^JseAbL#rɡ25yu܊[G`^ z8/ի2*b~%O۹=Oe~׹@BIq"6h=D Z܀!Ӈ@xM,,J- .*O-ƕ BQkQN8M.^14ž? 9 Q6llMGuVXy>J\1DGP#0ɦ53j4]ðtn3њ".Qy̧D-5)X_O*nm L[UNNAC[ޙ:$ͤ,_AEm9YYA;I2aOF\!:}O_l`?+RhSi`ՅD>F惸g#n"R{Ey5!S.R͛_ʃPDe\M#dsY52{P2@@\9 I]5s\a0)Z7cw~``8f̼ԉnp:JFޔo UAdQʾL;;2Aփ(#Ziɬ"Q+@vE֛d9 t:uO{\fAhL5l݌~&\g"94,#(445wed*`&nQ|s~VH}'\1k%̓ӛ.בցivZV'8kv 7$t)%M Ț!t{qG9Պvkiwbf?ʆǟn[>E$.5HzZTt>@9*ѰlYJ̢Ll X6d>Olx;fJ&edPPci-{8ϕq2.U AA u%T&m{Y{HF;<\cB@4wp#FFhv㷉 ^^Obqa^6pC-H[Nܐ{ z"_c5ҍg LK6ѡ^*+a4GCNEBol/QS^ 6'giĚq -"ڋ2tqŹ⅛Q, ;P|j6׊Wd@-_a&c]qz5 Zsi=H"#_19QqnħsM2YBmНᗠhx݋ch7'e[)+ף=Ed:T H;gݗ#tgzίI& [ ~Q:qSA{͚A=mb"C{JL+Drwv ɚۂvMiȝ RYĂG_UGT2ӐyϺQ9JD3J )s:s@gBfݵFj/LJOe$HOiwf՟} whŽ "԰w 5hI>|@iMԗ%ioNg62\PrsZ"X"݁ %4}:0c6SB3ź\0mT`~#Lf^ƑqO3e6bYGBQO ǼO0btH09wlK`vG!4՞8+{WSsj9bu毷O+ţ zⓦґK jArb`n'2#c¹> oZnos_>115Q0‚n" O??lyAZP@ιϛ|LeBxm+8cpdL%!2yWBj{xK(c;ҡP h z@`~~\t•y ,CRXwfȔԴ ^<%k {sԀ=")An) LGP+VG."㦵Cc&xʪZDܘ ^|J;2uL?BlRAR ƲWR2bd-rkmmaL`h=睥]:X_@dXU h,l%<ڠ54f(QTqzGw!.IS.Y7SC'7 ZwJTZiΎ*Ewԁ?#e|ŻqT=s,t |V 5R-Y|Pt '<̗>>E5OZ ڒn+G˼XONcNVɀ[߅7iڌ":f.na^ގ͜u}>gfmYTzV܂;2a ,PP\uN GBM`ů 1n.0/gy9*0_NS/kH5}1iWת3B1eޭXu \inY\O۲ǻ?=~,OU:0$ivbeP1gעnՄ8nkc눃G(t赞Ȉ'3T>@PUlBܓ3 ImohzmL-8y66k39n;yQ H VA$.ό‰9\G1Mxwy;h|/m犭i[)>#`nIH*\m8UVAE#–Wy[c#۞!ZOihצ})b@fQ$\rؠBh&/,@2,v =]ǰѵ3kT{C/]ʅ qE[Pw}?);ff=[$ amCZ4<Q[1ҙJrװ@z!Ҥ ZEQ2a1[ZEmy==ͣT{HS8kv?#.3"(bN2lfEedHCGDI6ԔB}?B ux;SG #D3\Ν0G𝩪y ζ|#*I b ݋ =/'CV$^e!$wՀS2.KK4UT6A,KI4͛iKK{%:J ĬɱLZ%= ȮR:Լpkq9Uˉ{uRݾW2IP\6= کV̗qf rɚx y6,"CMܖPdU&dR f4蟺$ߨm:X%tX&[hEK=l1!>IDlk=.7褟FƨedM2GljMЗ]Ƈֿpq *Ij3F Ękptf٭ #IzղF Ҡ䮭!bf@DL#Oﯲ6f/ }@PآN;dƆL~ z.tP='C7/`,Yٺ6&`7 [֌1vӊgvaSGLQ[DyEgzUk#'nf Ei"IV%i&;:}]O?Sqlqis^Uе?~v7a"jaZ4{g`MuF)Hwî dAŎf+m>\m{?EqP9VP:ؔ|b{E22ay~(jRϾ{K%'u3KmC;~2T>F.|=<օdZkFvbvad>0P^9f"F{fqYen&#KŧE ddX JQ!qhlK*xi '`x:PLSvl;rP9Ϛ5}ȰZg8_knaXj@5GJWKİJxIkaK:oьkD`Mm;ƼLyˆ*P-4&jsZl`{&}UN!'LT'h]2pFR@~BTnϭ јz10J#k-VQ!s{Bj-d}<ZLuɏ؛أR>7<6geOIu&Trb=o bg"mHVр-#RK,,۳oK{^k]c/ׇ_~ſO; ^{ %vdδ cSSd" 3hž͊J) tekM8?9Ii&GpƢfJ+OllHzHc鿐嵽 đD 66{Y*|s?b 5dM}Y ;5FkqٿM^ Cz& 癝u)6b9Pe#`lvҫoFК~p:\:>/p0eļ#ܺa60G*݈󯃰8)SxF^fjv%j7't@`myΡP*}rͅyt<U>ER3W^Odx*漢d@?`2zdû^ӱNXMrA?]^@tJ000[pvK)r㗧͉r~Tз)WU,O ׈?{#U8-̗4GU9˟7.06&?P@U ;1Fͳ$ i ŇCGt1lQpnQ4Lbgu-37gv--R>b&lܓy .[EDXE[cbLXUtNuک/8=с̺.Y+T>&r q%(nvy'LlBQ~Y΁W\h5sO!/H9B/6KP@=Xe?w_oo?~! 2gS*.DCU PLXȒbll_`Mb4=А :5X% 2kc`2Z,REeCV6}߽ޒKWCC)YI2\`mEU8y1(m}*ä^>?cI M~Z?c,A9*my'd;Mg yx,zjyuY=/tFrR.dFAn= .OcjTYJYZ" lw6t g |׀wESjf !HUi[VjS9;sc$}?($[ňፖ-@҃@v4go'n"֫\8&5xd݆As,dD>39^=c9tX\z1\^|ERQ~!̛)cJ%E;{dSPR+BA^LJ`dQYd5NVX2s%;V?`gZE?׼j+ QB;m^Z[茶kjsnIwaADNJhXRCEwp;Y mW'eXQד/ri]%Lnj6wYfm׺T:&<[=E6%>;c5=#6JJKP@ȃ%\~w?GI.#YP5YJNT%Xv?2/1Uo8ȴ#UMU`m3m}ޑVYM6ejA&}! Ԉ˰Ƨ3ft"*L*%3Bi\A5BŁzp.HGS:°ΘI1sxwv0o"_sM{nBUȻQ_zkoح6,9cevi[ͦ45v!̏Jg%kv%NGZH\.%TTщw 擰37(t͜5Vm !SE= B-i{PdJJr&/Fu\[\64 o,VNmQA# )`C(=b\_lp2`7֖GC<.7v4іED.}_vE!p6|CX=}<%F=zbb%4+Hw2^&[n04C^zMab?ʓ(P{r Fc9 )uV6n 4X\( Y`ɻ3ynȸDAYsg)J#h|\t`盬d[6c]?;eW}g3IDp^+%O\g@5B cKV3Nkeֹ s֜McѶe3!g.YgRo;5 [i$ ZJ8ѭ^Xmob [sdX3^s=ml|m\;$ɺ"S'K/I^qH 6d :;O!Tvsh[C^[`[[Wl2t٣aG KʣCع\Ad-ajR[q"/2CyW8'{IjSB^ڹ,IńYi}b`T`J8ܪ~竦l&|!ϕ?fͰ~T#ڑv :5̲>Ah0*2cd~F{t:{}X+3}2Iڍ9B$p(&,2hK;vEuf<\ 7]?uAb1!cc o%=)g3сs͞lLI,!(tx/M,p1 0 _I$2=uo`kR.<0 2{ICM\󬥃u7\s ^ a|&JxN㬑WGs5k/brs@>su^UtfoQ /3/Q.YmIg=G36(cC}9¸m^/+TgPy5%7E, U,B6,`_iJ6ga챕op{+9Ik9f,DvkQ rc /3 "0Zk"jA Fl#cCPb$.1aR\8\9\YcK gjZX)_H쳙Pm- 5>;myV[cnҫ^#VGiNkzIHVS+U@q[G9 G.UuPp.}M|0F _q'0}x,n?-~ݖyk,-+3Zf zJ5Κ^gz as˰>L Yo5|9[Nl+c^zICp棓qw_yI̙Dվa"#1L?r߱WQ +ì c`3ʾZTY4hD=+Fc3[@MI[]l<(T7;qxeDGMZ3(^ѥC"sT(B\+@O S{gi9o,U̅!v',[Ћ{լͣ1*p5+K1~G\`C@},=mF .n~K~}K/ΝPZj7D1?}{᱗nJP)i,9KQ}򽡃l|+VC ѩ%rP+ U:rb@*!5U9jL [ya*ƒ6 Lb[uD4!nY݄ܺRQC 9!1gk 9%]0U7"ÆFlefJ+0Bڮ!["87PIi ,y=k&-E!'^G>_:? #\Yd,:Sd녖:ˣH"gK2kN3;2[id*HV\=a׀ 5`pF;bvC1YO;(U?-d5A[Nnd\YZ";F# 5x"jgg [I2&eLK`U&F܃\Z&nQ_7Mҙdw/(P!wP$Q\ l%qFW4ݾck ty yz0>>δW/-OyMῃw42 c?j\A͂-te>SĖkw)SJ2J2%7ÔNZ3k9w[9:2c0#(cq_rI"`G\иB>ڍ:$K8?Œ?K'9^v3uy01E|*cʻ]l44tn՝hA^ m4A_grO@]Dpfrc.!s'I:DR^cKqhPeǤ+yRz4]ϞXo Xl..`7XӾV֏zHTuG) dcSum}zG@ ΍搑,I>`!p66l7~#u5[t~+ A[[,MVݫޜ%>6<69c՝SK 0A/8۳xbY_ x9SX= (Ö8BM_Կ2hxl[СK9_ 3g1lj7v-mV}KљR`ZNv⑹wBnJpFQHP&y/7}%pΗ2-T?jLJ? 1Isvd H͑CY<Ŵ5l7[)j6fa JC*bN];5}bV7]GZ+^j-OՂ:_t-N7ov@);eFtMX+Aʃ;f5sI '.SZ^; @r{yQfFY~Sg(%=8c/`Ya\^`c.:Xn+C^^45tV24,Z:zyJ(ӖH`+t'kjL [+B4ndWۙsb0ˠqݾ^Z|&;$Y<+.'LuPSiQJTAj9%;員>ʷ]/V !3vx]2p$~{``~ ;9 vvu=[K* IZð$&? R'XU(3W$S>`kBp~rdBlb8{>bpQ!?j w ѫ)y{ ψg*o3y  ]{$$Kʹ>[ {lz!dn&#068L$fZxg 1e6sQ|y8+̒BNٜh2U@WAMyB_ -7+J|ߒy溵fbF.Hs$!ʜ4q/ɕ_Xsii_+?&r6 ,_xP$B[DsgNazG1nUr/ww~x|W[}M$0 7z n rAM/ |PM}Ӝs{ 3s(pF/_Ϣ/pCGAs4ߖw7uS(6HbL[IQep4y Μ`V,|Ǧ )OAڡ%n:=?y@>ElCxz<0un"|%Qt) /+xt)܍ٷV*zEhz#v:yL4!ǝ΃xYPԈrdJf)nN篶_םna; O nQk U/!2*$сGL ̦UPTNP$4T -،4laӶ ;"a*p5[7ќE.!!oO;{fqS~=GϟN>~e?޹1x e }&Kɪ0l1:S`9_G;.Xe,QŌ&s #7+7(Œ-*{msȆA5~@& (-ti_^Bs %}+@aLf.WPCr\ޞ-1܎\}Q-;~1n2x'aʹٶ©D Cew~Oi1˕̺`1FYz[ڏ]B)u=vv6ϙWig$)=km^0 7]uꮜIpU$X<`֞!%Hfg 6XP&ZV " $U Nu,>xe:KaɪAtԡe#MsUGN(/ ^4AKSU? ǒ+dn,KOn (A"~ g6$l2`kl%H&xw{_K~?}*76Ʀ[)`5v][KER q"xVPF_j {)fw@["_"t]xSTgۉg4  |x<%YVL6yG1H}A2d5X,Ի;I;p ( `eW`5wc=M7#}Dwxê6Nj 1|Æ ]&ψs&W[N5*^eM#a\yW}cpI`f|u?~ '|.j$Ewil4w/(TZ'D]QA'њ9T5hg Y+>#Qy"u!dc,;|Ν3UW8-YWJ3Zf <kUK!ec~zZLJS}ÏyE1NV?_Uy|Zӹna|ŹyAL1aaP|ymciu!7VO"Z?olt"f;:6K bF ProvY^= 6#@ٙE3wHÄHG- 459 @5-1֮p6޿⇲k?5v(`6HLwQ2\] \zjTC_E\͌|%ڂ/rHn_./En˼y4pi ȸJf=[9WRdH;ls2ɪC'iyn<5*ߒh d[ ltn贶WΑm]r0%'pJt*}#&vΎN>_.ʠl ҬCq ƌ%(l\U<&J1^Y5iqK[a&e!fIg 򐣕m_Ad5X[S2hL#{xfmx,,\bh-5g3,4 UNGDe**fm>x/)F`f1F^=d':C*b'Qꨝ6B3 iX%:)GU'G%}`acQ)qAxMK<`" y!d$]i%Mmu?Ugi8 e?|n?|pgufHvpO7$ w-)CW^ ZsS.N,h+Yj1y~2=bw=`kG]kJa;bw*RMXfMfݜkq'^u4tEu(`}NҮ;'0,}R-}M}:cv _^\ CO7sXwaLn<~TڹtâAm1VVCz(y0#D3( ڋɯ33dEln YUp*58!%~|s2h碱:]^ǕF{y"}m!,j pǧasO$n"Nߊ YfU- cK 6?ul o0.iaOd~'9rz)=ڪF~!=K-HDŽ¸r] lFPqJ a¼NlX_|LGQqxx. !+V(.a}z->15DC+LzSHȔ!krP5^./?^zGU7l ze] [L> Q+~F)QZ: h;`+t{ -AA Uq:wpb_Pl vlo4TMjz}AhcpٵY Ri$q}ɻ nڈKӽDla|8xJvO̷B #_sS{e~F\5?ˉ<Ȓ_>:8_ܜj-ܡES۰|5O?vf|)-{ϲV=8V$= XPyxrߨRdrƀ6u|+̛zPɏt7;ΣSbRIoy5@ ’!6!d=\۟n'I#b|9-:-?1|P3 'pSqшuE,4hQ 237ǴƇؖ>CgIZ]ӓqX}2r捌n~vsBFXE. \ǎYZT95NC]96bwxR|cHPjOThSʋ4xQ"ŷ-7+_|C!\_1y/aٕB)Ph޼JgX ydN5\jA]dz_ 'CW/5 c#a6Tf9JGOl |2si0gjLWz~EY ʀ$sػ'ˤoh#ډs@ -]>ciqj9^EvF'u/&{8Pƒ'I兇*? 7 d冦~>4 hAN,ʋ5HgMA r\^~HsNKBY 8jT,{N4UTϲe <V(!(T/2 w2|l.ΤNY>q{KzRN;-Тє*zGl9*Ѳ>ge=1y*p 0F-:Ă QW$kz4;o5767.·xU(hAϲsD=}?Zn4za%ZK(s6JzPrj4D]V_ink'> M "T^̿vu܌%WY6&d8A.@N&| mrR k"Q5Tz6]Vs9izpWA%n~n5K9L/e4k.2:TK6!I*Q@H]z4jdl 5v 8|ԴD`<1VE1}?w_}zrrߢX}epgu궫O5< V*koً^_ypbJwp2N=5d 4E4j mr&Uh`N,&-X*3u~J5걍c\Orc,:î(k hyf|8~>W?l/B@&r"P>(oxW–yhx+)?wa-_"^kAAe~`fE C v~<|-e'5ς? 4VEŒ-nkY;O;+}^q(Ǽmϟi{U6AӏTQ1j4`s0+B | UނyӞ J*9W;^b~D2C 2'8! aعh4FFjOքGQ *4 ):ZɚzuL~NXlG1s:|7>]lm|S 蝧gªFz-b.=zP%eA e^,-$c])p ibdg‘i|z5-rbiLɢnʓK}Rfދ!v5־:t;'(Дɹ{/m}=ca˨ K'wliϐ^l rcN./ݘfYZJqA80Gplw]xa3F)oĽ"5Hvp9.%Jŝ,H&M3ʈa}3Em .yK:y_kޠGK]}4eŇqBz~9ϸIDUs›B[u5BCC) Rㄟw:G, R| -huajH;`"hYCs*o*#&{WXW svT3 Ӯ"i]/-/ BbUͭL ҍ;3v_p.r]U6 i(n~Fm%kMwAA SW:6V,A<ԯdm>7VV fo>Mc9E1t"VĐOSbTs(;^ A^A̱i8?!\0Bc>%#2LKbTLtR SW­ʯ#ȄM\pKҮc#Ϝ'u~wyücn`ձJYNRq-9{Sv, xMgy)5hGp{ @]z&xTg(zj>*7^`5eJ̎crv7؆k(afv:fl&&盘 'J5kHdѽǷG m(Lc+ M)M'5LrVw"n)dnj'eIÛ'}0\)-/*KɞNUC3R_`{뗩Œil;9)-YDlgN]YNt T { @x5: 6|Sh#c_AQΝ,u5='}1N?իedE|YΫ9 $L4H! :>Gµc!E]jOÄp_sujNoYNҫuV{GCOir(u3'8%Ǘ(*ɆN6ə&;=Jߨ}߳=\ogSbWW-KuZ+)Õ3ձ`XǙȤ dYQ<Fg-#S HM&{QOKNt o9Eb-baǢX 6OD#ڼ' K9YM2r[>_9ID0f'ljڱjy9*ֻfۏWBZGɱ n.[ Fn {BM6gxlY@nގm<@|g[2ߞ,Pwo=߳ jl±d]:0jFcp3Ԟ+ا^C+vv>n8Q'\`GwzS2t Vx -O1*_UPjpK}|T}Zd_/>-XHl{*?bŪ:QsdZ3EDjxInѽT-.)AN :'T~N  ,AU3vM@)-WU}Ϸ/)2+s,%2H Hid d$bȖsRrlJl=jE7҃y?"MKx;̂B#r$Ҥur{8\[q-[K{jBNQW# 8O`C{*rS?Sw;!Wy,De h@唬pJB==;RQ6w'oQ3w&  Q횪"(* J谞 (hѠo@,pC+&66KTXcGaCNmc 0 8n]9Ñc'n hVڛxt[wQ/"I=%h՞ fͶU#=oHM',؉JtogEj )cyɦ&*4kͻ7̟b󬬴=nԛ2Zf$ dlX 3jixL2鞶4vEQUq%E`ki:PZ8 w)x(-{/, !C[ SoNjWd@a"ҊILf:KLNg#08ܶO .jN2QJRme:>oN8vGauճk^yh56NbOL;O;`{]TRW.aWxwpQ մ+F43vkui$!$GmRx>+D9]c*g bksyS ZRt j{9'j LdhYIؽ:~'hZ(qݳje )@4cƹrsCE:<GerupnzޛΙBh^xf Tۨ&!;Ýs'Ӛ~ n& mhJ1>>9)tE= qOn@ʕݽ";[-F6d=1H[alr/cGp/K܈u(RgJ\-+SW8,;.\bec6@5WW'ˣJňʴxme@.a(2*#RHiVO;Y1V`yV| Z#\\gtIc8 * +Uo`VSz%!H*HUk*NkSJ~3W *ꁢ&R: 4*C+W`I-dqBbix 0]a}0NMoz|ʦQSs%@;>+( #J["j'yؽN5#\ Tò;HM)l +V0D?srڱnP  !+::wYpi ;IS{ƑSʇN[y9}MR%RTKO`y[%||XѻuwW*OQxJЧ߫:ΔGI\B j1f+2 ʹ%zǑzA z-Fp3NIS.UCfWǒQ?zo-+[T} ]ڄ:we fcdwO·f+7fVW'j yJ뒈EU0)W6R\debyLkͿy!lLJgf]{_{v"+BNu[±UᜯUG*RZGQ6Hf~!JOe[m!Yg!l me%7Gr&ƶAQ%A-"As|鏚*8zSr31Pǜ 䛟 ӢWK+bM'Wzhi/"~;c@?oE_/f؟L0#~ 'Àf$pzJbN*G} __5XE~q"5?><~~OMu6!S 5zP/$AJtߏG8G6*)(0\[_%Ľ?dѧ^8nң:^ǎ؇pÀLo~(+$\((=M P8RRv,)H0poۏ _`b %xL4U-bJ\(o 34 ?Բd̷-"xqcQ`)Ug]%`g/\,MzXtlL*$fHY(1 )B˵MZreژxPǷ`.xg7[EE&x51pdKЎf۶'; 9!,Vui9XSN5SD㺞0^#./jy,xz%8pH F3/auacx5WlΨ]cvT$g*2/&A1!@!4Êw&]OjgHD M#dk<KCJ A@*,mZ2Sii~TU:ñ̈  a&Qmew0x~HH ]fњڡY,1m8 g]M#E%]cGz\7C_سDZAU,;i)4^EL;&9XeraB=? ~":$qJ2/]Oͼ_ԝ7-6hx_Tscd [$ '[nHFAQh֤15̎{e 7B/IAw^*ٲanbA޴)'=rǎLsӉņRmsâ"1[^0+lbA,І`ڲ@P3Xmؤ@) 4K=*D8pSa,͞]<$8EsTQ%y*،ڀ](SSo2_T:(2SɶRaQan#t3de5[25+[_bTsoإCWڃnBE}4Y #NZdpD{ln*+Վx*5w6a?[UrLtŸf-kJQ SJf-㚥jR\'MrCx, 2_4go_s?;L{Ⱥ4(mb1J7:3G [ -d-{M# /qQiF Ā cUgJ=n v!0!)9iC&~\lO1a#*,INuo"}n E X7 nڋzE ~jxfeav~TnI^}ˤV"7) 2n[dPӂ󢰟ߥ(B@)}Vmڿ,Ja6ܩ#z U Go/+V O:$ Uz]?i* zG' ]my2JfWCOey7Q(Dh%0~+@le*_MR&D XA|yURD ?Bn yg ݸp'dh-\YԠl(88}%@h4 , ֡`[_Y't Rd{QxDQ1bJ?(XkUxܣk,D(b/# Ěէx4SE 98rfȊV?:]|l-la,/t#KDTt\[.@}4oTn @5Vd_a-:~9bRe+pGώ ` 1D}VnɈâ gk\M[0c1{sR`mwZFEt|›Vن0yҭ(E>8)Ya*8ČP66o6JUz ʘp [MZs +'(NkjLrTLs`)46H #Irj|L*`V%/D>Ac0͎͹rF08 \:o FwG k@7#En%e>+ɉRfOq*XE,CKɀ85jbd^-?2] }5X6*"j?LX .G Wb_F m bqt \j}*YD2t ">Eմ8k U< 'rgue#9ENqFx }{P`qS`a"e^N]kVm@TZ^ BC%.6%!Scbu`Nw8ld'7XCY! @PCfdBy6OBV e?M{}Kh'*q =!qG M |Uy؍ir1ByG,o$b} ݱSז8GD:W/yiE˖E#uxA"iB- R^S$C %%'p^4j'?S;'4<&W4DlC };Zg:(•vhaGs 6cX!^ʹ)Hyh)\OK jmkhJ۾Ƭ騦` "'b؂s/o8ƪzٍW;o°;%o!V@prD$e&r"PI@sny*J]߈-$ڙ^ӽe`[A]lՀgjg~wT'f S9?.6-e;& ڊ ՝f`FN.h4٤pH0Iұ<_s aeňe\uX|0fFȇR*yZEmr2v\>zPcBgRw [#b%>m:wi`D7|uEQNL/ ¸c๖FiPLٍ96Y[ E!J`} ՠcuӜhL3,Om/oId[)rgzzs)#0P36QtH'} :?V@,8Dnv?`:zA{49Zho4K]a1}I$W*Hf¹o޾F+:NΞ"\RE]Fh%ؐjgjujCo7: :9/c )rbTFƮ^ B` fO.Z9t"I TzFV+'kRczn *)jJ m;’Η?96}Xd.ӕ(VpsIRo4M\c"76%+n@Q3ӊx?>~}2P/?Y7'0 G;nB)W Yר'K4jb7^Pe1 f2)Ly02vMKǩ1T::Id0QAhg=RzLǑW[5'{%/o;<[&.@O6TRE}cc$Z' g4o^>U T%.%_TqH9>LTﶸ&rOM q FJzϥ XNϾקZ$? 6vP`2Kiy(zZ*z;)K_?}Ww?_}1B,#! <4~}6&9pEmd6u(OV1v~㡹7co.$EP>: }A0U]%w.j䗈l$L$_ixGmc8v(O2]{o"ɎӳNLB+wsDE+/46HG(@s"(EBT `#I:!nE̜gM+JDk&E& +e`_NdjFX/tFeqx/%Uu˄a|gjL,v5"0񁦁kLfvPTkxiOA֋B= TCpZU0g졒1l1hMe+t!q7I"NC:J2;SW!R0? A >pQg6Pxj$Ȫ5 ^u8(ǔ'*;b@+3Aշ͏ՐaBٚ߃ τ ƧC>"k)dhи0=@ѮsTLd} 8M ;v9>lF?fl;)ײZ/C>m`:DY9&1v SaP6gdņrv+ Sr+vR,ki:0u&T={ɥ21w\new[4pnd!lǽ+g SY)w Q=`P^~q0HJK㜎N``Gh)I/i=9s#eؐL@i ˌ!< 7*S3al̔E}aR:dJ)~k'״oI^o^n|U*WZ`HG 1.҈ϤZ~H[qRxIj&厡3i'F_;G7k*"uK;Xݞv%L22'inL-$SlBKER|a+s+OPi祥 E J O +u6>0mғq_s~dU@Hgo◅x,roů~=vMUz{ߟU2SoM$ǵ(W`ٴmzFEEB"峼gqfWwZ##3qiJ:f,ixFFx/_̚e*fҨ7PrlP3cW93ڭfjlcF f@VБk3;H|t*9LFO]S8rCnUǎ`g%蘒W. 0F>9p']heWUcKz>@:kviI=2#fESG Ǹqq@l8{KN`)7EDYY#}{G[hl)|}M=vH&A!H:LLnSVp,[-Luia#׵N~zT5JAB#WQ{Xhre\23\C%n?V=P֩#5WV$ۡl-X)1kdLڔ_y'&u)5_Ɵ,`&BB5Zn2 x1)`^UzzAAMVѧ+]CdOvr`W[GW(DhlNjԘMNSݼ|t|P<=/o%YmHÝd{Gv}#}!/ǰm /_0l7|˯b A)HhF֋ 7"# +B{Q>u=HʺKVyE0zLHUl<^ j<ܯ=x-~R3 !b̀D#꯷ՙNJ4 Ny>mׄwO01>kFraUC;+톤Zm*f!̻UKN ֽ]OnP*=p7$ =L" Y8E$}5 ࣛ:@vG]R%-=! #(7VV팺z-D`.jm1O6Kj '#8Z[.P@}j+~$lvcL4I<x3aۡ*Q8\^.|T .awoCվs[Sr*ӱU_*]jfL70.{yb$J!+ 棜 K/3*jBг#I=G13'[cc$C*6[n6g=QoQm;ל\r¢uL}Ĭn`Ś;!fmeWW*c1W^R`'yCC1=(~(>?=~~^BםZݲl<dɽp O4I2h.fw߯޴wp&S>BW>tn-!T\Y5=)n쟿?=&XzKKIՁoDjxoԯwNŃ|A))d'8-0BcrVjs3HŘcOH8T.*)%nP^jof;T4c@\B,œ1>Y$]x(ć/OOWw^7% e|zcO~WYEdJu"nwԹT1֌YeZPw*3IQ_h$;KϷ]]7d9D0Cs\?˖7PxR ۀN 0B?4U󗗧O_ .F /Mt}M~`r^~ׄB0gN\glpRؔOZkΦr[[oW΅*РpF3اRfamˠXs>?NCXM?i̗ƲsSݵM[}dCƒƚ݇C\75{"n]ý ~<55+zP*UoNeUG2HUޣojGr; qX6/?=?qCS<ѡ/>a'A! EB {emafdKzKOsk8_mmsڣZpTS?>#zc6_Uؗ0F' `LzKzt/qjځ%o+~NR6{r?y s4V6*il?>7_ǧO5jׯWG%=_<#I(UCqrW C^ա_JR҃UD|T]a@9UGYv50@(G [VI ɕ-Wl˲B3 EzzGBTO0]8%[hWAL+_\6m7ɀ6(7r+(,ù?|aC̼/x#OzbFi4{Η@b\1$Vۃסap-)|R6n=c -]T(g k*R˧ MgF6n|+<)fCkܨ)Jt] WPn֒lN,|LN3Z3idṡiϊ{^J`a=diyK7}q HVRdpWsdNخZp a zu*WT]A1;R^,R5D-; 5ŕU+ B$ 0Vg1S\zqsK* l /G?P:<5;jl)~f W;g["__7sirr_*K@>Ԣ>^}'e}RUҍ~1oP? +3@. |0ʓRTek seulx34{,M?.K^?97W }JW}zxs[s[:I)䵆Zi v/#H6υ\A"a$BC4Wg@ mr_:Mۅ˸m(n/DIٔ\:m>%0oIotY?25ykg'B.ljҐP-k|g[߈#KwyoZ|||_RnݱC+J!z[EfhՂ TyR$*:bZ"|`CA郴 wBg"b#M?gQ^Md%=ІEx2A_${t'0Di_ c1dLK &ޖو`'FPnR*͙.ʫ63kx'$wZ\ˆU Ub%>}7|֘"&#$M# Ri([`3GIp❀ t[n-j\yԪIو6ҕV@"KeYD/ߏ~=~;'Z4{? P6}ĚotWP?T; H[ EۦF/ؾQ|.yf/ (-5TKK3: ZG9E8}KLl(i0;+^JCˤfE}|w f%)ńNf04]FiI:[dAZA+POӒ O CUr7 t!8f f]TfX| Û1:Wܼx*qz6$H )L cZGQй9L c,q h&ۥjRmoӧSV3rH(e Sn]@Uf%. ܰEw2ӭ ]r_02 a{6\XSի; @*D|65aAXNa__?ӈ$0[ mA8KYY&?r!$|zJ ­1&GW:^PDz/ox f7A؆(E5ZNEpe3} 4ï@ A.Hs+oYjZ2 M_^:`P"1eơ*Ҁd P^?O~31.)QdPdCSkLPGHS?d2^C.yoX}Z0K,&g4X| Tɫq=͏j{+D{1/?,%Զr6r%OJ NtY^X_-f]fgan]jCоKL9ՐOKjƳЄPW ,*Q,Щ$ \cgY0l.]ifЫ˵y8PuzrПwi眨 RWm|ݽdP||84 JM0. : ,tjξϗ\%ͦÆt6UDR(f}AxsZ/7y|:şw0ܡDq+~k4X:pD`|k0FZ)c$*uE{6j6͕J[ ԋn}oD8qk#\TOQH{792E[U_Ԯ2qL͟}blWؚ)̶&# mGBtț($`za TS7wz(A;cI9\/yx6뇂uؽp |=) ekX: #,S8 rzKEk&[5+LM(J[vLGz*p) ?kYnfX_.H4sWQ뮴NIޚ%P#}wlɺb_ߗʹp\wDCr`Vto1K|@sU|܄wŇͲnf#诔]8H aP=Os7_lW޷6vh։&75kB hPGhm;KϽ#.B)nkeRƽsP:bF?킭Q+W4§v3==LfeUv#La1.FN=/:X=:`uhs/T7- o+hףPiy0*ZG(Sy50c9ON^=fFE$T^xgu qIj/ LveA88W$(*TW,-~E6*8f뻶(f=۟t4_-01f֬דI|yP7ga5.aWQ[b[&wG&) ) /tz;\0:)6]\1uNĩ.mct)%'Axݨ\O~v㮱Et^۪' r<5EVn/ |?X3,I2`WOyTo?aX ..915L~}7=|Ỉ'W3˰U*սΓIY֫V ;?+Lt ru:` kpVMmՅPq<5z.=ap Ԓ"E6>73UMG4/M~r{x 0lg6Ҩ>]P/:% {5Zx70[u*?4JP1#+"vm:@R|.gx3`"ﬞbgXw,aVL8ل 2qb+q!{?3n9p\mV 5t Gx?>}~|>-ӰoATx P{uiqmE,ϐ/Lj21i`>qW~|x,P, ׉lPb( bQ?Q;iV1KIf(^f'OmGY2 >D5` Q7 ާ\6aR;JC蠄{ދu|U c>1>q聨q{tsdJ|lX hsw.ED&dhH5xN]d~ƶ6woC% ͆s4I15" FD9|R*@>o/lWA6cq~TېzNj,)S3̿(38Ӽ*٦K`^1X;] } @C6wހ|P"ӲPHήli&T Was&!@* \NhٖSKF8yBhzGSn6.. ]4ul_i~CjRu`bp~X׶_Obv K9ETVA$\7걵$zGI.쉡b/PcWp8p?BXq8dmnP/["0eOvfo4PAg<.l[`ޡ/pT3Y\q Gml}[˜P]8{L$urZnjhzZɡcYXFNZLF5nPICTatZ֎mP7LqZIuKx O4VMJp%)ŘkxĜ_Ϗm~|=Uˏ2:^#/. mi_a 1fIO /Q%q@yJTIL`!\tS16? 5;c`ʼn`]Vh/e+nC_J(u툋N?:rs92+>KhGV^'؅*QqpY5V\i7SL’N?Od*_= 8n3&f6:Xt$gޱ6Q[q7ұRXRf|=!PiFǔG򵦂{$/ϖp*Pџc9= q 2qEq*ʢwD&ĺ}s :D\w[,zloʄtww^4{88Ur{`+A̽-\1n!ZVIu=KIsNRCfHTP(~"w/Ʌ=+f0˽)ITn!QҶ)T{6u[ຩ}: (r`@+5P"gC_{gU9zctr<<~:sspwSGp߮ImqAֹe ˁPr'8>6/ `1 ou^1Pyj!*0o"pnayF0s㗧z^?|CF.x#K.:V &d;d hY(+KLXR솥y0&r pk$ t A*)+Y 3854٫ǯa?"x `<(Xa)_?-d*#t*`ܫ6z|^LѬv<_N~g_PI=e3t~f|fHp\*$ۘ$"S8z n\`4^:'ZAG0 .՘<+ hobl$05&.WC[ o nJ̛Z._d 4<;MG)]Dy=+"jF#(6ly|(<^L 6;V uE.Hgd_-b.t^x7j9wZ~-gL\\+]b ~iaaB_i鰀(Q~P Ij0ι,Hhvy$_afGn#-%CH%IMi@2Ѓs/gQIuԩudNa%*H;Ը &룑&)-s1gX e6ByuFU2{`A$u} zR 3>vVD) N|7?N%85e];GAth(S g10ͯ5o )m$Jjw~I&Mcʝ7_Hݭ|};SłF%`T 4#3W_a(KCo;ld.ͯ+_ؔi]x#|[,slLFd*/w\@9xH I&T2yI Lt1߹ #׭6+vo'޾IPRI%ӶB}XU MŠCx?0=rmQ*+Pi3(]+o"-'-k$"0hIeᑪQS^rqrJ^0Z\\Q~67͗!Oc{yv4x\2SkV!II5;i/BdQJ6p#%^\0G L7-@Q=u/ dVͰ\&7& SK.i`9o?߶vݠFa؂xU]Tc OOy+hą#ֽatF pHZ3"[yߙVG I`ؑ:IYZqp@T).hŋd~?#8.M\eT*SN/Hi* d_ZQ=||>[T߭'PiT O#Eh:lOH6҆(俞\H0Xq*B Re mu;n+1z=mH7⡙~)j졏PUqU*vVMXm[NF`߿`mm^?bܺGKxnbzY}9 ~O/54"M}*>f1ւ%_kxKAmutvP/< жaN:Ʀ˞_s"|dp .P^Is41lJ}ixkhAo PdAKφcߌ5e!iaL0;c)h\ qϊlƠWT&ky"Q+ B* q^q.ꈤ M$r5lxFq&8>Uc;Mϼ Eʻ"n@)ՑRBέ継($S^77/ }e!}y e(e*vd! ]Doehvwg`^ШĐ;w-^>/7z8?}߾k.3蝨q-,t@ Gד Cs*?wi(e`jIW9a/BuSõYrxCE]ucn bLC}Idޣ$vj_{JRh-3|w/вjqE{Nʊ=(JEf'\':^ rs( ^tŁ ۺ:R](S`6!]]3FdQLOIZ ;u,#O.aR2.WeEomxI5>>ҝNG1A/ϹҐdbgHhѰa*.C `J3 @IYh3@"/𝒷 IQVR,O , u8ԃ.ϣiK%F$cYzEg6޶PN$z93-[!!Ϟ] vl  )z9si/Fџħާ_l_{hW /sprRJqxh cЊF ڵ&b0yz|^~4yvRDV{Nx0\Ij-\CCřǛYRFLa ]Ocb"RIQo`K}KRxGAc'/I(@Xl,^q BH -6N[x<^m`Vy 7nme6^W#q]ड .^țt,C$_E[^4cćIR nw[[ @EXc߁ޠ by"{'Anl'{^GMᖂWKY"kX~Гp6I ccE`E2qЇJʄ HToH' eRA|=6^]b+lѶ.Z~P.t _kK{P=tOaWW[z yANRmbTK`}2c;G,T?fҟ';:O7}nm)0(H.sT!=Ÿ$ĂeݴofSTv$Sh `@ ̍=yTw||vo_cg%jְ^y ,a8qQKp}  ]"?1@{+#G`Rޑh{ T堚0xݲW!twR3pv$UpٹoLqar&6,:Ɇ o:Lw3qL0 u!wk՘ 'z9)t5}<, rbCK)>T$!k@қ,+a6;51f `5 QVCI"PzmV ;T҃0 FM}{@s -#Ȗ~20ƴŠ]ȳlCVS|&/×0/V.|tvN~K\=~(^j4|8_,_|-&m8˾1J@Ϡ̾ s'XgZWFML=1cf]pQ&ðrӢ?B9AC" 8y˺GiΉB;=Pd}&4\} !*)Lc!JyGSB'V.$txUG,(dXvQej%ӏS\; P  eR怿çyXY"=K]O؃PTD*_d d.B2oxdZeⳭTI(-&h uQd5ݤK* p4z=;ݩ]:XۀRZ3j >ǍdiJcg}K(FZI%>$D'9M8庥M8߫z%$}1*!\-{VڋzOOLp0a߳ӉX`Y>eCG`!)咦[ +O;_lv@`ix\AzL=VU>rDV?-NXdH˞>|ؼ>mXn;ZUsvQ,*Dh@w(O.+o{VǗb( -̓:<'3d ѧ]0T!2>e\zX7Y$f5lЛ%H`OMf/UK7UZ~MҎzK$f̲3$6`d v%@h nrfBd–:tmE*fnT\H UkKGd%Q!ƙ X{[/glbI&I`/XK.2N>!R9P–P]>y"]R>Tg: uNi(Lh* \1v pDJ#Ma2 Hg!!PKYUw Z:2 S^ibgDGP՜0`>F PQڧ{a[| kjR$P̱ѶljȯDž\J:I!vR'Lk'35g)1TX*Q+v&TEkFf\);[{ yGOOk2Ȟ,jbj)XA!D4PO[i1vQOEGV FK{jMZqŴ %RMⲤdy|x6 C~:]lUvhA>P&oШft6ly]!$c sqBl Ss;4w.>g#b:b{ Ӗ}m? Wx]:7+pJʻh+K_ RWΛ_ɒ(`c+Ƌ!zXG;A piJ\5y.\ ss&{7'A iV2&W9(Jl00`tDFlCdc Ec :*؀kmg nf?sFv֫5Ԋ5ĦRR79X ٕnQ`y*CbNz,[F&&.4(1e6@.ױTwx-\{*_4J?/rd)"_6U;J!R<*[f<ͷ%:CT)LԘnP1r3>h2^cВ}^a1里J_]&:hF+./iH^Vp9Kˣ &0cل533QyCxNJ$h%,׭L"%#naKa}1:(kgH HC~aP ٭XLQyC-+2} g'Dpfg}l6NIÔ_LF/{1je3Z֫!S!ݞ$1Ox̭b {\c<9i>zl9֌z__MFPӲ^h6մK2ٽ9 }zLLa`CȔЮ=_5ف䆋ԃsm䡎Ni9_ݢW;Y<0v]9}*gpn!rjϣa wF"-JNin彅h[]4HJ+HTCCeQB3gγ03rjnȑtQڙa~(tR龜#gԴ|g..uMTX-DWRg=1+htfQ]1ݒ4P0}vؽ[+]6U\aXDCj) Thse.16Vb8LM1PU8)X8>4[<,K{vyf>)Lу.e XBAUebxd-,vgfOIGoSKVjc~1\x|qi|z# #l/Q@R|kc4O+>|?SV?'۟Wl҄0K<OܡJ 1zH(}/DVo<19Qeғz34B¼F1t!rs9֬m0HBm.^Ĕt0ة7ɫ*F s>5,)o{f^{]+ EfgT@"r b)>Ti_hŕ*= wûW;2T?YTǢq&˰JQ0$=\ {qtpc_"$ׄOv::2ћو'.k_n !밻/ y[faؽcсS'9[ݶl}=7oQ5ul:ki]${p><}b'Z'אkLϩ{%`}O}N}s}U6 .~zϒCT(=x_eNBEf6bC6OR+[u}z|TSJ̘q0EIܱxTă \/6k H S돚oZ5̭e~ IIlfi9]"#KnlRU8{zI186~ ˡȫ+TGEG ȥ9;vj[J} 8ɆZLkdSs9}9&U\hjkߗM| TYҪ9NgxX:޷+@u[rH 3|м|7owȠ]/A]I-tEhQcAqpK9 %PʁH@*Uvˁ%EéS c RnXe=XpA^!ADbشRTE-C~-/ƾO?Tӛ?~W|isܧ[fSf9xj8`#Z?z'ջQ< tP>b)dIATR2raŨyȌD! ID%-XIE>IG5Uz"<5IYl6 \pH4F^\KU4_QawG_ؑ:zP\⋧Q&֊uhRtVА,;4 zFbL"gbzDP,FTz9Zj짊ԛu[:بùu%:şP[gWު4Lz'G pRU|..?yKu=L͝[=ʥ)rv&TrEs#s© .b*C^ w[(/. ^H,P&6N565']%; I(pԘXKzIonLZSu⊷[KV9]5z'Xdn'mstnx+'nk3l6Uۘ:@B'fgIL`\O^iƱq\w)USh-pf-0hu6BCky!A)V!R+I Ӧ7Fkꎜ_W;5"-61z70%N~yXYpXn.26|7Vް`2z.Pڀ<9/|ԫŔXz ݮT|ָXW!lOg_5{ `OY =h۩z]fsyVol N˦fTSZpX G9m__{^UܲpACȂ(z^hM-jǬ*qKDk%𼀤*<%u,57&|.& )Uk8-s!t_P>m:;%As5rT%yD}-wr݉1dvڈ1,_I0m6&Jr?,(<`aSBshҏ]n7&u =gGpg`uUVb~PK:YcN@jći,) W!UY4Fu#4oxC*ӆ Gb8is 9>G͑OpszoUcKVץb4B!]fQ0Z7[-3,6݈cӛo RǏo^˿vUznɣh[ %͂pqړD4ZO\0g 52D뾅7vUW\868(=Ww2 h]31>|ncx4 caU6]0%Na]vs;Nm//iVW3K^4^aa@•XY:i]S  jj=(k0S4ņZ^_I[cAؒ]/$g1NbhH::dyVr;V:4jYZ;h ~mb kJ{$b("A^3{j)+,s+KpPgoy>0~JxUR"-L1Ӽe;olw-<6-EPbwhN ^%19М( XLXci6s3t=7pܚ /I*Wpa) D\"[lU3=.Qg6NJ´,PڊܦÚ'@oSS?3eכrcSAVրU@ɈL{E"SQ\($Ax=|uKTY)l[0,ûN_dgH D',$gMCz+汐se^Kޱ4Vӄ5;=?ےVj=*'s)| 2C'ǿt[br9n+'Cvɖ DQC%`Ikp؀ѣ!#4E\ЌěUSGr57>+B|K+oKC#ϙI9vGyV:kPi wŤ.0_JkQ,.vKf1[l|yY5OX>~~|~{C4=ԛvyt΋|PCHɍG]4 Vz>:ن^A(Ql1IjͰǃ}{zX6S2^j,7|X?+_diіTiCϟd1YVA)vo"ncF{|YMj}]O:pҀttE*Lˤ׸2S2,s+Ҵ2:Xr9D0>.eDQaeü郦6|\Xߥ^3vV:{9!@ r-u >l`X>(:lӋƞ<ܫ6F3jmhԒ +o=0R5 _ 6F2"nLOAQȀId "[U>U>( W.vF jOן>(|/$lJc#w'mK2 J.R1?뙂L٭f}ѩ:tc*ϊz{`o?l gfk}~K{J͖z7֮OYV-|*Gy<LU{/*JKQE2F%nF+qX{k(hgD‡\8#0IF+X/!A6YXݭK35[ּҮX0$$nFyk8Y Qe6=9>e//<[{jZxn)`pUNB%GEÊПot8 O9 0W?>~.V*?<~]i,,ϗGmo_mɻd !+`C)ivX u, e˾"ӑS/#zWE翘.hCSi6DwYT:oL$ihg$p]~"{ئ gfRhRhdgO:Cߤ b ubɏfRQb{N!uxj%;J'4sjKs!i>* aW%׼#]gNa~WeZ1myz5 is/^5{C@_4ȑi`#Mc`6(EY'CAߍ@ V`P=0v \.4ybwkOΚDbM"PGnvԜ!y#x{yj; L]=STBz^i2M?W8MaD[dgēT` T:1D)~-8 no1Q6aC̓[b`Wz&]^e#ݩ{۬PcΒ& OgLVo=4aHK^!gC"BQ:ރw7#ΆM4gC_qm^0{#Mj(Ώڻ޲g ӷĨaQm1(】ޡL\\X$]b@qJyS'v"DiwtRoL)}U-fr}D"C3?FO-0Is3b<5Ý_Y?LߢCsAj1Ouqi!:(ڋi'f)az΋{) <~8ئF$7ל2WފKcM BENP-A<8#ILi3y@+4Ylޒ^npAК˒ RoY)TZx r2Ya47zחcCsM,a#V"=fZP8i\h󵶶@A#,ˑQ?ߒ.*š*kgrmMPpCGFFkNdqH6т HU`(4l,uk):rS:%cWEW{bHoۨe yݬe.Nנやgm::QqDY#jjBh`F'@3w "BYe6nȜA詵sccsl]Փonͧ"Nm}SlQ!=?-hg^d IW̙_&ԝ׿o}Rk ˊH_^>Vj{ӳoVfL 巯[ ,םgATmъ=W@f!j/4yeQT~r3ԽV $Cͨ 9vQ#*#ݧM&5Lf:kP8 0%_SWt,i5=l%<0_[ӳl% h*@RVh|l9s{ IT62үJLӬΙ'wEslRVC^٣=?6OWS|&/×Xx|ׅݻ>z/VV<տX?O|kcuͧ/߹~XmBFل,hExiVci88ŞN2#%IV@6M]'4j,KEy&H Lhj~c?O'P~WSq-QL"6۶O&]3&5$;bI*)9*Qkjd0f:mqJ$jSxZ߸tVMO<ϫk XGלCАpi>4|43"Wٜik1(ѧH!D+GO NYua@f܋tѩz5]-uTv)3m sT1j~Z(U^^sstpefjgX*}U::*[տ7, XE@Rxy546wavy^3 X -]rvҎIzʲplU3%3r6;?7wn[Z+X;]I~C5iYdP]o$nI]Wn} vfoImo >8YêL3[nq؋Tw' {P4RAzEVP`H0bHE1H)zq}˫TgгKCzw .|0)\ Tݫ!\%V(F9RmOs0 Q- ! JԻr9;{ۛ3}a5>)@mP{!|!_=9vŷ^2Ofmi-2A=炥7GܲosdpA  T""wd :k7kvzwAbu?> +|(P2{X&F;;db]O{P@#A _A}`Kjl9xa97ך UDPtޞ Tsjc" f-C]9YS꿙cLԑֈ=0#GAzJj; 'tG}֏>FAU㎃H$в8Z@acyT]^U%T׏O?##5A-Nnrm솴1JT(>}> ._Z:'AYnTt۠Tv/8Oa[5 2D5vᠧkmCWZQZ(ʷ|Gk7 NQkX*S+ú >Pt5lJpi1}{&;{/06qĠKv1D ?x{) u mJՉy~"cտ~0E>aJH !LlcGڐܼY *{Hl ך]~R^k4-oo r/ ~Ctzru, ǹN9gv*{(^`MG*6aZ ?7um; ItMrC'&ﱵCd 0/np<2Us\Y#`-Q@(>35؏U>R0( њ)DϏ{D-0O9<ߜqLr M'BrNEPl ƒR.7{j:,(ʴ6 n,.=BzǡN,$uqfK]h[/OUܽer\ӓ4&V vCh>(S"FE?'j_5lorZ/oWķ#OΔ" &55fSU;UؔCVi֏9= @G=ő(V@ c#xO4wDDONo"q riD 2D&ֈbhI lN㟡=QX%ǥ[ٟvrI3I?ǂjMWtYDD:~æWvD O\X9 'l".561a~nN = q:sKH[<v4XgJXM9"_n]5#A9!Wc%v\+"i /2ous)MoF47DZ^i8='&GW vNySvy6W 1*VO +Hm vӧad7")SEbuhNٲuoX٣4 |Z{ô{_ޢԄ f'V:[b-(3C\[YE;ª-'/^so߂5~t~wJ[gC9IMcZHW\BB>9l7nbMxp7(PiFP-= ѦA$ǫ}LQ~Wn6k\}NG@*t64{ezcW}iԾ KU&`G;"iXzN {랃fʎU,DzE#ѺS:Jeu6o"RS$k< xCm>p|Uk{S1[jdN+Z<2YA]F1~ u`r޽|dHCQzE6T0KF(K6ihe,{"0{U2 )D*XI m mhY=TT%" ӱA< B,YIUH0Iԩn{nr35 J4'HD{fr3tΜ6+fN^hI;W.^SK;ߠ+M*q*Ń"OXn\ 9#j%(W*zD>;BM=ud724Fh(aޣI3q?R4ԡU-*[IܞQ)q7y"]|;?ZɎ@&Ós-ŧ5RHvmNA@@HYq'#f hْ y͆q ߃8]4ю+w%:8=t\voHy%KG<铇/YߴHPt!ml^A(4ǷXS[]{2Y \0$؇DC)*+D{!~YtzsD[Y}(V~xo/?U?R|zn>^yS8%& +M05 (:o6(7u琟iI>vZ3W2 w@Q̎!vVVHiMSzCHXώ2ʆV0)+8S5浿j3-$.`FJFd6?F6_U5w~~M?<~X;;⣱:ެO={=Hi@x" |8lxܖ +vl`M* Κ:rՋ]s9TL?ͽͶ[ҒR3~c~h/V(>hddZXٱ/{W=Z@jAVQ9A yf[qd lw)6^˫N8`[VS J2Otqhʌ kzY- e(#ۿ?X}I=~(e]D?$sL \ Z eSr`i -Ť~~eȝ]Իa)+'쉸)1(f8 tw.J˚Hhq8AD,j 1ZM } BJL1 *$9 0v]YhFc5lP ޒtQd$WʨSFjZ/ٲqjض)Ɗ$W \QΥ{|岳eZ.hIJ'~I%fyZ)^r|'ZY+IhЄ涚t>n_yzt N cc5fyKg; PFoOꚑK7!kXEޅw A[keF_=k9G.5ANBKKEc57Β㬒^>{&bѷulkBҖC#bh %N2Njv3Ƕ@insژچW=K{H5f@RxÎ_ Uu+ Fqp)L we2zC'-"-kNhE1c-h`^"WgjCAVZ FSgk.BA]c! 9;CmMHtAl>0y6.YGY&kxw^ӷpB|x#.ˆ*LJĿyԗw|o^~j^Cˊ7!A]6NFYV>U`]ߒLSj:a캝0THcAC1XY"3\~HiumS&ç^#te/3m0Ѥdp I4r̆Mkn- ;)j9?i n]ߠLm Q"CJYxE9]u[;؏GATQϱ/07S)Wxȏφ|h_H  npLe ZMyE%S%u6N҇GB2E8 f8A+2IyQ~}^͇j&T8kBv' |W$0"U Xo=:,/fkps-ڧ7ϖsdi E4j u\ғ kry8t.,lg_uvzu}co)^y FaH=;K7";me+IouPf ܶ"P0{)\uTջCc;H.}2LZ*kItȺL4qR W dkbԾϏc 8]Unv T i鈋w7GV/`VCK۬:?W>2lchBv;P9ራ øO'jUAeoMhw vJZˆ抂 <5TFĴ&'wZ;3~JTs2ENÞV *EF0繽%^WbU㳬@E"}6WX[Y+[-!I!JDfTsm ]_4xo`oDJ7ѽ\&XMт)[#~)@Q qw!²Ԁ,8'ѱO85`n3"hPoPk7cݴPpqkMj!DC[aj+1h\Dl{ nVC](tN(4E]7qΙ bw!tfRzۆz5 `_!XYBlrxV장}wVv1w "XoVJt':MlH 9~(TNip9.~dH|a9 |/ޅVG.mMEυ=irXlFU iLUzÄkhۨS5>YbP4X$µ3ͺ޸OJJdZRu($ՋiIzޅFEV '(XBpֻVӋy`}R_C?y:1Ծo!Ć)71z–Z P ]Bj5??saotJ:;i`*>)|s5Δ/Xk>JP].;AlJwbBU.=f.9 p>(!r`4N,@_3Yd*@yU$)M B(rZ=1W[]{xZo{kڠSe՜ݞWơh<0ު/ś_x_E%+M!ZϙCQgIHQLL0bo(U[kKeQ8 'He׿alEqh<6עuO{hMNFHkب L6v![6ǻ6d5O1?25pyz/i^ U6:ܙ4lA"+ r [ T@rL*GPn㊌Y$[Fi>9ߣ^ fI~m Ym"{h/CƬ GRI8f=.ԴiĦ^upOred{*q8Юyֻ`CmbZ9{&:;wWmgԆ)*, r#~pJ&[)SYt~(5ƑUwnoӨmx,%r,cfOky `߼F׶DefmKoZ[gjylAe"Y&5"HޖMAg<5 9hM͕iK|wN߸w/y $~y3HFRL-r ([=6#zwuh + ڸTr-od;1g<*yuCH}4.4*}h[|XS|/]|xiE:JC 7s0E[:wۋ|Lk^:Z _$ZX}M.`ux|-LVarCw-)O#CkeD*U\ c)̮Ld2'M;ոRh0#BUKkϼSYDRr`R^2V[g^~JURR:1JP(ګ~ϻk+֪;O eČaS{5[уԻtPn6vwyR%!\bŽh]4 { kKR:^x'N |UPCC0+r jZ0&HW'܀[$_p58p.ߜm);+9W@2wwO4pctq`G ՙj8&`Ťvޢe< ,i*.S *tY3ŠsJ{{!lґW꾽V"B$`&486;2 XwQ3vOO&N7!MT|A*86xY"*-B8:žغ#5B4W QZAڱiXb,e%b( QbmI^J$nB^#u N ,-2{]oUAc? rXf"Qlw~XPX4SuW '*6{֨ޟ%ŵZn7Qp#/I1by1f̨!mbҋg%'pc@q?l㺛υ {༧\^9,LӂW*.G}iy`F*`>㤶|0ԓp;-.ٻy꺹W2 ˍ$gP*[$ !w1r62{^u1/04g:Ic=zfX #6yyj*s\*C>@oTG*b|h 3ZF֡Cp&sp:49VWeafe[_PN5 ,?Req;K'øVNSPD&DI&Yh݇"w<`Vo!D4 fFj( XDѻK6(\/?r@yӵ|{ȎS\IR=*LjNCV%>{0,m[5 FLw%td=X-z/dr/PB xϹ@ıO(clZu-&d+>I<<ܬ[oC>kP3uz| 6|-TFaL3f(w^brw,$LdH6S/ HC5s;e~`!D`gI}riEo bϴYٌrJ72$лaDv`wG7ASS@虂-3YSviIm;(8B0 ,ԙB x8*(uRS>䄊3Y63ڍL] HrԠQ s9h&QEĵ#Nnr mk- +/ӝX%hh40{UmĮ|27cSAܓNv}y. LngMTBűBqHs6ٖ2QKOd}x͕IX715yY|RHjQ AvN;6/*|i1V:k^\(e٫QrA}Y3U;kǠn L9r9[w;ELOGZ-|U7x󁛜(o淸 y`L}f 链&o&KqmNWs@"Z_NZE0m<ͳt}_߶s[4՞7OL:Ip&m]m5]QSYdt^I%3 9㻥; ia1C"j:j%޽J"Bx_ͧǨ=KzPһe<$ґ] |R7J' ]WQ6W8GDKv];&qg!&Ğ 6JOUdbw!pCkkda.58ssd5E_?>?U`~y4?c?6/T͇'kk}ROF!>oGeUwlmhvMPy~;}LCAɦz"c<З7tl'I4瞗u[{/omŽIXF<`|鶸J+$4{ݢ./ĸULB NKhWcNn/ZZ@![hBjWzL2z4^{1,*r|Gunljjf錓ag8HZ ԕ_mBm G,?E|[NuFNVJEBr % A=ҷМs4~p?>8 Ȕ}P+I$jۖB)){#)*txͰ̲JN+@ì2xN)'G{hؗD0Fg8{> 75E/( Lj?*:bҏ;6`MS{iM+$>dCbh_dmcŬ$UT'CPͫI`\Np}^Syy,{+ޣ }!5nQ$M]9iP<j8{~lR=Qi!CD}c@ hgyT֐7|j4ϗ!(mP/ y>_O=:1-pv`ǡZiPLƀҊ=SSW'k -n*M (|{zϰd,]0Uݓ bQEáe}i\a7 Z)QSSŇ,JGk(+8%&B$g??8[zVpd0c9WD[]GjaSҿ9G+p*5y귑~`qFr p{ 9୎|өAR YKKS7S%غuDb}ʱ/{>{T!+cW;-pJי3|L¨yEjcnoiZP}6ІOÔzNnN =|Hن|&vxJDؠ.m*V ]:u;Nc[G[ur8Ua4H}ЄCYUɪǎ6{qk0Gn(Y-[8w tފBɦ"jKJYEPqZ4&JqdtHuyD1# 1~,hlՉCZHڡK4N?JԝlF94Wht !:Q{<4Nl+W\K-! p5C|;QG/}^'0vK]{)F^6!7Lc[.qʡ ,zɗ1ȯ|P^gЏAiv3*0~{$[ilr/I@,S@ .h|}*aV6ɼ&o~Gl"s`^0 tmg)r 0ovGËcwi2#Ҡ;Oٯ34* O!(0_//VoB 58ߎWֱ 4de8MB4QӍ|+sk68-4JF")iv뺞ڸʬ#.\= ;3E`pk?], !i;pҵ&zIq@Ȏ,Z)~YIU_|Sh2b(_~T[p%*TR$;DS>iTy^[5;l^x,W8mc\iFbIopy{T[ á‰Ѓctqّ xr 2s+`79"9)RӘlYMUoQCO?]&Lm!*s 48( =50JhCwh>Il9I ̀󭐲 &* :Y9&F55Ber9޽H#ʈ& 2+5ԮqQApNB=3Xgׁ g X` '&u$;`w*}h Rn'lt`)Fu#eWɨ=aTjF 6Bdh)ylkD%(rDWphZI##*m([Q_Hnn ќHe+2 ӷ5 ]_D`>Q3{oKz|#*YvLmptdho٬"nu*%gV&.mZ2*COW)ӅQRfD1 Id;1#NR9̈́]ҷ_Ff[?j(dòu:ٹJr#& :,bhe*&^=T][Ry(ٷBpbH;fdO8K>á*;&XYJi*{dLTMEjIPwD/ҐsZ}I&l^,nB7#C[%&Tqt!9(aQlTL{BԽ ?VŇ1/YBӴ([~*8]Zm*x`*UGdE }w:\A B+dT(:hVRP ag xuEl%u8 m:7K~\4OϟV||i>K{ޭWwmWO.'B([}D*N\2(uۻTb<ի_a.YYo^~h^=DB:p[cGS$7Wb $銓g4:nPj\ rGO UNFJ{/QJ\nus՜rH d-h^ED=[ych8G1)o硟c9P"zNb<<Ѐɭ*\  1sS4T = +:aLe^o-!):N8"$1]5`Y˺OĔf8dp#<v>lI %y#;QqN*(W4M;EǨyV5|$)k#3}$/EB<4[G˥ nBUnr,(Ԭs`UY[AjPw( z{QIü*[0CöB.D!1ddpOi6{Ղow9aϾMt)Ok;`n'#[T*4Ta]t DpL~Фcvyl m.ϗ/_/Uߜ/?|(Vj8ݵ;z@rvFq7M< wU9X'[|MkbITZ80^`'NkFVN ArRxW.jvF݉%ewVJ m}ח-42rg7M]{LA%Q+)B!;Jq~ Xg7ɥp52RwсӇ#*eSV2+Pj~kgScr5txvpGf)wOj2h/E2g@Vi:%a(׬أVT C`g^3 o!!apl3V Kl ZٓC˅t= h"p.G;.(?fgq7y.d`nYVQ>JiڸEvfd~؛*!;Fk:ԝ_;4Ք.X(aK?S| @dPx  //]tm^:MBɡ9YmiEj"p]M*r{b ?R@[j]}r/DLd:*8 -I[(9 i>:elr˴|7 *}EQI-^DWC&xzU,]0vbq0a=T8u ?A`Y? `/"+44Zҷ0Ō%Szrd6UIɽCT B.5s,ܪҮPn8^g7p8-oj;pN{xn`!W:i>7/ =5;GP1g|V[4F\W&-1+xdhr޹U6n"tObV׌;+Ǧ**mHğ#\Z>%Wv`Pb09h\13|l<=-2L4v76aⓆGy 84`}W\ u6&l웧FDѨa Sde*qy. f{A ^A`C(x@MN&\C |Ʈ6r1FuWl8`P%ls@W=b1O2ֶQ4mKZsA ~;]6ͺunA+'W|ϮZI&(VAv+ٚG6=V۠SiINh lwuJ$X\}P~^7pX\5tQPo1Đ:bA)vP;EJOwqYGgsx|*^OX܄_~S]|R=?OX?_{buzj/_W?bPT߯~\=~(^Nͧ/XˣQt/dp.#HM5[?0%f(D#(TK،շl0m]5I  H z Hەj~e'&=a4(4Q Qȵޢ~x%yx3/{%M I&2-4z=x!30-\t3c0kJOʂNT+n>Rem oM0b45- [X4= =*.w5*Faum^]n<| K[Ի<=z/縷yZ=0! TDyn7VTd -3`t(ىeFA_ʴ8 >t5׉(Cl0癭Gb^7!~vmfmrۃqwLWcv#|ヺhdlgmBsN G" \9OAAܐOֽ V&OMq,|4lF}PCl Im\=DL(9iZK);Y)"iKzF_>>~~)_m ^LÑ6@VH5#C( U"$[kCl^%\(=5cS1԰_s`4=5%M[;,S{0pkN]Y~^CTM`>dц3L=H괧d+)̬wo$y+9#g֝KI lvl>T?tҐi s5X"YN&t9̜\j [c'{-R]1l@tg&uPwS5: W߆Wf>߅-6of|T&;9 ]@7*y}~#J"ĸO9h%UTFfCsZ#vU'Vp*,ku"!uj!$ [rϮ|8&2dŢ0%ݦH +tUۄY ^zY\ 7 dSk2 ؊>12ux9=f>-I= @qsWY"b ^% a瘢s &.|>6\3}UnB{ρyR '\LaFv-n'r "AOݑ `nV9 y݊*r(V5B(b/, /Ϣ HSDƒhP J`ALwk΃Àrr$ga"w9Hg1l n&4*r}o^|7w_ Ԉr;ձg%\͹hRؓFRrG.|yC?XF39WUڱG. i7c/H$7-lpESGq~Uf_*?i9&e /f{|Ȝۆ<oJڢ#Zq( Kwgh؀a(Z +A%$Pl1MkټF „/2WʓK] ^BV/cvɬޒYȲ_ 6J !|y~:N<9F:Wiػpicdj~y¼˦R: RP`GhELvNP vm5>5X1mÝc5ul%~8 |Კ[ΜHt)&)$'68Dzo0%$=YP'b] kG ֛wx=q,^XF*X1/u"5$rR̕Wb$rU4XlU{Rbw =A&4LK#_/tB1of+Gc(`Ū$%ǧ)h"h3#,=[~BoWEQ32 K?<2a ;IL5GDk_MGl<Էknx8VJ 'Iѐ$MخGLh+rfv1W eP։ %Z$b>)n&ba rCw_!~ѯC.}RS l|uoed{O.pB`D-P8BKo&#fט/0MM4A4JGr2gtyrRfe*TMY{ O-,C"&leǦSRG^Bi+Teq$@D+IR*g>Y櫂uMW )*R8Q@5œz3p\[V`O2#G-UD Nwě"f=?P8EQeB{n?.LZVߝgt5B>\~W%af&$u\?qYt-EWmwɬ`̣kf- `' ZxY/2j9;Dc#8~4sJݹӣZJnn1kJzU﴾C@';zAS>+t!*66<%n_l>|x_ng=Rsr)hդS%%\l!bR\HD_/AEr{CyJKa*;6ف8՜:JJXǖTj t!$G!GIYuqVqJ/ [tDЎk\5d8oꝹqO"{ S:g xϼRЏ2g H?nwH!1AiPcA*r@mOI>+k<@ކu ]D؋l1ip_Rph$jRoƁ&f .itv..%zK&9^E2Bam; R|D׋xʭ6R.͓¬D!ޚpY W^|^j򞑽[h'6n^651(攻^MN@Sq텒 `#Z,b֖nyxKd?N׉ؼ`;K>1$:]$bJ$ryyꛬ\`K+$j`*%*S8\T>.9H+k[ HFFcyȋt%܀{7m(uBX'>[ m$w^;g9d gQ N.ݯoߪݒ U!n~o+{T%:*]mɼhdݷ_$G~VVuAHfxTyrm>Iwtjg+(\_p"]r-\OƞQz׫+_7s|5CXYQf__~??Cr__^K<֙{5Ƃ2]NX=P+s6Z(ƃ?ҟʽS*sHIANH Dihk E&!b.a~+ؖ?O4#PJ:WN/6u6gWA(gXM&|H=V6;޵{.KqA"p#ɜC vW4"lLK>hZknNf?52+J[H^*9g1{N]aƩT$% V3 [ط ){Itf> aR;+Q7pm)&r졖a؍l- h >wI(A/"jC^ /!~G,ǵ8[Qon~o?~X<}/h9-V~&14KV޿ZJ-OY1+xKftEzILT}Z,N T;wܱF6X=9̑ q,{5UaUkLOU>Xˋ0|&>kg ?% g ET ]m,#ӧO$$tkMH3}H֢9O<4JzGepeIt/r_ i]Jm6ޞmjѓ, EDKgĢL!hGM5<^IRؤyz4cԪa -ށ?6_Kѕd( ˧ 5FV%e05.zHjO6#JɊ"cW#G L})!A3l,jbM{VpZ֜>xG\eڮ,ԉ*/- lrAK2`uzƮ9F5e tr?t O 'qz &=}ޮN75Rw*J!h-=Bն {>'_KKOzK7߾!4!ӚJD>u[ה:x0. o~[^43-leP@CHA`Ś#Pm5a'5vqIC@[=㸇jnζC~}-bR &Gles]h|gH{N~n:iw'CA=够J^;lpMÕp!]15Uahl(Cwg~2FR7qPjfF}R/rG@OsKqU tQ-{ơa׌tYjhYDy],Y{3mZi%rL+M 4af2vqY0!@[+3CeR3}%^@mǩU^@}hMc? vJ~my5~ Ey[4(" ΰ(O=SC_CP3 Aaɂ1WUL`\tN߽ϩ7F UYM¡&*Y2n#ЎexvNߠm')ۮDl(yb>IFDmh5}Oc)7yЂA@xc>20\*!ИLB^RV@[pi@ȯk77`c(sKuT ?KBqp%9o Mtd;:dʊ 'W”e-CEML9B"RpuMGAZ/`*F>x=:'H X@r4*A Eb~lF i=ȯ :dg[jnaUOHùITQ8uP+*)7C͉#<Iyo><K [~ 9x+53fKQ".3-n5E 'I"Fk/]8 ]`\/t1zGgcJRbhnHs J\өxA?+7Νq_ʣV0w2 mԁr00"]pi］7I ]A[1%ݧjf>JR }ĢP`rm¡:(,ca=|QQX..Z؜"dYQ{> g6LKntywEN 9XdJ@l% Mbj=ޕzdʚB,83o-ЫZ JZ: ;po޽Wȱn3͙I/"2K5!B.I$.Z.R)vFks51k ?֓Yٿ}<͇{Z^t*kɕ[t^W,uʰze摨v * URFFLG˞1 ta3i^54hr .tΊ)d%Kk5@&:#k'XՈ'J(JqOlLsYk ,gL \z~{ܾ!*xsox(*HlSBk5NuSA`bu{?7sbr=uz0xܺQҪfAJwl۱jHʙcW nI&ETefjF&NMZ[@V|y~>uoδB=Hz5PhNU:LC~bTM8ae@wsFⱏѵLv쿥c+ƾw LcX>Hă'wAa=kU q ]^6_7;7ȗ,gB1:w,„2ZJZ"N Fen`[49aK=BEӌjڗ}ڿ-$u8DVp-x-I wwy~+?Ƅgtw6x_(^ƚww1@MդL[u|ۢ /؁Ԩ⠭ DA1#-(^QVnCkJ#s;s"6z]P%6m33dH4X180؋ĭUW9u%¨Y(YBɝ._vxCI,B=ۣң4Ն@x-uWLvoGvqܤDw\ 9oE?FW D|p0Xi˞f,&9|#OG;uR&CH}Sٸ^*gN#5&s҄ohu~뽎M<gܼ^mp*qjdG*B`55T?p܈}wLHcYB jO}t%UߚzzjVV|Xj3e7X"MԳa˞}) W3_vhAr\L)KoZ+)o;މ@RګwQai} +I5 <}6S]9+|y>g>V JRWR Opa}$NV~^N" L>zc^bqvF`0>b<I:]:[i#;Gù=.xx61u.A׶ AY42O1I&ά:x#(6Q94 xrJ/>'?{݁C8nC$5Z1!,S)@ltbb@:2oS#3iۺI%j@ӟX:8L k&m' zLO&*d!+Ϙۉf)Fqмxd2M];46r}8~F7Bvv  ySUe.d۰gT{l@c%Ar-r6xr˽2x_p8_Vv!@ '4l2zQuHp 6 ϱa=؎rZI-tP1}AƆ0-\V_p:+!Qk}WMXAf؋X\dE^޵V=[r=pu*S 25 FׂS J޾kl51V;-lAnE.m菟}[s㝰 *-;*a4dɿf[ 8("0Xbq`dgǁ 1 fž̵J.%\7=hxNp:ߛoeToarwݔr5*<֞d%6ɖ( q=F3ɕ@Chzjb(hc&ƵQgt_z\9>bK>dW[#{rauN$b:I^#n 3 V)\БXBAHtyfllUMCQ%!)@ dX [|?향wT\p模%q9]EW"Ӡ:)ҦK4kϴΧj}ދKQo 3Mv^q3|.|x|zepStTP/.? .r#@~&ݢDU;@l" ujaVM>mKZW}O72~Gq:Gˏ}V<r?c#ijM/E{U|?gu7p͌8;8ԩzJD܈J"Β{fȴD/GZdos_~탟-KLl-Q>;^j\I4L({ Td9H5.d%,ӾpCҴ埞[}¦A淉ܮبx}rX-zpQͭlM$AVCRc~p jw5isY HN;8NFG'oز0Jr4{zngv 4s5D VGy1{ӳ Ml31PpθGon0Lgj[_cv»6R(^|W=  3FzH7ے3&L"p;cD|l0O훪߭f<ދ]d+ GUАj]'v^HN9q\dWreHM`K *++6vjQ6ԭ'p)Sr9}tjX⒱Z^clZ "Z $N*LY!W-稡%#AptbKaBWp &GDEx؉!x d'7pCE:@ ˖TMcS^1f&jU`Mn3>Eq5M28CsT lQ̆f^Gvۆ!>Zٳ(Вՙ9z?6Z6ـ h(*x ߵxaR; ۛ8l=JKFmOt,`x?HGG; _*/X@ЇUcνGdPF#3)ȁfC q9^K^FB' e1T2 | TPd[!z F~݇7}jja07^V*6O AYr!l崜*U9L }oG `UsX{^ٟ aj;N10ќ1:>N{Rf| !2u0Z_pζWjYJ0} G'ݣw Hc$d̽u+YgJ#9S#aT,\_gT׭wzU>=UABG嚳+a ~+sc7(i (Ab::ŴSO[3XQ?|[rfzE^ow;@"S}JT#CZ q ̏3ww0T&ݞ`yai64|lnK5泟5~>lrqLo|`LW'< PM!"~oS!!zٷW>y~/_Juby܄* e&_@_+"j Pc|8"Ċ$O6P=OF~.4B5ۑnTCŒNЙi>g%:ڶ{Qhm&m+_CI]oy!^ u v4o(6RIQ Һ?ύ y!˫~BCBчٰ;o1P1Rv%V1L,Ho$,9"(9Ӊz3AE}^xtQys2EG6L5~|r*L(B"9ܒ6K2PbdGV6/˃oMV4y V!L 7X:_&ZՉX»mZL| O(T68oc?qh#PPCn%Tp>5,l CyNQUL"_mTqj-hAH.˭t/[*N bf ]C*nnٍgc.Hx.~~aV;Yl`aҦ Hُ?0=3ֻUyz|Du` YQ *2K%:U|2)aH嚞` zv)nfW515 `+;-0gi@{8z9U DWXXV1[;bG:h\"LˈޏDkB䢰+rQCheТL9mTKy#{\m(Гk! uN:sNDEknnzqCG5ܷKCe_(M-4q^YO#}'%.u=,K/~_hUQqL,V_8 W|Ljr`[WRoY .2n-mg3vK2rWL#!OM'/q'7 :U|wΏkg%{ Vu1Hn4CPQc8wS^/#L3&ƀ!>#L=]y=t R~YaƳd!Qᖟ 8]/  2ZVF8}F q(|_VBK"*m#6=#گBo4\98fl47;֞8\f}\|S$A.aAD!o1q-W6)SoKBH\[h \´Tq^M%8Mú㽏"A]Sd[KkofydEk4=b6vqUwq;~81HfsvwUC1'sNp 5{ d֚A VJEeH$4f2 s«T)cLT`kD_h2$*Gkb\vR//NjzZr*5qČwr|96Pw !l 3c̾q15:46XP|hT>O$l079H<15D͛)c>כcxѕ/1rnO͛=Hi06@=eE_5ɋѻ?]?jsYYBS_2h=['#՟c(" JXhDV.8td3yˣ ԟ Z[ B)$hx]>--]Q\ ӗ1/uS]zBa/%'=s' 5P̭#.8ϯ+u9srQѯ{QU>g#sV )C25\LZ goMcanO+ںBה&ѹT [1?da: .Ys{rٰb5Y"ald> ^<\N{lX,cGӠX`EFK9<\etB|iM/'6onPڸyesPW;uGW'wZN}硞_jvI=ܻԁs~cRPeS{֒SCsfE+*H,H7; '!xJgly^RK,l H|t e?vJw ߼\2 ,7K_D< aTȽC۟i}!@(܈p;q1 D%cSxh<'TE=p1Bm|剡]5!!l]T+GmmoB@$rN$1UexvɴN.non#{İD EfO -hYAnNC' k~5)@z`~1`<5,E _#kN@lSb N,C,BAadʭޜozPw6c_HjPjHMx9=zXWl:g' )ձ#+C$X%:v Sܥ^I “6Ćt䙶fg7?( Fk(ʯx7Tw8i`6-{,j$!]!.>gvcA"=CZ:(=(4w%lG P\$i)vU77t ?w>ޕo?ng.{ _SOvJ'#r[Be:QkEMsfv)c_ `stx K52;XH޶0v06mIM?GUo|* tkY V8f@]*bR9-QkRP|Y6׬3 k~lM|.@4w ]ݮNhl}RVݩ6HC# Ȥ,s|8I ΝM/E )m`7#rҫ,T&OI'GB$7Wb Mw ȖS[%RN]`py]='clջ oF//-: -vs")ѕ}A=Oδ]CY@UJ:}Tg]#5vt>rֺpMp%I G S@Bl?Os3ʑAWb{skJRDBcGGCcel [9/)8YW:TӶr }vьbZIǰr+@(M{V0QU [_ȃ p}C.1CZGb2J(aCdzrw. h3``IDwA u]? T#pĪ-ٵQca{.K㐂a(քЙ=P~'KA|ѹ]=ug68\uSpᚇ5|YVuo9 ߠpDBG tJ{Fv]ۈp&pA?Ĉje+ SWXtsԅqvPg_E ^ F E/bfi4h# =s:Ne1hϩwU]{`V/v-?YHLIy<ʦ /qII'ט(ݼ`Ľ-< k! p(Ab#5=0"z|VU7d^њ_^Χ)=&WDd+ #{OBlێ7JyYFE{BC䂹ԑ`*тf`1 Wi6CWFʙؑ$XhlQ "ߞ!m T-7.xćܫxrK]V3$Ȉ54E( q8%8=F,-7UU('~4*<glEE=>o 5|QY\j@i5˚+&= ̬V'ʖp,u K7Ӳ&_[]Gl[Ѫ;5mn>>4&rzH'B?[E1q@ݯT𪏏`Gs DP[̢6f+Y3dAD+ rSt1,]u%}a+3܂&Bg&ޜæ7fѤ? m6ѡy䬲Aʆ(ByĚ%fu,\t_{bJ-(>S!Nsy q [ǧ0q XᑡLڗ8vqFbuV0c_1W%5Vum_-8&003MB]ˁs6Lp0}Ms+0eU6k=z^0 ޛ#˜7 pekغN5g.%_HyZ~܏n@{ot݇܎]}5%Xeb9k/' MQ*F)Z0}ۢ`aʪ&b3`EmѰ92*([m4?ֈݍ&b*NZf[D5UڔEKUrO5Eh_׃Ctb"Eo! K#'ya5z FpbڏZGڳE)K*J?h siAtW>`/z vk=FGC!rZRI` g\a.=Z"Zc6]^{I,tvQ r_$ʋC4\*("PyOv]c7ӡ".Ua05[rREǣثU3l4mݖʊ.eh M˛dsݳ] pFg6 q,;{n +8؍cupNgc LTyl&BDfP%>,4b5 5MsJ5m(;R2'O>Nrދ!vY)b@(qVWS8OLkoekPy/ ARCǦ 9WwUln$ˍ (5(C!nXNuLMFv ]U,}zfU-]qE-_H•(1 j$!޶G?EpG;˰׳o*,|<1:q*a;P)KVL:|{ GCCs>Pep#9$H 9Kԣ]3PФ^ v0G_?e9VZ mLn2Zs\xPy7Wh5LmgzʰʜE5;P63=<0f>+~B8 '&nw4V= p:<5cRV91T}'ޤ4.Nq7Pp{%Ҩq \Oc0lǜZ%)9 i-a,f"JB{5ڶxfě/}M-gw8]NgT1 .NRj3,P1md2>Mv_Ts+wu$ mns2^r{e=V77Z؞[>$lssL9 gb~Z ^W f,,Pnhdf[ x u-@žތ {질z8ElA6}G09P5%eCҡͣ8VfvOt06TvQZ+Y#=GV]&&cj@RN;10XF'XQ$ x5: 7%K^ǤAU3:51UYN8NZ&8x)cIݑ,&NzyQ.9 F˛&Ћy,;V3 4blc%Ul+s84!11KĚC= Ͻ?VUڪݫvAYu֖,VeeО-zJݨ۽5c]ܺBoGf yj 3<Tӆ VXu+$NN]a,"z Ma 䡨6`zddo]H~UjrIY5y8`ZqLG puD-o_,?:*X"h)[ѱ3T͘dp 5"!>j8EMIL=7AJؕ@.$ @s j@=9D 0 gxcQJF &~8SyK\`4Ǐww8G!GiqlN'>W, GO@_hx⌱2ի5x@-(P)'OduUTq^(Fh*{r*"iF5mzSu1Xww'`$}1.#+#P)vQ,ah=g Dg4~k`\;6>ЂKŵj@~=w:K[8E/Z6/̖qBdIE+8Di7ڭ݋6K/!LG<- DC(= +y=yt(5QIw/ٛleCY4S\OضPm9!q`n wy0"^. ɦp?Jy\$EP%g[ja~d<dz0^{k{#{K%/uuv7ӂNzkg(/URpՁ7y+f{a6 EΙ*ȩ}7~w܈)I\NvS6zUj`qT(r>{q%YӇ3{W1ggt͒0A/05TZ{ܔHd ֈ6c@ ң~+M͸Gs,NFbY\+n(u[0P$@:ga7h[|'-y !8]Ϝ훬kd ϔ&ĽEpͧR S{^p-Ikꂈ{"}Rqfl0 yljNW6}_]Q]mk!zږzϾgBa!p}5R@ (RF 5Y@au`cbVMXn $O?ݼ9RߋCUP5[g"aSmxJp/ucV/wZ$;4pG=gEa,UBQj7gX6$ m˹kNpdEP-c{^?缇}ᅜuKEa-+r[;p/9̽yҠb`kh[SvVLE - _"*ݥh.EEwNrA>v'S=\-rl&Khc$X9a /V[=g|[Y*A[s5w1Z_eT.0۟mq0NKFg[7XJ+U?^\oe˶fIPAeJ$$CnZ)zߦݤj'"ˆJ %  עdJC;vZC7Tj0 ߗc71Y?G@/AD3W>s>ZzM`wtEBOBo(X:k[Af\l;}ۻweۥg$}76"-3V_Т{O΋&As7۔!ti*:!vE'J,o>U}@VDh92RmI'%6_r2br&g#]3{K[}gj77Q\pM[5Au*khlbF7JP%͔ٳI7XJ2U97s\{ {ePH hn^z[׈D~e0E2vڝCcLɾTo+q٨+L~Puµ^^ckbc!X'Q)zt '?R_^)PY 5cok胞^gꎦ0m07#ɗ]Bq5găW i 2P1k M{T,1` jhW9Rd@mRg~".2o_vA~m*knWOsJiž@;hœ/" } YboF~,\4tJGa⓶0Sk+Ƣj<.ՙE¾.TFqbRm>?=)q#2WBa(J8N< e\o @F~[0Zv2.5W /N\b4BW{WvtԬxkZIt߬DwZl=?皰_[ W1i:W}v*O7 ȡ0;Lq9Q%)/?+ۜuIj[< 9+RO%$BP"E}m^EkSLRd-'*f[_"GNa "+UYȍ]D@T`:M*tH\yי*ҽĉy§PW0Y-CUip$uU_:+?diYAY Dt>3*͹: vg#Ը#Mzg'umTbp Hekj6MqIW?AaE6/EdC5F /DRFȋ~#{,>K_&ԍal/si{j}Nk,@I/F_H3$J>8uj)4e &Fg][NZvZ}n-t:-AQ+>Uz*OsWAcE|5gb_hXD9|·]k$nuDP {:EfNPmuaG1 c.غkekio9=phޖ2n}b2FΖ<Nۯբ*(Cw1 J0i r\1/'b kkG9[!ۀeSw.lK4cݻ4h+dl)/WxNQ "{xVb5檃{|5s(zʳ_Gar=֌a dy2SYvY5 Hjib:|2UU3I!Ltw kl*NQ!<ǜrei8+)Tb>\gφ,ܦгy+?^՛l:M(']ƜJGp/a>ץkѲO1/&6`{Q2xwǛ?6.Çwʛo s&P^NcDN\!/5́{ω7)1sx{$:Z9txjBxo"z۳Ro)*IJT7( SwgT[8v?aMX֧ijfc=8RH]s:{6KҘ^z/QrA@ZE+~]砥FxbS L$W*U\F|(p4i~XYZ/Y$P- Idr }'SnKy՟x։NGKT]:-(iVԅ}ewXj.S6=7^=tBHk>KW 4cX+pk835R·K}v#QT=ݷw*(nyKor%2eHH=HjjoHWYi-簼{ NHP&9!,92Hp59Kf-sVg{UͮEswvjɰJƝU躚uģ0jOvϑ lzdc!$nfQrW5Ʈc q'Vm1L+ھBPhrqy1wBi4XYG(Tw{D~y2^2#&D:s*ǎ4a⑉# ^;'(޺}@tr 4 ۪"X3T opכ\֤eiEsŭHRFW@5FevMei}sd>bmN[Hd&Il(EqxU8;aQhj'o9=+H)scVT^sN|a!-}.v5+ N}tU2VS|HZ,O0gqf5]g+Y}/Y&.RSsEڡ нÌT aݡ J7֑;Wnۥn6x6{@d/RɆqmC׉4^MvNU 3zHj|JǬ=C|}֯}yv66q֘3L17벭p(Zy#O.خjRBK#$%%@JsCTSFmn/W2o[ҫASZe,mN"%G}~j6>i 8f׵] :΂hRdQ9MSGssl/< gQ׾ԡGU"Dʕ|?6oD ReJĄu*Wa_,ٟ5ߣT*!  K@dJfUmWcg0ΝIcQu5Yc!<I+pD9/Rͨ:=k]{~ J͊ˉÓF1tC,wB3G̝'#%vÕetS1Uo0ܜ@|vt9*s㌡\gA::N=j䷣{Xs2eck:I`ky.]:LXV7:ȵ(- V *cnc3mC"1Z7rfhroMhw/_+z BH᝗# hV=>PV~(:v8'KhǠ5R.GO9/8s$PΟ\8tT_914:Fɕy LI]eՄWV]qvxgr!X"944~ 2z9LJ0$-G8.0d}j%&^K_[CM:FU͐~h χd,[o UL#=ۙIW&;?|wnJnĴs!9fݏLqR@<)5z3|JqRbrG{H>kfσhkTGUtAPɕEN+ɜPS;m()Y)]0ry!9 lY5B^'x?@ME㒽 .:vYwlxFè]hu,G˖coHe1Z(jJGyISmֵ,@?Bu{PzVt~q\ kez V9Pյ# wqc׬]LXY,<^DGnO9ŇSgOSeDC87mۡ,Y<ZpUIp5*k Gt5<0Ǜ;ܕ6{l?nY4'41F^[A*RvX\MzȜej+DD= d@,UUKϸ1kH\R^QKU/c)ա/BBUUvQ[XGt)ܖ Q}c5ӫ^8̣X:R8g뙤j 1ţf֖cvgGŗk1__4V6DG$xȬ*9Ɇ܂Ԋ5ǧ금`@׊DQ,.hv{)3[Dph,u i<ЄumU'iL`<5HMEX#-,p ӗxlձ[gpKvv'_S/e\Q7+Rn&-^j2jrB*(UD5GW@Jg3u[,B~[BSs <{of`5ZzS1~X5g`Z~E; snXۼUGY 31ڟ*5kojYJо @Ю3ZްcI?dgrRxg+OE=KP=̾h3a<[h{/gfq߆n-l3CԀ\1*ʕ^mEjqGj{ɁRռw UVtvRS\\2d{ Yͭ*:*'/mTtNW]˨LcfIx2?y0 Hc_=maB&aat4P)l8n/>8rlTsA/+_؟~d[ [r'?J Hf112PqH0"V@܍ObQ7҉,V+ 1=Hmb")XjqI֝Q8Nu<4Kj_Ȯ^]>~ǞCV ΞD_$v[V6W``QO~bѹ}ÖipbAj%téçZNֿr/f/غ$Aq)lPM aW1ɻ]Nk/R\ppxz7wB+"E%RW4yW.EMG*\ke7կk/@T6dFf#n`M"^Z|),(牛MUԛfScٞebӞůq+;nN<3e5 7s0KQ- T#jYT3-eşmjsO>%Dp˯[~ŷLD?:WrG鞞Oث.nd{֓BuNٚ;LbCtWս&dH5i=up+GUrːu"zKEQY5j:([pyFrqɽR}R6-`W|:d"޸;yJW@` mjL2"θ+3+8;|wJjdIg;Z(#}d??œ 9YEbVqfӬj/V㶈R1VOYQTuWmO2D؟sCՔ+)΂Z/(93 뭬BLO`s@-)] Eşn~~8係ǏK/FR*d`P`#39nfMYj9#ddj.ȢozS.fAM_+W\fmĚ@̞w7~8 '^Hx(aspص% _áA5 Z>z%Az*-}* *5踠6NʓK/7C͇of?W@` q;zs5~g:B0q:$zI(wE:2!mQ"]dK+co }dK=z=PՄ1"p|g逨t+|b}ȴr۳GOz+Q/( ge͗~ d>{+bU϶L. Z|5_ݞaD6^ayZ~Tw:B )_^9gm56D~`AJi _.~YCg9yõt֠ILI5u@X#1G>X!F^rOjQNOkatDd<r{ԋ!9_?nKuh懏7fsM\ދ<9Y&;e팫l.8'u2(Q!.zy4phU/t ׇtr8{& jP!kXJ|@Rd :cc 5g \${5j6Y'uxm4dM >kݜ1`#8mBqDxKV V,mB]Z/PLc{*oAwo7V7mPHo޴mwVz>]*!d)+vGgij=KO+ .z4 4l1[;xo pSHDb4޽>>N}L- z 1f%7.wAڛqfNNH14n^^jcxyΣսƽsrNsYz-S yZa2 J5cpl6=]!ω Gh,8.gwZ}7rpP7yɾH@Sy18 P  Д2K6bAEӡz|=F'?|c7_o6W1VC\ %Ch&lքb{O:DNwlZN"lFag?^ޡeSk8"9@ !7B(X ̚dQD"]s1r^Yd B%aĞ''UB2 gu !ڳ۬iop_6f#xi!Ghfh<]A뮻G;Y^DAEpW;siUe)q7 $Kdo4ђ xbXcM7@Rǀ^y/f}ۯny# ݡe΂º ;Ѻ߉YxGn#bGq>/;%STOB_!kcYhc8]@;B# 8!D=y QCoT iu vwbJ%7U{#ҁz+Բy KE: DeL+r+JQ]}( gWct5&lI]8b8mIei䛢}w }cƸ&a}!ALo)"#E _ (p `HWO.wfC gTM]k"W1꟪w}MN?0yo7/zx^My~L ~(O<:nր\\Q{Rt19;̴m"L#5߇Hƫ-C[bΥN+ FD~(. XEl.agtx؇K_D"p ӛ#Tk>k{wK^~gl]sEO3خlIQcv@)`{#e[ mj/F"1zJx@^dA$_?yQ9S}RI~wjnBXp@-˾]MT_dlՠH+a] Nđ+Ѳ-=S!o04#Bbp\ɛ6bۮ xhhuLM4s׬*8_(T%#x}ԳP&Pڢjn;e1 ̘@D{ǀ|*XKu!v:  x`6n)ݭƆb.Ln$;C] r:aK8l_VE:> u"]pme?l;,̷\x":i­Ǯ}`&ӐNs&tbїo =d7GrHf]:S,-I2uk]/B鷫 `n@df3ՠfxF;q:>ju߰\ '!m9Oؕ_J<;qǧtb&-]?9'jBy5ws41v/0݆.!k~?܈ w }񳎫os.E<1 o-ՐͽCX<.Ot¡'V} t+$5s➵&͛jgʓC͋k߫Vy A;l;sIF k)q>j|'/c#)v+JSe1;)3M-5'6, N.\caʪD4Ta+[XR2D?tbjh"|&.cfԍ6ҕXJϊ&c cHOǹ>ikk߂$#>aH;)\i{Ǚ|%̑8 J/ߗՋ77onÇ;bz>&S /Z&Љ$lJNUpV,(Mۯwo/twбO0k􍪂HT5NJ$Y?&F.WmːiT.EqũoRMZܐE! )jK!Eڲ/O|Fj".o[1D$ik++,y:c]5sCQa٠xy7ӳtuF=,p;@z"6Wvl!6.͉F3A_Q9<罓XhA[;AAp|IKzڞ 7ǷܼƳ]vwW=^y63W"X.T TmYUw7񃵛5M}a*8iל~qV24^S>FZpY,"5ReFe=W4*U-JJ<':BʙdӟaZ+x(fFN7X ' GǾ=bJKVp=3T'&*<жf7ߵ[y}8nٻg쐓AR/9jչ.+TYXT!@s@M_@Y h7_Ds֠5#V06_*)AZynnڒ, OkkiA84h ے yN~L-eƜ|k,Yh2B,Fz+pby![s63g0|k; t aSnhLpe:)&S|Ղ h3y?/ %!Z*[ =~5C#zm{#^6owSGIMTJ;R ̕cnwϲV9J? ,2f_;IL TJx8/>Syz}530i|zm6fmU4iS+3%/5DzSP O6 ': tNNDj5\$oA z14S BQs10Jҭ/[QPh@Yrx"lQ[I <.r۟_:IM ؆*3 "}y t$gT nzbuȫ?aL5vQL @m!5ؚJ Rs4M 2% ir6LD"hD*DxPdB, ,@r˞f ]i;{(N LkbkA FAa.3ҩQҨZ0?h}ѽKQo/1ej&thG࢈ ,o+.]Ysrs;0U˫l"dPR'l)d #Q6%@̔Vs#8 1՛, htgPY'Cz$h2z(kL]BeSZjaYHO;;- F")s'~G;?s!g-ʔ54=ͻxzIjt-"/ݶqqR Zkx P^ٔkڶ\̩Qe0G\yQE iw{?"R } yKB.2[]K:\ 4mUf/~+!{7eʼleT3}q:'ꕲsHwͪt\# V4L4ʂuE5y]dZS^$ؓ|ߏo\eӪ#gp\_CS]mϙЩN}vN-UrdY܍@Ѻs2J׊ǠÂ: _讲Do\pAs;[{>ܼN0nPܳ"7p>-NMԬxӽ䞱Yt-򰧎ȞqU.B` E֫EމGNRGEZ . N?E^@d/mJϸ^7?>|8 o;~OpPjTuGb;BkϫDoF bF"v᠟Rl_4#j=t"GbCZbp樀5h9[dh0cIJ }\.b\~>D h]*}pC%Å0,I S>TEkT컏 [Q ']OĔRtj͚H\)969r>[ h¸B- {Ŝ薔A+qLV=Ŷu ƵʨA/Q/f#ՄD@,lh͆RK@#e)N^O%gDV/LsJC"̑^*7'B*"s%XGSD&yM9s_igwi fX7hNSڤlȥjFmE{_/CG1Ec: ڥ ÛS0ubɝ9&)uz5K~Z`(Z%]$BF[$q`\И"}Ŷ`l_:( ے[sFܒ5'SlIhUz8iZou{r%sJ` •UQn^ X?b%zOQark5&fƤ_z s|Z7x+H(J.GM=+$,i]iɞ0K1ž;cƷ݋c!{;;vw<'2Эr/t+ P͖{ :GK?Gd(1S9%q Վ`Hټ8j zv[dp}d vHcjIo!Pşvʈd/0WͶ%bm$gClB7?WwG xyt_1IR SA b8p"Ꝓ B둀X .#/@`;> TP)pԲ(S #JF@\iۧd6>1|j5GQLAesK:mAmǿ]̢g/k+H˧Mɼ汇~|Dl ,: à+g>2*)`ЩdŷOH>Z.fIХE,ȁf*&kĝδ:$C0$6 T!že KIt3 jAs MkbA=vAHNA"QCmAରg9u(m)a lff"oZjI2Uk$Њ}B-?gw4 @[4 FDWKh"Gʲ?pM_wWQ*#3[ W>oO7+>Z sLIaH81p󟷤,@5-(SjbDhK[a(MpSvѾ/Cj0Sٜ]t`GzKLm\K b mH?7LڽGkrRl5dY%^1"m-p wa%)[<; z.{cb:څ.ӝ0N{ʮ%!B?ssiel\b{f|KiB:O%F6d;j W5~*G.-_l$g?WYQ=٘)Gu͓ŮV^`g,&)-CVD+8S"A6Ӛ3iLW>B>gZM@Vǎ%FCx.xjB(6c ^o_ZzM9C 1bu<:"R:4̮Bd@G\XjE AZI$d4{N2~֥bd:0W,Rbǃb̓5ϥpgV5յ,׮FOT;N6P[$®Ǝ{L%Dq#M!cpK+Eo>|$ֳ΅5M1dC (RG= \6vRZ~a»BH Y+&ЈzEA?fKU"2HpN.a'1`Rj3 R^,fJ7?DNĴ-1q#?#`s`tZ j';3 ǚT@CN"Ho6)VR;M*GgF]:cGA NO1=)+q# WQp]=aYt^"]tQ2<;aw8'g7Ozj(r&N'[+t#dlt/Zb uQ[d\,'Ҫp/>Gr}n 2З_q}^̛x %PIN:@oLodV(JBMRN 7ĝFj&\Cp #Hz]S2_ӉZ T1:p- Zy_Uͣ134 Ain9E9$z\hFKig9;7ܵZ|3ZD3W0e0g"p>ެ+Y1E o5w^Ϊ[܏L=33`f` BkU&J;C/ϒA㇯*mRv{*|_}p~I?>2!L#.xH!oթ C.b ymU~IIFBАg` 5'phzp|imUx5dwun!*厄WkP5P Er^Fm>i[%a,h+ɑ5 nJPrY ݦers*=</Wŀӳ~fs>XB$Y k :r[Lja[JrgZϵCGDv3 0fgL!#vmfuCJ=z|nsC 9-Ei1X]__Cأ̟ƶ-)cg@R冀gֶn-GX2*x\ sW?EOlLҳ-}og+" вIgȎZΩGpř5| _KA0y1XZF |? Xhv'$ř67oSA5\X5B"e,}H N% dl_dmΫ57XO|W ֜"Au۩C0?a -:|A,}p=s>B7WNA"* o rTjFnrN7c츺*@m3?Wi]z*ZjjDdY=DP?}dqSe!"nNeڏH +~Q"kB0J̟'C|SHiqH_kZm&^9txn+ 5ƪtR9+|%.W( g8lIKxd^A$}?n:PVEz&)eI$B ^ ˘8J5L.W|c}E6٨Fa䓊ۇ 7^*:>.⵿Cxɏ5Htqꑒ Պx<и&"3syeU,dta55&Ѭ4I^_a˒۔{)T9!]@Բne'Zۥ}L?3k%ZKߘUsH4KB#Yg,AWr;~,zH7ױW>aHk Qal:kPFy3_Lj RN q9 FZ7n_~,q%dp2$-s\E u97Nl.u_? sͶ}BQg%!#$``H&K2$YXUGQ6p(6gn_W{GTϞ4Iꗯ^-Ð# 59qbvX9L h2jєܘiLMum620Op I>%Gq 㨬uXb5% UTѐ](١R%RX} HQR43։p}4Y4,gHm8 /Tl(Gb[a<аܵȵ#mY }7ՠ5 ˆ͚yq=QÚr[$oT<6񧖃#<%ܱ=6Xk!!U?޷ǰQ/ uԷY;mY^LrŗDaVGd'b:t wOBRA*alE PACt b͉ҕ%G;C8sG(U a瘟MEB?Z#ɣ9H$s ǎ ,OzDaRa#'ěY۩qWDمiL hTQ\fpluFc?/trtv)ͰKcbWIN%bxȲ脏(p𱺳ۺ&?ݿ>uk/g@4ӊ2;o߶)Br-7 SpAza >KSrcz04ES߰*bvk )RWW@0v,rU0ha$ `Pw jE$:ɁYdow]cBU+Bj sX{>pp>~}m.&( +#/]3}ux.1Ն!PEDY&P3n,~H04 cU՝/`5(_i:[_(yÉw&mEls*!,-hsnA/SK HJ],q%SqάFl>>鱸DU+'<ѰMH9ꈇtD@-:h!2n#aa}}n䫛 cm5d;y_n8]0[aԂQ߮{OA\5=j8E&`+zd x``nF/]r\/\a\!$lQӄC%M@VU5C T2s8xV_aed4ZC{U=[/A1N4YGP#E~}ZyjeP`'Q=&T;hzKQFg izlY2D~{ϻ?8A GDHy ~Y1赟xF> MpɩE㚃E L?-I4ur YgL:i{Ԝ+d0J'>jm3j 6efR!e}[H'֊5%iGsȵ'#[z`j.^/?sZ5Tg!ACmgSm,'DQuwR dߧeEO We %l>Z:=cww}3Vph)ǹZ^EFCZ{ KS_c~x}ûw݋)E6Kby.A,*_& :CTc-&ٯ:Vܴl0D8t5u mJvN ruSVf<4gAmƾ1*=aNfg(01?.H E"xI{?&'I1AAY<] ʶlCDG:論=5#f%01V+yP72U8k^[vk5<Y̖u3_h'5^})U4)ea0.dmUp֝{cm,ni$ ;&5)nI޼ *)# #SUCJv*ӑح _| EOoWakY`A5: X]a30!BEh&Iw9 U'*TXt/е s<ؒ$Ԧ 7(O z{zT~Ac;G[dd2Sz15"E9tuDzyE[A˦7:U% L??M:h R*Aa_Jn>0f E- yE 5?c#3O]н]Chks]R*ސGq9 V"z"CcT>]JKbwu(s.w5hSo+`mImPo5WsPFf7[, v$=qM-` b\*=،!`ZDebr<*#͆Ś=CkZP6(r.憵@Mfozqy$zP/JiZrY=p1HZE49Xym-q^">VW{у 8lN:_=IdA+aP2bI@"]}'m"nï UulPd{w.Wy׎K(Kp詪OUywx&3 Cw3ޠbA[\y;K0T;bPH $chT*wԾ)u)e:7oZ[=LcIf@6勝jsۚ5ό}òƶamZ9M,<^#,ߵmK&g Ko7h͏#򍺄Ѻ|j[kՔu0YLKm̢3 .)5\Z͵Hԭ| F9>~JDls\rxdWHݿEE7jg+Q" 蕨i1!U *֭'Q$\gNbWĽ63X.`bSg0҄=KtTZ\eObD,| JT(vL=&&%-}Y_U bU9L'h|/ rP?4[&Ӏspxg Tخ AC%\obb-V#6&co;[^>˶z=!>K~p&2'ݍ,%;$.m=c#f":~' XaDquL4j$l x,qGƔmhvX/݊PjGP[̢ ( 8D2w \V%ĵ3ʲ[ 79*JAE+ r>u1^XRF!77v/]c{1{BBnK r"XP[U#KvӢO1=Y/?jѵ RfG[UixRDf3_4S$FXqӳWv8# ? +FOž*z}g~6Y0-X}Ğ с?x klb >9Ojc/'uWWft g〢ϝv>|;%lA#A1 F>=Vo8b5هOlVx1]i\/w ,A1WFR!f%`WQ2tѬ^5%ވ"a3'y JKa C=GD%v 碢d&˓Pdw =-⡭AbV2_b^H@ 6md KHi]|GViC6bP.1}DT @E6:NWuiPɄ sj +9+utx͓;'ڲ"V>5F?aSKXw6{|[}ǛY}2V/Z_#`H 國ܗJ7XK,|q*/B QOe@r*'?K}_7?k;U{68F]&5X9Hb $;oB ɥ^4[颶r)"׎38 hs-} ^|T0j(BɓmWr&3eb:G 6Jlq=;kr2ٴ*/+HZߊU=k~ gZy9%v.S5 B1<|||n/^B@H"{jg;] &; go\J>H!lB/{t.|0LH -LZs&e۲Pd] 6{x{{{ewϚ>CĤAσ-x#THZO;anstbkQ9ShL.aP,^d&X>WhIk(jFW{a!NH5WoU~8._ypw!?]RlmUJa/ ;#r*ܖ UmӀLJCBS$BF?cm&WWͩ7"ǖ~/ӋN@T8lm cjAl4j1Kxg`;`BqxdȬJ 浍Ɉ_sD{"5T_37S5~."jCP 9vB-8@请W+mY@רRk[Dߑ؏u|ЪtV.g.Vk[+ֵxcٳLWPBS[ctJjmkqQ^h\$Y/fӖ*C S64灌RK gU}뒯xOp^0{DѤ$9Q Ibzt~O۩O\.ʷGZ4~dR,pW rd2}#C{f)xwT qk1Bhx _#y* 3I=nk(ެaC}"ȇb<~H^RQ IQ7Lh /zxhO'%ZCwZ.ib5ٿ ə"xmI w T'r}ě9={i>|?f 7o2Pcrp )jN`eys0W/m< 9-m#"зiIgs59*3[!\ϋSfh^gwPVughNrxv.fSEh])$ Iņ‚yѱM}̓wG^6!G,Bdo8;)]$yG T2NOZSF~O1n .3GJMLY)]hjIB8V&(0)WIJ!E5Jf @;`uV!&&+ivV( 3zh",`.Be~" L'/99B[3Bbv|yw jYr0 )@| Ou# džW YKڇT ,n%'Ӽwe\*m>z=gaE*c>t_\f3zwl@t-}`}dRyw79uK_+. i#29['ln#hܒO WdIhkdьy>AQ7ChIowC ;go`6+篸MҪ6-ǰQfqHUDJ!dyN߻.zh zNGLNQ[%PV<emd92+T.l)ƣfǽ0)!s5 6;^KE;3^+pϜ"bi|sS Ѻ3~ nMs TVܲfՊ+mr}w}~3^4xf ut2h-|60dRlsѧ jᥴoyiEkD {=;嚨ȺװP994;~_N:&YQ?; %EtffB~ F=Q寳CF{~zr{Ӈ">SEKsҕcYHŅ45TO>ڊ%/SW14ZK@C'1B ]*AmT?YܖK0KKu JӱԂɰvUZ fw9\Y?vKGH2Fy$d\нF2."=9?`&1ޙ We(kmTfI,/lo74et,C`9, yYXPDjDjALmoz: rs(xF. Y.QG:tD{ o.} ;ܽk?gt7 vĀrٿp?+䥢k8w|s/[`fAőT|-QP Ww`]*1ۨ+%FvҤIB*V_:ʽķ7akgG +`8NVPfn: h =gL?hV!9fBwؔng~:|:W/zxؠ0&Lq)wҁx#C  RX)GgbS#RS/WP )3WK FV…7Oc{wx{no܌9#B-t`tv@.&qPoᠭ63w`y~F1'qؙgV>C@-M!' jveoj:g?+gFt lCY'O!oY\ (USjXڣh!y  '# %tL#X" șPZak4GߑĪ69f1t2ňUuvU.u;XG0ylq&yx6ʎ6b<8g9% vb".?̽ N"O2IKE(IQ[" !rOyZWWa$89Ao\3W>uvWqVf͚nv&'&{+Uŗ&RLkO<4"t [zm&kdKkw|6(5%)w`ZQ8X'k-VcL =dP98~*"[ ZR!-h{GqyU4VT} ˞LTZ|NEbkm u5Ǘg0dCVw>ie u *X1 K!4t5|p.{HMѾ;|P[u7g]1 yosq;Gz;G @)/kӘ*f}6f:*s$Ʃf\7w c"u@`HAkfYe .%Mxu~/~_ՏCeVN8ŽpCL۫GO"DxH1m]I1Kj A9Ah+qA^D+>ў]_zu%%e;PL]R?b x^0Tư?%w<PFb[.ۓֱ9w899B3P_rbS7#Z+NJ1RL7:j \iז,[VgaE:z$Jð s|ƭF>يOBBæBna+#D:CDLxjL*%zr$_vb%Nzր NX R,#/=5zfh,g ؾF:2Dg'25d,t-z1 %_ m3 ꨋ[nb#%n4wfz,95BgR6Ÿ[0 kq/:Ǻy_Uﲻ/,rֳݓF>'2SҳlnIOɟJqmofL}M!U+0j Yڜs$ #[) #/ga#~i dȻGYGeRs +4gT7-XRW9}K?<ənkM{ba 9^z7nOy?Pȅ5_=n+{2\_ bQ!/Y8l-vYeveZtdlHz )՛( eʥ.UJbtvej va2 P5Pe/xZ,MFF+elO/xc p@B\jRx5MލlK)DJeRF+&CA S256!UIFQ;i(b?|5y5vb4H BGAh-/ՂZ$ZȅLd8P^O3BNuTz +@*CXÃh1>00Cy~Wӆnuؒ+zpbؕEAM;%%GMkNq"qp  Sw~Z:9)ykl`\lۓrIIX (l<߲^g oq Cx?b *Gp^a@Pkx|B:Q87[эHɳP"t{FpNpC} GuTGm[?0B9!5b߭ :UCRNY o_:;0mHZ p.Y3BԾцQWp a 9\ MZZjrxUHcdmgfrVDoH-NVqXPⅲi>OSxG^ $Aתa7"Iޔw{@/q*Z ΀@ :-G5՚mcޮp:OCYrBzS,C»Y(h|-acú=7k^l6'\N BPpp+9Ky@5f'f)]a \idCv: PIV<~,"J0%T#e/lfUTxOWt$.N9,|#%9S35hdPq#!FN||qdqb\\tkZz>2g"D>jP3IɊ< >];h} [Evh6Eṯ+lίڽ$Ñ#0樲aQE i#K2jgKL=JҺl aQy0Jr 2xqM)l_v?&?LTO{5Тd$sj+{bO}xGtD*tSo׺=֒:k&V5K"B59<g;f~L~gUƞ į#"7O*/1V[2컓/^~FG1I7Ll4M̽u$k23]x6=ڢcC3,Rk<}vm!ً/0Z&Z5AGnS家S?t{~Z 03Rdą[ߚC ;HJ{CK%Df`Y_Me{iRD+$F[UrڍadƽmJc[n-o`ճ3Y.RT&&>dٝ5 32ޠCI_Wd?IˉqDݩTPScgi.v *3w$)t!~go{\ϱm*,+wêkT.`,?Гu+_^RյKnT Kc`iM k\ kZ,E]iylju=GE*)I;بW[(7*ls`䝪&'W$(G`|;Tudz1QfVoAdJ[: .Wr,y|]ܒv"cӮb$1a(F7'ؘKYSmPm #չc[& )܊Fʑ( u#WpOARG?{++qY!A2Zzi.ilZP6)0/n3eHMTģlZpŇW{R FN%9VcQ<-⠈ӷx<,o=v?<#T!:04ZImW; %N6/[;qMN[k[[> %8X6Loo!IEPteOL’=>t=u\Fb{HISuaOwfoocqfog}_ZO?ÿͶ?6YvO7`_=~=~?=(rN4cNA/X+tq\e5eH4ٍٍ7FEQu9P^<T9X34/]<.ƟwZRXHAX<|Ǔ>n;RQ.~c]7FO˓T)4bN44IYUS5" 1iv jz=gyJJ|w<f>T,wHbG/c?LBafPe}ǽ5.ʽ}Jb#YLzZl2M$Y:JZ^P*ք2 LAr>x1] `%ىկĽvn:8[R:CK%U1Zsva'M'+=0Y;/*)+˕܉jAkNܒKD-0"m<:v&{՟VRKM # H] 0"t:ONܫOk0{@N?A4|<KX-] J:?f-_޼k}a)5~Xawmaڱ e=頬aܹ9ŲȀAZD|ᔣdf< 9+yOΤ .޳ ic'DZN>ˡϹk{avI7Ԭk@w:KށtloBS Dv9H\Cv-#yf׷m|;||O}S7o 9( 9!C^$[fImsSNas'`S{`Ⴕ:]Cr,/_]g78D"7 cu D~ ?†dKsTlp#,.Iw":}w]r="3nA6 ȯyqhO"?\Z/Ko]ȫOn&_) FM8t+jdwM>/v5JO%`}KzzXvc]U^̿y,ο:b9h悯v_I/2θvke&\ 1}CnIo;V#Uż}y7].>v fR^ a9 J_}U"N rV5c$߫{,CGkCZLF_ -nZ^4Վe Stnja4UݴyX@O7#vpja*J Ƴ1Kg}.lOjW$5-"7ZIKÜwLgHHEӗ%]"Eo;\)~P1SR'͌H3n )e_pVq%]`o,8YLIVڏp)x49}Y/URrk)cc"ƋFD¸rc~%2-n`hiaQnYEWt"+d+H}P&I0= xƙ7@?T;\̇^Ħ}:vo.}K[&c\n!HyXbV|Xe+dBB9텫;!XCcqOv4g8ǂZ %W!aR<4S]U"tNjUvi PG(Y.:A >9Z]0yCa<Cw5i55Y1S.ѷb~\L(IՋ5C[!6;  ü}h=[C,'qcQԀfBثGu(8wQ?0xўz%ZtvK"3npsF*>ūͪl@7>Ə:*I d9395$Lt@I Ą@y-*Gγ6 LʻF=" xq:5Ä}|,(4J {jKo3eTF2%D^fN~ZX1feQ, +rU T G#r~/pY >sLZ $H> 5q΍.O}~3XOʯƓ%NiNr`N^@nwԜ+aUGq9i{< %38x&oCv<1DǢMnΝ8rafuXgS]ݥ}4G(8c quF=xd9\盢xxM?<ܿ~Q\z)ijPѰ匌\g46 /cMGw"Ѣ)ZX{TYxk3_kIѿ-rmW*i Rh]JhcM3Q%?ʪu`$!РcW!~^#$6;G ;R^ 8{f0qR'mI>I[ӔD%ΆD91m7 't /zi,n Mq4wu\{;pY o=3f*9@E8m+-N.cV>>dEvP.Y>3k2]y#⣝*vR**RD/:{n(`#T9a' gܕΎ&aZ o7x 8}MЊڰ(-]\iiX,\)4u(8)XI51K~ x/Gm2kbCgX^042emۀt_ "N؅$HbIJbԬ_=lSv7>~9,;+$O֗(8Z0(l߱Z>M'ꈞCܻ*t3uCujhd+PU]ՓV;ჯ/D7NǩȑPxPrBƛxڹC ]qXYFДJ%l,1P<$R92Cm =Xyy4޲K>Td!a )EC Ddz.0/%Uk@Tk"&W1|aI7RU>|[6,.[;8KJU@:ޖdg+hí!i).VCc}.lqSzvn'2yUڕd;/V,1FHUoQr|u.'`7m֛OU,$ݐ^{Ҥ=B+RhxNʾoqZzT ٷ74G3h4N %lk1K ˧ִ L{`Dv}1aWc&Py$B$0Fjͣh2 da..Mѻ40,Uٶ<~d+~9u/1+JM@w|?֖k±2˘ձ>jCnWd!ddA7^ME~WXzB१C)*\D5M UVv}Bs_{1_LfUnk+ah7~D5x]gZ=N-4߬V[ȾkԏqWb}v~Uc24?NR-;KT'buƑRlBضp-SW0HT8?ЕugSm78N)}K7e'b݇ *?NS'%]Dx m˟oAp.\𒱠W mBbgՅNs(8 Q+Kf8)7rkIGɔ|T[J4"{l~I%yԮF7r2*X ^nbI9hNBT}>VV6x ]oQv%ӓP>^(nJŘJS=s@`XrF^SOt V{8!eRC9:Q1"P\L:.$TH= u:z \c)tj6,^Tޚdhd/c-N^g URmfpj'!OTmGr/Xѱ3@Z:ޜʰfq\Ta`Dj\n ]=7_ۣ mm:N'N3xxTJoYL3J,7 c g1"!;m9Twn~[evx} yT*Oy6u" @+:՝: % a7N@a< sZ^IMf;iÎEk%h$HI^=%@Ҏ7>ek=\CyՀWFIșH&dߓVmI OI 30KM-OSf;Ea$ism @"S,0ܐ{z>f#ճ3b8s*vNXݨ0i1(.qɔw]o`6m玒5,m yxUdz:PHGM4'wü5lXs\vŠ x) sqwl2~}I+Ū6F-{E_N ->$\:ͺ;Dr%e&Z7v+,xNpW4? ]X_R2$hAh^(X 1ia+q7~~.hy8qKMi VAI@ڝdzN혩<(aZy@Uq rحR6Y` 2![x^Xidw[SfOm\R%oZ\n^&]~激"45+:h Zk)"L,]iR2l8Z&(wq[#fcNN6f^y$.?@'Iܚ<|+^j[Ścׯ񲩶"2{u 3!>*ppAL-q@ (l=an*ͨ}g.]RClAG}Mnz@C~EP _] >%e'+(vfMR{)JD" ϐ 5Ǝ+{E8#$n Nfq\<@[i9hkjM9W r~:"ZzݑmE:g>4Gg\s#J*7=^OBbVsʕr/3}Ƚ" ʌ*3rof3De2t6abuݏi^Htg7hGz})+Bgӡho^߿˳ ŅEϢn)Bn 6ABR^_4n8jq"ͥޒE)H w3gY2Tu9>$3_Yx^+2r+bj{h~"'VDKŽPlqAy]w|E"(R>-D$RSuJvL_ .y}mţD,:&j钋7.hG0hAĮ1ǽNEx; WIJ,i{_otct1!ȩ\ı0T6:-Q<@@ϻ'YbMy/ƕu@vFoaDiJL"Ҝ0YYnC<驝EOA(n覞wCAv[#G2 4_[5JcTV=_U)stD0筈c KkW[HZZ4RZh 砉Ps:~]v7M.{Hn,u_QD^\hj=k^"°lnmTwس?Om~ի!( %|W{jhRN>}CcOJa +۬hзߎ_{>=uRfP^pBAp߮a̡dbNNA2P›cܶi)Zj_XHaO="֬6אޑR|Ejj"V sT=݀UY̺] 66tLis\֫x9!c6>,XEl,lM0$d0 u]21`) aeB;4=7%ᡥg)*L,!`!W1kE@{MOB ^8}@b#q [QenAfȶq?wr{#r _˒4:V~rb|f'sf%Gjmnk'@Xu1ְ1Aw)/4̌ec} u,|\!vabxK: X ND!q'\mD]H׍n{MC Т wdƐDr<|Su7ePz",~zM*75zZC}xa Ï61|"Xxy32X8Y+܆WgcՁLW,+ ega  %/uRܢK33Ժ7޴{:j`9[B4JdKwǘ)Z kW vSEM9VS{VSQ^;S7`c֐Ab̢Z梃.ᨳVҤ^IcŦƥ,1 _m uW_x[(0{㩸NnTJc d2WKAĥIB9&YJO'pk7=EӭSsoמ˞cc-3H0% Wj+{S d*Νč859-.=wlDD9ŹE3{| Nc{rm/[@p7"fNI)hD 5L;łK7YEc VFfJ"`ECOeХg>JRv#Aq5'!]zǺV9Jlq΍ ./|ȑۿdog|ņ?CZuh,7^ iKkiswF"G[/۪.rTU[jg`#,VzlAY/w0ͼZ#Gx0#ƔNJxI+,Q M\;T/ejmQțK%{2[r ߏvY 쁻ZNw"USC,∈:j.ՠ읞U|ފ% d^TTiH8'tٖLwB.!f%\~ژz%Pp>@"v Ϯ5Os6C8b2`pgPPQД6-|.BZTԵ:TD"DŽ Rw)}46ufVi *5;QvDQT^VF_koRc_׍EhDUnRh`=z>ej˵vyȼ<%KNIěU>Y kC\ڒ>ew+s#R{OC3| DdEk;xV E\B n -N~皴b:FIY 7NJ:[0RzIiOlrR3jUǁTiܔnCrq5|u:xd޺0( ziPԛ_?=i~ŇAiOa2\՚w`"GSWFCPl&xjngC^;HDvu){ZX:CuZFIwAyvw꣩ۿڪ!?wW|v %}Hudxhm}LrK$,kiraLOCIASnyZ'ʓ]fWn*@p Sk``bPȾ+_\Sgeg+Q"{u؝JNdooPZ q]0T;,?\"MLQ̧X-By |57jʧd۽O v|WǞx3WE EI8v^u4-p?N_ekّJG=S+~lIQʰ,{amYFz/6CIٯ :vɖK7Iң糠GEגwZ>TO?CwUi\d 3޹F!c4Lr*DgLܞ?3kj~ɶlԤdS#0U6[pwf%_&++Y2ݗ 5hˆ]ᎏ wZ YlvDMSٌ -QıE X"e*tT$ 9ڋwFy~}0WZ )eۉp{7pk?`vHI79PSY$b6'qʑFor&ےc$n0,9 &0ɕq焱0ID0ӨʊLT=ۮYRA-B/ V,ML<)=̹ RUE"+]`S>(z3(al!{8{}tnIU2 xKf<,o/aGS'RdW! KXhbEvTR/ؼ~WlKyŋ' s5K]b}%\(ݢ4.#+yc݃el@hgJNl%R~bbhm3|}?߽]^d/볰 1 dUVE($ .$oWH[2o+,J.8#FI R/>FI\3m (u!:+>|u7%OD^M:~"B R%ܶn?G|E ?7#glbs= h  /"  R :z1<:4 p $"\CWhTca1eL':I8> MepJ-Һ%һySdJ0*ٽ3 GtN |Ƨ#>^[Ӯ{4} SκCBe5tkjЯqgwllg޽sۀm엇 ͽ)8M)5(T5}' :"׊9)^z 79ބ9Ha޼׳-UH xYLhॄ0ja> :m`ץ0gVvKװ <,ҙȓwm yrxT d]_?J@CIEF$_ ,qnqkENv`( ^uxe oTÝ @=_Fcv~O.(\8Ӄ*Wf~ KC=HTs6,M8 1~O0M7Tnܞ]} ^񕦢l;.BM .ӀxVrn9AF]x%@^fՕUge %OS3V!‡oд+C׵&PWcy S>Ģo|'*"g[4fדʂS$U6[!9˺f>U9F v4;әzrۘAZZB5hjkX Zye|E=WTkSTIŎ fĝ7}ȋmhI1k#_q}eSU+aY^pݐJjj$X< s[,*X<߿p_moTg~)ha)?E N\-|Ʊ$I+<23kE 8d]UN2겺p2RݕoH񦬞V;#B{UB7ӯJHRp U(J_&3O.z.Ä8;f- &@i%w(oI5`a~m>vx[먤`䎞 ʰ\0h"Dk0˴cIJrP3ᘃn U0R z9a%%6V%^ o(`Qrb~73Ge{ ?Ta8({.N)` #TNx?ړ:g( Ѯ2GQq!Z6uk`fjmoMFQr]+oO:"X,mMV=/g\#^5- ˧>iv#'UP0w~7?:)ǜ?EtRI#6Vpuag,vcfn 5wOE&Xk"ATsCgɰбew4:z¼N2Uk) +:ˈBArj/o.Q@oQ9ɣw,YB =.i,5$tfVǷtnq,옺/{+7"Y}-\9bqMh5g$;)u|tLN_Rj¥`jqbv[0[~Vw.F ;/ח;?<}}gq܁(VD=M;Ր"9#U=9Ȥ0ZC]mC7FV]ϋ~-2׍%| 0/Qw5Wܵ|D!;@lbt۸*,2WqBP1ĐrT Lܓ~͏VJ{vRl#lՈ`T+753 ul^#z;Ru%ޜ~>_RmoSwoD}(QT8Ҏ_# c"%bdFmb =r^N1d4q"t̤t7rbh$vy WEG4k?`a|$%q @eg֡Ik{ﶓO?ۻN~Koҟ?(W+>oHCYzmjGpAFLs /@YɛfjjŢE)A 9rEݢU+8dOYY/S i 9Qfs4>ɘ#4'^AMɓoW*bX:=b~o2XQS1G*1(thdƂ b8T(ZP370k/eRj%.-'NJt8 T2\ ih5Iq si-#?W(9F=_+Zݝ$^'-'na#AE}VT;zw_A-%嫧CC ]XlKFWV9%dPbX5G?fgkفQz ZN#jf*B$'U92Nsdr6ܦ, hưQ.#f}*)@4@Q#X q>h떶Kw>f"V: `Q ʒmTp>j4^hlն 1(nldYJ9h >a޹+&7J92)jQIzkJ3s Ŷ[9ޚ|3[eY:CdW%~qT:QkT-DKVZըPQkM{3+~ezꗮsv,% lÿ$Ws1_\7' H\7d|{z)r l%qtI ԆRR{R[2IoVc D?՟cfG )բs5S(Qt P ӳlmc-I,*W,JgK4h4Ǘm{xoOuƯ֣!K A _ %'Gu9w]t$pU O|vK"v6=*-u\h򒉁=CF%TbtJ҅ k"KHX!tv((%T;!,h ؕ-EG#-Vt5_bUr`Ъ2,>9,ሩ "̽CI/"0c?X:ΊD1/[*ͻJ}+UMO SQ}[:=SVЍ՗-}@ GKx<]q"8:qcRJ (X_ЭBRfj fըIƺO%m6,[cKh%ܪs8 4rv԰+5Bq}JygQg4|v}Բ^}sd6DKbΠBq\=}ML/OAG>CdJD-x۲%TQ O%RKK8R&3c:f, $HV~kEqU y s`fCA- iFW^ÙA^@:[ .xt~kK, .;#0= QdsBKiM4-Fݍ2GgFtj&0"m"grɑMAԴ[иbX>מ|r ȫfbpYՕZ'.q^jB$mNLKgIN|dJb=fKbC7o{k>: ^F*%|N%H=W9;8ӖmSjW=`N<`1J9 j%l^y;2=<P=wB"HXR*&}-:bü[E/RK-}[R Ê/j HPM L<%`q `3D+"-StרY%~:SD!dv}[!)ٵ5+#^VǍ ]+nUz@&&i<ō0EcME ?ɈVfO??r_OlGPhtб]0γ`.Jm24*Vʄ-ʒ񔏣 75^Fg (n<mQcu}t*fx7_ײ+Jܨp>1휀ŵZ(=n_Wޚ)Y78{w56tD$ oَz! ̵KxG5OZJ? $Ûse M[3V=`@?89lq:`ǫ&l^D=bRt:n^0m= m#*}m4b~ʛ//?K???{^~!]eS/CR;YPq̀9v> 9D Z!K)gk3X5umsɻX2,%wc8|&KJISb猓2yf:6@VH#Q-L Q?-#my$v\9y1`[iFY<7[\C-K͉/eP nD<'3%c(M~PUD\5Kd}RN@d2^LMR 5 >8 -C燓FEv߆4'v5BJO?=}-sqy19[a6q>5`b=-Jם=OrC>^ܜNCDYtҐ/WSTۥO~)^]wt.%yw^¬{G_&A9u-WVVA~C(f&C~>@G[&e_)J&{ ovbOl,p `>.ETW:vkHC!1h_3`g ka8`DB 1UHڹ.Ԥ2dyz99 32a̩дD^/IƅЀC*WY[yp%X gۚFXG]#iDqK[ņO |4RsQT-7RT ^SOi@d]SmE% %pb,El5VX2" k~^J gUCnrԸ}6o-YIE+'350]iPm\jqkh<>LOf)k 30۱Ԫ .SUs!U|62|G1zV2^@y[: fW=U{??Hw4Jgyj4yg %? ՌS74IyFl;fL۲S[*3?rR$=$^|;qN޳SW+?ݛ4BRTNkt9" ᩜ! $]dLCŸ3 ^kR2L)4E1BHתЈ* xvX9djW5]+Tlzk$wVӡ5)v:m@L n `ftˡ)iFQ@- %mȪQ\zP;Vy33S $8);ˋ,Tvv;9N8T xBr\"7h};4IAT{KxB@s 1Шȩ8;a"a x|qUBM?182v/h}dMYd3 !muU 2wjቶV!0j'nNJƘ=AR~E3x CZYDkf3X/QGE!쩐cwC_ǧw[?Oϕr^lMGeԐ"X&!P嶫=sQ[EQg9N,fZEѼ- 6永؛m8/iر`:-ֺaxލ;PM FiQrl U$X֊hA5(Q*xJ&VD[3l[Ǽ")MY2lWyA Xq ua8[ZgIXCvzRnwF0_dKLp(f*o:h?ќ|< >]7 I`]+~n)P?.rT7"6xC:F}v WT̢] 9 tך 6b͘mlVQlaV;Yd'])fWP`qmVkVyBY#?xjsbYb*zo5MBVH6AQ9Ԝ*Jqw#C1PyXFPn ?Bɶ>36:ڶ#-NaLƱ b0w_*F4 %-RzMRV@$~3=st G̢v^}%lz4E#c~jzTȉvYʛ.,U;kjXҍw5HD70%̼5xSX5?M˧wOUYN|"D0$yC JxX'hen`K8(Nb JZJɗa!J~`Xj>J)^.tTw5jd5i]j|y)LX(\hVE Uu /Έ0 fwqar yjwNr4dw\E iox ߜ nV͵ϙׁ247й7kC+9y8IKya~yQnhy%9FDȭઈȱ1'3_:LœJWH+@Wla::-_ArX 54wU:So4a6qFӳdKo744񞝞\\Nw3<2NK/VMU SSoih[FX *k.,48u~*- (1ڕJ GkrS-w_x͝mnnA ]ɷqw 8Vᇧ_.*\iEmxMvHBBӿntd1;9T Ov.cħ3vgk-0ccE zۯ_L}M<jL;ٮϸtV@y{כ\О˰uyF| {2q0?w6.6_o/ /XnP[L >q@>_hW (ck"ac@w`39S qi7Gzq@#L&0Gn9J]KĿ,U˜e[OL Rb+㭎[ҍ'+1K$s$}S7`3Z'[Cfv̢ۛipᏍkKS)72o&p<7S9݂BТ>=T1¡}:ݜvǩJN1 8:}dd8n9Ú!t PRݫ$V_K7 h[C}=۾7.{Vl{ڨ%VuCoYٍtlYS24Mbn~~6ŖSGz|3DGbxT$kϕ&i ĺ6| nx?D +u}%Z&gS-L [97Q_<@)jQGhԙl`"5ڐN"|x+j3w0X 3$Lg7bَAY+e'~5ڽ8l)S>")x۴nUFVS xG>Z1ׅZG h>YޛSþjw6/бa]&}Si G?ڷfR3ca}le`3 ;>,88`ed%WZ co_d$*{50Ǘof{TUItƑni`Ykzx:I m[΀[hR墍kC/5U(%@ng .:M% Ux㖦}}|Eｄ$ydp6AbP΁2\(LyLҍAsU㸙5cC1ut'2B#5 -$`5JrҰн# ;%gE-e"Lˤj$5Ch4؃HB^ {V4nY<)y;=nMC86WHT^턞o x3cUgʌܲ鴏^Z~క mBȱ T\!0#Vg}3f3D9M9aۥ 1Uܖ6Y{7fSx?Rbԝ4E׶1 H1 n G.(Mb) 7vIQNm C,. Jo|,F䅢Ȝ FdRVn_$"L 84Pik);}?簓9,FRIU^( 5O *NŹR='n+ -7uҾIlW`9= ZbpMT.ພlFO䗂¦ %M=~Vr4iiQ비NZP>8#1URĘ>ƆsvAM@haNu)`# 7Md}(<[߃AĶgvXy0?, uMilX6m>/]XNXe9)s׾8ފ [FVm#pSO32XVqkm$9KxkvX~r?}ZL5/K{ٯX{y)ųC|ق$ݳx RUsP[Â9*%аF8^bib6>zgW\mxoZ©U9WitƨzØ#E٩~okfđЛωi|a*3l Lp[Cy]Ow]( 穡'oLtSeER\TN Om/qf }C`s~3;h`Aa)s)-h:IZm aa@mKz?Mxq}SܿNWgsj,9(؃LapvUEA^$kAcIHtvbZ\cC#9a(h|+imBK,hԊ o?03ήbsyfW)m+^,bqH93G;'huOd nszy[5#@0Sp[Us p`3%*IiTX}>|Lgtcr lVJ~?=~|x/'3'V\|apY!;)\A ]5ch&Kla|mx5w<s]ʄ7ݗ[񸸺ZmYlu=gև=؞5%#zZk2X735F0s6†0MUYwHTٖ*k% ˦`c"䐽PT6yṋ̃b]%>λVre\ kJKE;Gh1aDA Q%5[8[yÕwDw2XAJH=_.&k0H#?x ^7}.U1Ue١] ]gELL'[:Gq&ѡ~W^YC3d;!$G crZ,M"hgUrof(KFuab/Xj%q;4@"#3Ba͵Sunѡ^6Eg6@_ 5'Ti۶X M1Mq/)aKH,}\J_%.VWp٧h^Ak]uLwy2|1^a' #F|K7;'lNfYQ'z8rWjܑ2aV"4m_DzьamC mEj{7dWDn=WԸ5=7H:(2>=dτSw?5O~: vݡ ֢_sUJˈ"d%e[ET1N7WD"D)l"K sKSܬ?-M]X~t"ʌ-?}ju;Ƥ4E*a[jQ2gxhc]9~z[zlkL&P.Zfdڰ_ln+OQ.Fۈ^[Z=D/s bpCr$hRpir_n}GhCZp@m;i+9r$$g޾Oƕ*B!!^ Up\俯Y[Ӫ/[cq e5&Y{ɵT$rׁHp{ʆe1;*@+cꪡ䶵ꇍW'dcƌT1KU8dj 5˛RViG//=HqV2<0yJ(A)EYgrp71kp.`0Mɧ_ڼvAږH[!] iw(n_"-Iwn+y#CӒk[yS%\HkۜUμ)<廈y}s/%7 "D X>w%~Y[' (mj4B3E@źYgҬݤR-&fjU|sGQ1ŃSCuąX3'_ϻ?m_eQnr[uCj@FxQܝ QD:"x0 &%w- X)5Y%弢M9gԕϻ:qƛ CpW#${9b/WW#Kfԍ [iB̴cHY X3ojVF* ^C<ђ!Q̬zv^qt(+ugsOP~y~zOZ!y#zC:Oq2"uvtdFK+ J ၚo,owϳN%6S(rF- !LN1?I8"! hex]Go-t"71Cp4j6^[QUkP9"\>A"em]-@`0'VC  iUNj@XCVȊj9Vt+kA;ʜn8\`krpq4lh,_x _+N{}mӀݶɠx,m]f$Jkocgw??߾}[uj|hyCؐHPpJx# RMyc۵Z:~ba|OŴ>&V1(prդ[۪5wUԵP!@ޝy|ȿιv7 -^@ oӸ&HŪ"a9Eaf O}Ͷ@>V2+Bnƭ,][[vsk^3"9a Wmh4>=}/Lx(q.(^3-^/` 6"`,M_ϓ[5TµR '=N3Uh4(±݆ةL4BO m^/f,  E;%xZ澩9H`p/9 `l!~h^5"lKC{) U?I]f~dQ)a*vB+|܊M#Lpwƀb%tG 'wFgM|=įux_Ru7? C\ }+p(M걖i8?ňptr[s0ɆqVX+MUhG*1ɵ2_5S${&$ PI20S5C-U%<4Sou왚9.):y#Ҹ!({cӫo.ZtǀԫBw @;:- nP/۸W u0%6b֣}a7\ EoVO'}kClh׹rԥ6ɦnO!Gmy'Z:E; nݤ@] gλ^'z[X@Mwo_54$m `+x7~sbgJcG-}jfkٛawf-2f|z 8H976{ӯt8.y¶5^na u mW6ۯ!nTnbY8b[_$7 I(c38爩9mIdq pZ,G߈ɷ[@KWn+Ll+kt2o`gN - /Jҗۯ̶B@((C`4jtv,7Q`|iqƶ$U|Wd^FV~hL0ML#|mAmKVIpΖ48/.w7J S2y+T%OHB4DaihexkRIT_ , EOY+z1淮ob̹) zU(k;MWgY12>UERnb[`#gCt[mqK4.{YD.nZQfVVɈs,%-7 . `ʎnRu.ebץ\"y"\k1崕 t^Luicg!ǮEռ<%"~Â>1ϊYJ@w?vA 9e[rDyvn^"RK|DF=HXFW7;5khy4żrw\Ds'~z7 vַ|CYp-GF\ЫU~gAD]-rA%t~aFWW",M0$fV=PvdY [D U/X^0}O叟wy3): jЂ M+o:jmŔ='>wɛ?{5'揿b}t9Ϣ*昦}OuLCyivyG%AP2υn)I&"ذg9Vli7Mr/G—0ﶄxmGLYO=N46NFy!-IEEťn\0d:s33oP@-rRG*nLBt$M~k_ p38eN~b}=%&=]db|&f^קˍjXTZUbb`բH6_Gtx]ucK3v& mLIb[fi'?J+HT mdMӧ["/"E~*gVfB_r¥"mA,|}NB@NZl2ҡ'Yqu|)'??ˋ**]4w{L;F bȫQY4"ئoͫ^fZRˡMJqoWOQ} }R捻hZ^:TtHo]jkUB [Gk F} F rD<6zH1cЍv^r3X@-=T*)x  [t5!zSg]S[.[޶nذ[vYdYm }K߲~oi1nxɜ1y#ZSeSg}Q 9؞ž[ƅn+!ZVKI;/9n[Ö,? WIelJD i$SVmY+]WP^i)fhV| ߰/q1K3^R)."`Q7//\QON0tDhTxi2҆Zr{dFzIGٶSHX֐\ކcH-XpRRXiykꆄHv#~2M47s!Z^rCRK0o%Z2Su pMs#yl??w׍>&{CRge(ڣ_N2(ńQf%;Bƫű^1;pxAl {hƼzL!+ANl)x^u!7gG>#[ jPP{}w퐚*Ӟ i^ϢqPWܞ C,zV.DKi iJ[ߪ6#Y'G&6?$l.zT#zǙjNQK(~[2GĝbEݙ>gٴ}KC &7`Վ//FQb&(k'LGJ#ŌKFFJb'CiK9G{moluq`J|vΊ8rݻzVPS2s޾B:)=xZyyZٷn|h}Cvպt! iL\PP^x5Tgi%UTз^0ilHOL"V@{b)6bJ3$!0C0vEIp>$HfIAɨ4 j$5&fK G$Q~ށ6%٪JA?nXp[$3DWwFSƋd}fgIXѮG]T$v`:T`p3x븭7瞺͘F"yj·̩3 P^n"C ve+ANX̬EvÙ5̮|,W?~KD]oRwd&z:I[2!$Oc;OA̓qw #XpL[6`jouʡbSAPrk˘H/D"tcU ;i\-tWJme֊ǜumRtR02ήfnWB],٠pAOΌճj\q[;Ss괥S+K{'Y&m TL>ˋ5X s{V~x-((~geyEdSJlFB??=?)}>'9~}\4\wPg>-G QAsPV_t|^j#< alml!Vs9ֹ,{5 m)\ҸRW ^>/=Qo{6i޲rxaҹml̊_quf>[1л]"7]{ȇ/&!0'RCt3(sj|!GO`3 F7JN;f]qh#Єp[MeۿMopAïv)Dx\"V"AzSYxλ[;i{$ 3`6[ wT7]rl)l0nxٸВd-3QwMl9ղmTI j5RPg2L;Ž=sJ#- Y~ԅP4@",oj ikg E~0!=C(Lp{] j)Z]<멤(jjk^Յ{* MtǼ)'O\=&ih>^&]qђE'ˍ+1 VhXp^UKweOOdvQW-8"acN__SRww"vx!<{?\wǒIcS0u dďI䰮5bE@aexzz sf6|- LAMr { k)/{iv)4!23_ `j z0dxzYBX*7wwD~pM^ֳ۞IJ-̽yg Ee\#.DjŶ˓!vv1;-n@$f".,u4yqW.dҸ7!h35C _=?[Ph0ܦXxΒ-Xx%$d jqdžϮҵ&8p`YSajK}8hv-:q*9Vf,[1MiE-:S`70FYz6`5 25Wrj8c%+UM3Ϯb=n(P3v278P9DVG؜#6j3jPآ!8>?vBf^键3sc f60otxaꆋK5V䶚ZIG X_CZ<=??'yNűWoӗ1{JWZQ@uETn "16P O&;S6ɝݟAS:|_+`Y4+-G*m$ ||xzh絪dvv 5辶!"TlF-29lV6/:+ ^} d}V<8׎Sg)hAWl4`3-C+|fP^F$e^S!Hz-'X'qu!,(w# ѵvRX&'6)8+imkz-C1;b*lȿr.B=~|5mE4eA2 -EwmkuXmڙ:K86q-t 0/bfoV.[4]*o躽n{^$wPӶ* >Օ)6\Vr`z^9b( ?fgb2E$&[P:S| Ubz|k6Th][ٖêt݋R(6A|ov ]`i{ gv@ia$byRYԽN1ejc?Ӑ)qP`~iR{k;q޳Xuxx]9:~)C_ù7{"h"vtꈓ@ޒ M02;gx^[13&nVCIϧcUԽK;kvfS+#u& 8"w-ij3GOQϺe@彰b.k l.^:G|A90-{C3q)uP6F1zm Iyv ]@J)a j{X g`_K> m>D`kΰsWزM;U*83_qwbe܏26AM{nH >7A-Wp:PUzv6~B3ᔮI,Mg9n`Y,xʢڶ${}px"s>D{ӨJ٪k;#V݌޺|?YI*9THn7)- ʺClIX @M4j/7y%o}਒8-rx94n@pRse ؝]gAcC然眀*Ikt 3,(3t$I@M++82t,Qo|_߼UӁ X"ZeVa q. E ;XY]ǔc~p1g/3&!]&S Nsfޯ4N/x8QۨJE.IPXS.յVwv6'^7s,JENꀡ6|+Iע]Ea$8\IW"8rl0t;Nbr($FK2IPh_ C˻ /Zfh+J&-,KUswJ=_|0_wJi@M\&Z0>Hey@Bs_N!c?'2Q`+;w۽X^ SGcjQLLc[s2np36w?}g o!Pe }N0"|@ SD L״Vp^Ew7r08|5O9/xzn?SMڷPDKS!O;򙗙h(sn .(;5U*;&՚X%HuVGu0죦n|UtEԌKJuπp𸭭c)PQ3XY*5.՛xњwFWk Pj|, 7f _2vO`_DN:Eڂɶbb"R2 & 1ZsYp_[Sl\XSKH8ocF^з9r<1s摨6ZD4­ .;5~\~}F탍^9Vj$}v\/V~oSpZ7nO:CoJ"t@υ1sl/'!Itؒ*dtkmPP7LTӨnAf7>F=*̴N/HP2Dm߁м+*d+PEbH445 ltVRaȈmGXͬ.-F6&i'H*OuO5+|{"vT=gɕsl{y`DMe]7MXt==?NDfL7^- ){ ·.4JFe/_m]^]81 JZ+]^`@"J#.?@mv5L? :ͬNdZEۀ@p;.`gh9Df(Z15 ">\0tGa#! ({;>0WK>riPKKM"V) ~Hkg"kP23pȁ3ꟜMz+o(e`.檖0۸dxh_֔I #`@RuʁxE,f[ܒT_w*~{YI]CBAt ċ?T2IU-B@-bbR1;ji[ax|=KkYf965/VPBH5HP[(Wd\׊ #Z4RFCmI8 мв-,XW-)A]= h#z\inH,I!}U5}|I'իn"7G9IR8Zr1n8n2ã?(O?ܿOBן/٦I^x=/k|yY:zf3cry6Q,EW) y`=Q5V8~f:pN]qZNd }TySAı29Vq5#br.@~w ;>K7/JΏpb^Qz.-wBxMY @ͭJV0 d`ũRZҰTta oQSYU-j{n9KZˇ#ݺR8O[. WCgO݋j.Ks4u -"\ 0lQj~a}F'߆P ʼbg'N;m+$ש!Y'鮡/ӊœz9hؼ6EC!mGk]aV3 :lj,C$ywoSXȮo8#L"UCA}ϕ^]SMb_Ylh7ӽͳTʬ;6'X%X?,!p]-sc6p_CXeEvIdGJi'XW~X^&g6-+^VP mD;\j`sQ4gX>Wdۚ]ϵ$-ZM.NOҟv>#.`AE+ܑ=zJacVZ뼁rκ ACs<%@9.H984 )<`ne ݶp5@g:4? 6a7H1+Q0֬ZѾ9狶IXwUP , ֆ(UJ`Ɩaz| sx|D9#Z/ָhT^ PG8?\ u3ŌT~`xPs{hut R4nA#:TpPWmL$%j z[NT>?__&~z}țo)./PF'tp/bp *5&?,$ngҥ~ D{+, k\ruaը.8Ky/p=5RTr opgvܶh1U&ZW5WS+:g;S:|HJgtN5K+D-U&iSZwc e>l\@m~ k,sjI=qZ^ns8A(؀haKxŶm7Q w*6cuywas~SChljrc(TO?~͞~,_y3k#qQm ;@U ٣sSۃqL^Y=H'w `jiF{)2hYpecE"nsM[WFqn@Y,6K!$8[ƈ"#FULokO:~oGmM>nZ|@VZq{{Lk[ ) .wI)xn R%:>,n?w,25eP)]S1؞P,ܠ=wޠ $Dz~JP gͱXHwDI9}>ͮ(sn+憤f,#QK05љuB@k7Tp[oy@&^H<<[U4)l/d)urX+|2߇F]Ϥoi *i-E/6˷q_'i r!{ 1ܑ#/1gƎmxJqhW+4FRcWP2/n X#>^Q_Cv"0/<(~Kl=2)m %ou? ahA ƒv+kAR7A$N o#:I9c[$GLO ڡV&DĴ@1]~݄u)jnqb+#U&4O$GvΝK_] q_XI] M~Mjii(ON<( m 7!9It XY< vn 'u=B (٢ 7NzޯUcA].ZcI}耝bGizJ]^,r5Tj ۗJdQ -cq+nECжYcU>ŪH>6>F_v89]D|֫ʅ, 4s{ҽ08XPSÂ6Sq[s-4BUWx8UNb!V7>祝=a&=ZL8PNEMF.(8;GʾXN/-|VLWAME鎯rU495cE>n+9,q'O04c: \=KkOP뜏u~ UO4 !voƛP][;cÊl r1_f<\Tw(g _kf$b=ʲ(˗w?Lpi4<(- ({KUbu8 9ˑ[0o*-h!ЅR T'~ ǎ2M`Zvc$;i|gbbQM +,"$<QG){i*)2sB/mmPiffe'[`8-J- QkIS1Nb%&a1Y'm9 rv{? '.kJρd6^,N $vF&WOԖ7 l\0̠6 cUpsF`k˗l8'pm̀ \Ɇw8D4z_]2)_GZo~| E-}u—7t͖| ,OL+ۉuTItkwg|~-++(֑|}vNp Ta~F oXc/5Aإ.z,||qa=Nަ>;HZo%׏oWcJ~-$N`la HsI/δi\A% 4.;O# úP /,<Vleg)~ gSWWJC KGTM]\I*#:Q=&$lHfpcDWo ̙/㏐G=C }`Qj5M{튞dlnKx^0`q+$η^+%);:^eﴕ?~ruVЧoyN ]O'6o QO^'>>MsWV܂,o[x һ>N_PuY1V68n~mD8KazVԂX5ms!JZq9U~6&۔7lrw_~R#vwpk]$bϠoGP‰q 7||u-cu8z7,/ 6ʖ2Bd2 7 yfv M%{Isg7N~/~Y}t7g-$a=%ܭY,l{LS2wbFmJTF0.@^cT. 赥}=[-E)r2@~ []xyPkM\+EޑYu{7'[*?9d$/ܛ܆WZ}ɜaw .qn j^qBEiWD~g$piKWBW6_Ch,[ą hhzP,=(W64I٭X;/M/vV-2+ևL!:E5\9ΓJ>jwEB8TDw:EU8rl<18K.5|EH.i-RFЦ u`=eUnĨ#8౷N9dgXO0QQRy'SC[X{wmv趈-H֬'EG3ف PGB>jp`\.-50h(R.^WDP%l4 \1Bqd3SP/L&bkWح n`0 :ʁni!s{uu?͌E)%n?)` [y֥dp0ϮQl5f*=MH-5qC6a#D&vp~z~ݯHzS '$јͼ%!%Jȝg! o dg4K:si mnՀ8A`ƞ]gBݢ V1:i >B%5Frrk9#1U;K])%WMz{ہP[tTs uAg02tIMO}5!o7 _-+Mu#󍠆Om( \LAg7Tv6`V5FZomŜc@&<×,(0iɻ3<4e|svǛS#?IR8~4|h$ Ee+C>hk*P]Zbxx4i;Z}d*Fl>vZVZ-.r\Ẍ́:Qgm] < d:0^2/$5hK\ʽ-֝\ܿWL>~헶MI!?t>W~_绫-ySww3ȐFW &/lۀSK&#>53rmOE0 n}㥀~6RcO&M տPaqE`t ڭIZw,S?HyD7-hvL +ˊvn44sFkg$5L캲q xˢl:P̤nxfGrvtk!Fq8DOt`"t W9ɔ(Bq櫫@GU5$FOa03e8]#E6E;U$uCKjӔθE@5A.7jո8hPhtz![Z0k1s ^kʦE\XנɌ8x?Ϗ: ɆÇ𨢳K:)1}gmD%Go`N/$5 9/tMS݁EI jУ:RG% 9^8u[YZGQRބ80%^c9尿2SKOo:dGIdDeheLeƊAQ)p!遢ĢH\ſF!lwvwFBϧ/7_5[|Po; ^>B A\l#KpA]5qR=h"k!(-*m״A ^ai){]LฬpQ!ks1RN@ZKT?ܷ'f9մp+vMi<ȋo Wmy4/+W~δ%#>UB-Ieo&d-:\ljY_=o ś-3|I?Xn&K)4'3ZEE=n*jq6FJ3h˒+4pJ~(d_8 .߃wo@Ů@,;A\/Wy@c_r߿MҲ= F<6BSR)Cҹy:F6`gyz?_˗/㱋.ԋx>]ok)ȉye V6Q{ :##|o\$PL~zVn\ęp[[L֑LӠ#ji價.룴7s+8:e+ӞH#X6Y}Y2?݌l.If63E*C^x>&V+Py" aq(ӝ#OF.B=M JRn$F{:}TY%ӥ48i1a3>=? 㴏"R{(ЊUg\+ \W C@Sޚ6}თ%`E>vH+$YM#;Sp{:D`Ӣz YxNv\S8CCxo8w(l[jzsC*Dr,!*[ }+@ # c`{nּ MΝf(5EHD7}|Nohc0(sJxy= 1uU_lh"i'[Py)̕.C$P=pSkL=g搩eZ1D:BgJfNE|+zWhĖ쇒ϳRPE ݻ_ʤ%?1Q`*sbS_:u#9ͱSf7j9*V$C{#z;eA2V&p6eBr_'a[m17/>VѩĨPfR@dU›lMB>EspǍ67D.c3wϤw &vmRveZN* ,fm ?kfm {&u:}8&toAlGۑq. V6-4V8s{龾-pԄV4Wuv xoP$d8l._|۶+qDc(P,6A/]Z7\& єTҝ':xKyV)[.c,'q JQfKL7my4+G-|Ԉ/Z87rpS:Hwz0"Vr;8E҄E93F:`F|';COZP!UlM<$ib"S T.#G__ 6%3h!!zދ6k]+6ๆp(g X8$=R1Ucwruq0Ibtrw@s +:OFiһjٚQUk7TI?i D5vUd ~[][ec*}e~oYb}g鮐A kdq C f儞9I؛P:2v'$[P2"byb< &k'V0]`0yMV _k DߣX?>U/>իkVz`ʆ I  +:Sz*X*|RcSJ7ı7qACCO0Trm5Ӂ 8n |%I#ꌋSgL߾n"m(\PR o4\y%֔Ekw|.NbיfvȜ"<:n`QqlMOOyT3N}r b9E(LH!(..fE,83羯w5 h,Y_jlS 9nc tsq%v_,>aj?'D/jɄGsȥ:QK]V$J NNl\s2,d"P5eah-B[Ɠ,%}ǨS,XdY|ۤӔe_uWVz[mXsl YTf ÍyRWirлß sRcOM,^xPZdv!$SMXYzڦ%s<>_0  ݌x*oVI>rFߘ *e_ i(wh2EA-s\o؛Kw",f(O'0-Ta}6;sMiC˟fskWB/g6vrN9ق0lp˥FMeTH3]~{3<]?wtΦ!ZP%ɶw!β=kLPO%)l =#E lHQI=92sW:+MhI]-HdXiY;(+ƌ A|q`9Vqj rMF[$u \O&|{b; \ar dC9Â4l'n#ڮuS0]tzKt@-93OL\rؚ+4LY{BkY<+瑈ĭ6Y z~i2EXFW~c1_1.z/\-r9m|^PH&ӐbJZ҄Ĭ˷6,v G-oTFx9J+ڰKsB ;ǁWōpHaDSMɆ*f@].MrI!倱:{6U35{iT8ӗO>[3yV)f ]`AXM.Յ-?0 E/LD,C)837̼POuETo$fi9 b!b7ښ`푡rn JiimA [{#wyi]')oO,4#堂86Yɍi̻ˋe?χ= tBwP"x ~g߰M9sa+(,pӉ8]n K䀲%DfBS#ԍϰfZfd;:Qr"?e֜5˒ ۃX'~,`5s\*rW$S9_1t9N{Tit5=%l ||I0r2!NVlڒFKlT bev^Qv4Od)Xdi DVYSeL#4k]ЀRXTbVUpHMI!]+J g9P3O7Xn9S{/]" #mYksEJC"‰ac8 y xͣ>Y=/ o^`n'-h!ecpuvTA ~{E|&!^Lߴ{N>KcXqjvEpm1X]nċ>wYDsoI壧c'5Vdp}(qi}֥PT!3% , 5tZ =0b]Aj]ћ@74WE' L{ )1Ek7b9}-OV5׫ѡ)ZPuvKm_[2V88;v|Uss|a}G"%>Dnb cVVz1+ov$20eIf|$]a_M<^~>3.aG_͈^kH_f7:PيЩ1J_4$O`Lr%.>"_\Y?X\_h~Bm KFakhV6"dkXmXDJIvIhi/ڝ%8}i#? ڮ(]h|5se>ek'D\g:n:_+2ˍmMSSPJ,R*׫7kmϯNt 2"t ˍ`X*{V`fy cC||b趑޺r꠮wV9bTA;_qg]k7[b$֑"iNz}ص (혍K?w֕&a*T|:J?˺12Ri)hH7`U0c,!d7(zM09;[U+S Zְ,X@i(v^bhhڎeUT?t߻p+us](wJaI. ErE@ȮawHJJ^Ye-a!%zy }ۍBVR&PĨ7 @D{w!9`ڳ]zNoipka_`ù-VoX=q4O;9f`~˄ZTtMJV,]ĕn+6B ȵ\D if2)J]D^ǂH":AdqFȤbq^իr|6@cDkԔ:$ \hۏl @̖R16ľX |BJE_>-n6$/ez@vGqA9(}gy_mxo,~"j_Ÿ@2!3 ;UN8弓 #d`uARgS6fO=Da%;נʸI(Vy_ ަV.^E;ֵA\Ⴝ5f~y&+}&{{Q1t4Pp(w͞h ^v XqaRL\ggq?[=h4,M aSqFZW§f 龺<$SF$$"%[Q5AFr18c V8Bt-t󍝽k}?Ð*g F|#Vj/w%ӏ_oy GfwXͱ&dൂк݊i8n &L=g zwk^}{9tL $vn?fu&QLDB)+ߒ3ԋ*T|Cr KNمg j^<'.*}&}5ؿ nwoG((x<5 *? ﺭn)C.t\,=3)DРn Gcn{0փ?`jL4آ ʞz*ў0]#27G SQdսfIgb?mw]0r6Hz8{zDOؖ˫AlXV~ (35 j4 ʊ0.?%]U`u јZ3>S(vKL^%{ Ubh#~ H`a$=z]tleϓO?0Ǔ۞>}XَRHw`n8bhZr~.!T,S@qcOĩ|Vf8ɞKmgAti Lk `i ?!ό 'mEk(BEo9a'҄XӕN=QY=傭3=i!"d2+o.ՉVy@ic.RmԄss?64HXV7@y8f{gY<%!p$nנQ;;6-il.otJ$!XJd50'i4clӐ ѩޚh`R'X/[q K'vW[?}8edJmo5VCr>O^4L!6p3 汬dˆ~,HKW֣zd3\ '2YՃstFg9m<)V^;$6DF߻\^<=mqZ=_ټ㕞2}JB7`c^࿳:a8h8_6IDz~z|R?~KxSf;u4xw#FjV˹$֨ R`[LFq|8EP4~UrA?{mE>Db+[`ʼ#$SD]pO :6ST]$5,|ʈ^`U3s.M|||Jq͟E_;e~{SAXtb)/¸&V⋹ΰ]߶c(^Pmp7\ԆIpJ̖p;"" x<<}K':ݥ֧ܪË'CFýof#R]1 ^rvt 83AV=N}[Ɵ ~s*&SR=7H$5#9F=X!pٝiВqc*ZKtjI7YD7G T' A󶤛|$LTJ$0Pe.NgŮgAMC^&Mp Rr 4TcVl7eĊf.X3O:Z>a =Hq芻$%py-z)K2{;_puw*vЪgvV|QU#5j`LKuA&},I#_aXƾĝmN*UϘ bŠ SoP;R~jt5cb&(w!N̘PI"pvg{; ,Du_uME.0rfTK@$b.r&c̫"ZHmIGГy+إR::V>~ӟ&&=|9oSǏi}X&k߻Kv99!Bo._>>o?dQazS^' V'UPI3Dz2m܎3?N03 ۝9*hE!6 j +(c)F鴼bdzu\8L;pr4 d 66\y$"髶(89\VYdB)VB瞣#n\U6̦4p}A 5.͏3 ŕ2\>jK~b,-3*gslRReVS{$ƼH5u<3D*jGمUeK# ~Zxkt@Q3rnUu|tVoʖ"- rF,VgF*@o~L<;Q:gv[u(:6Tk4&&ZƁ^dVVK 2JU'r9!'ix%f3փğm:.qAC4 lMrd5TIxvSfxc*'Ye; Vm?Chgo :siy|傦\MXW^ .oǰeMKr:bF\+ tM^6bMeSa 1s!rND  LA_l9%$<`a E3&$!r xߴ^}#x̺z gjȴl{Ab$xlv7ߦGcvj1h_򜖺W젇 b:U$L4e ztf!# 0+H˗B*RfH $8imzà4?3`+&@͊5Z\^@ S #51+ݒ +ɮp&x6Qc@uȺ1}gu)lMF]duWp`{g,˦!Mïm10YzUX%~`]T2RGUj-i˳y7Ǡ,mdׇ뷍m_)vӠm-C$ 4nj;õ?Eo4G- Ds"B1 #܆2ccCJZ3wkgqM[5c_pߝ`l5 ƶ}({bmt븍#HKNkHMF۹3}bum{n,D޲37msh`-Az@sGM+O)] 4bPB|XV$]cYf=tu9bsٍlô 4/;H$[xk<㚾MR84,dqy<*Y[6q`筣zR/T,&>$8.;BR[yBh/<=@R1xx1ԾU.DSX*ԉ^fϢkW¬m) =wllC/Z!50CWV0!1p gdXqNߟlgq4}xF*fB{DžNI Zc1s`|vMDTHk#hnQ~gb^9wO8AXTƬl>~;_Ӄ=ȇ$=O:!g|-q`{먮Rcp̏ hMlj[ ?Zw+& vX>",)fa4̳kZ k;}"rkl6i+)JÖ5 t{單1icms2:a<yQxkK*ۊ[CzGE;+6̧ڔʚK)Mxpy+i`iTZ>?ytLׇ%t܃t'ǡ׸|Z}מ<}Z9(4,&>=`-7#5K'P|eKlq j͈xh?/rY6c zlQ+4:2zQ'1`NRC+e0\%ۅL$e&k6t}|_?ƾ=H$ e8"{4?Vܹ!~e~Pycӹ>^)M֜/wd:D/QH>1Y/̙6ћCﾕY94nІ,qv!;Duitܟ 0'],1AqBL}j0Sݖc 2C4U~h)$Ƌhk+o5QþsN>IwgG3F::TCMfa&5U8EVT]'Yj;lDxDJpid2y~SQ>?N>Ǽp,jq:qe ޶ 7|( AoH%~T5RF٪XP)#|Y&TVkso#~Ϗ ͭ!.ޜ%fT7w>~s` w ⻥LGnSؙac2R4]2˻vWMu޷kmԻjƾQjsXnh#Y)ubOmpUj- :CN\ivCax ʺضpQON-`9ACI*'J&^9NrG˱11Sabb4=Yst21Y} Y3@pl+[-JvBb؇?3A-9!YwysQFw~_ >Pᰭ9ZZok\j 6'N:;;J,ҮZo6fUufj2m4;VN]P.$~n+H8)a'fI{"㽉cQoO,OZi0cRg ̷~6g A;q0$AjK6J|Aڮʡ)ؤ^׭ļ젌p=?.N@dy:n&g6sCE SG%#ek1Оv/AD lHK" C1mlB؇`aB{֯)[qγǥv`W4 %]hl^@Fi}k榅qt2R;l`e񌷜j[W3BpM\|p/Nh:]5UOuaa%/";GV.`Vֿ2T f#ji1(Q7)`yk W}3CDln*31NjlA+RGZhPmK5̵+N`\52uy䤲Haxlt)y ՜~\`ne92ćCSO>L-~GA k|&UH%k>=K sX$l.O՚|YX5Zb[W/X_W􄔦e*5@CE9pj!@ù~Κpy}+OHVq{& JM!qdEAzuH _xܻk)m''(vaae>pȞp! XߚP}A+hf7Vb .h\ғw3HoC`j4;rc|nSmb2O33hWY ܌k=SS|;NRNnyi@-vo-D`ux;Oȡ}R6+58ܡ x=Jˉ̋AIUGq=w6B2UfL'ߨZJVg f:XČT)DKM@Q/^ڑrB.>Vb8z Xu 3\VR^AΞWַf#>,Ogb_|Jw$SeI=(/',yE/Nm+6Ht*mb3 Ԭ-hCb럾fWmn1Uc٢CopIG#ȧ>en`VVĠ&,3(wY:dL8ZOb95v,|J4Wz@:<`US36 Ry(M3K٧R-at}*&* *692e(ےky.Ce/Hڱ;C%QslϫA29&P%yotnGaD[Fᾍh6| y1EE0RQxv6(Fj]pۨ격ĘY4]D$A xA֒6anԅycI4TZI6QP46q |`dq$8h)wu]k̑&2ln-(Y&(Sn̪p5=~V<רs`SڳDܬXa'GpZpf @r:k0)"7X:m>z$,H sX9}K$X,0.!i)Pr2Rds$i f><<=^.0('~i u$BB%GJnQvZAmT𸤀`nf+EV2g~DԚ {1n )"?y|g;}U@;G3 d+[YdsgRI; H +4-\@_#J4oђ\e}Y[TרP'iUJ,b%A劵D1vq;O>BjZw _j2(;fΫElDAdlMy>5/?[tj}f*mv̍f+bR ?Ŭ5̔M;J\̼&QK6 h$2d[ ®谴sTLw3m2"#朮҆wiH<)7",ۑ\ˊ4 yn vg240%M(FrR*!+ G.]AxHk}6AZ% Y45"$Set7W1qDv[ָUqonJЉ } +\vv.&i('~ޢMTZ&.L 0K>T#IT JHE)"Cb);(iR2zp)ګ@'9YOu}_mg,u FQ=a_c2'Gj)[DU;v fl(SrPd0>]꥿f_HYl!s)j-[GI$E8zٌWjpj/bcpX H~P!Es}<0ȘsJ{(̖#AЩY PhG`cm ֫V_g$pG 8?qǃL)K@Ex /:"T#6v`%-}=R?`i+Tj Iw2e=x0KTe^:w aG {"3|*7U0/ce#`(E5o8;qfO P;NJ|mv?mafm(-,*MgZj!ë TW7ky Eh [N9,[wyA Au_szbg۷CՊ!-)EdAN 1afJό={"g4c-}LMoL1dM+>}sLJH0OeOz&0(i*Ng6 K. 0s9wD*Gh\iI-Ť0?|ʇ AhQn9+q=`N;r~+Κa[sU.dxô 4xϹ .*ZJ28U' DPy Lm] HIBъKQosy6K W+) oũQe!i20f4Lcc h16Wrp>W{I[&O(&ol9 8(êGvn~I,|jG#`* F`8 ͕K4$?ԧKll lce* =.!Q,5]&RɈX]ź_-rIjv>+6$SzTAR{L$Z|9iwd-ֻ?ieU%iƛ^ibe`Fʺ3OEjyHBCQ͖zS A ֩7AWƹ :Kx#:=e(.&{e;uTlM%⨧X%)嵒XUT%-’Ԛ 1(z  ̥9M> H͢0tO5BNN::-TEoZSc (US-$A.^NJƩ[j+Ȧ&I==OSQ{GCL76%1fDYP6EP@!/Fۙy|v&s<3nUb|Gf(V" JaNz[z~!JrX2k^∣ӞfԼ|:e_D78|gO?|ݿa I`Wɚ+!H1jw m.dAz [K[kGGhT0D2+5K1XU).$=[`Z:(ki@'QNg9%̸'5K;VȶΏU- F=;?܈ų_ .Y9unGZeLmٰUd_34eG>fyacj"o&?Oi0т$!.9Lnσʶr%]$3 䐔_I=TYQu@ӎ56l#]Ҡ젝e++V-ӣZXF}CqʤTz R5vlh|K[O)ިpSD@9T `⛺("m Vpm( |/SF{i) ۲V,]5nE8 +WYO-_ a(ar)$ݵ] J-Ma40&`^4&ըh>$A3XƢQmZ X1o)%ZR:4s70SclT'[ J*@֪7wp@r:>%h]W3YlYIA6(7LJ3R1?7-*:zSzѩҚ2(n|>6Pü*DvÎ{ߗ巺U2~>[(wXodW1=L$BX5}Qq׍lߨ)S.mN+hBGJ:k5wiشTjTBBز;7VBM;K qʽԕ2P5R8 l^/Pq;aC t۵HzЏgp}+dGT ɗa$h>}SxoU UsNcc1-BώYJ{&9U;]ѶrO*Em}1ek=#3S:$tأ D|l9SbˎD1uOj!P߃vV4dv.G=DcToo*Pf*$f,fvwJz$y%9_ "v6zV혶QLQ#|LT X9ڗt7 $d?DzYFmk>8=.92BN?gZT섹a:UQè0bh6V~4 R1Ģљ75\h\j1Qxi5ߟG7fyNT%-L-"*1}=xZ44uv۴DGlֿ#l[(Bu.=SۥJ* YKJK]jSf0aWi_"3Z]hor(|f4qQu(%.Ą[:3)򼾡:c owK)Q}<VB܉[ -0[] U*o&uW¿幞ٽҸ)B±TVȼ A<ҍa4g=ٞ#~%#-\u0/ uڭ|h3p0%贁 %R_g5]4ex" *eVB͠¦X +'H7y; oRFRD]+P䤌j9֨9GOkwgsG16KWNfw5oC'J9SMy[Q"!p_VM.ʚ'ĸ@=|q=q zhPTeDtGѭ &'ġ-sϪ b[QGkD'#*ۚXrs vs2QͻsL pAUwfkF!1-$u0aQ'5*(x1ۨK1#d*Ϣ$ ii>A8QPPdf!Wz6RUBrC:8REi+8/ۊvNEĒάaۑKj6_cɊdԘhPcw5V ,q yf_O?N˯Y"+b7i1 +P.X rhVjµ);8鼍iLm61j,`wtc|K=6&c nFU(>L WLZxFK$=VC,}iaaOLjq1:oqB]ͳQ]KJA CYy $:\R s. bvLnSּseCw 5EN}Rd\HGFbeχܖfl$U[jɦq>݆ǵeྗ4}f׆4kCyɲ5-* ̌t=n,UE`v-+ŽjiLR @'^P1 k ' >П] tAg+hF,SB"`&}H8qx׻?x>uy4vQ?dN Oh #)T,&A҈h76+Td*ZZ-Gj>.)BaDIu64a0dńFC{܀ɶb,ZJSL5-x|bӢ Vt!$Zw/2-BKS|ŚfБnhlU#ķcD3\nwy;Pq?fgia4+c-(&\PJb"I3%Y2q Qꨙ+yvOWCeTmjNjc^/ܵc뾑,NtmP[rli7QJ =R{-p-3IvC7ñCh(0,w(cqHy),hN|kAK(RP5ެUm:`PtX@F=N A@^[k+P+=A l߉ XVM }ʟ&?ܧO TuZo.1KXèu.PJrߒ5l hv9Dcyt]V]sߦs)1Πr7z:I/aIU[J!qe ʣvx `Kcj_3ƱP3">l,}9gott~x5g^7 je hZ*y-%^<,UI<`'X]Sp| Cw,2O6A8:)5Mގq寘toV3.lbTT@߂RXJe̒Q ElP㝾[ξa{QnY^YtPRjU(IlQn1㡄h`螫SͻIPm )8Wf^~CDj7-tOU ^Q80,TR®Ȱ_rخX7WC+[7l[ibQy;L[89Z0즻tCKXyT&K2`ݧ?<=wTǞc%pQ$,㱸ti"lA(q9SBVBD4"5[}E@W,X ~wD0kgK'JVd3jgԃS6mM(tЃ j 2hfa| ysE>}&R J;? WgTaAaD &xˀ2M={qr3v`K^~/qXP/\B(ěߠP3GM}plJAH7;s08B9o";:K2+/]6lZwOblBYR%D\CT uIhUņJa숵vQwU-HSkbH \mxF gU aZvVr6(_̗`9gWRS ĵK:d[n>H~i13t3f(V  -0oԂbpPjiBG \fԢ{#ic,E>"F,٭QF!|:r7wUX/+[k[B:] G[Cxپ^TG! xMu/(3#&CB!+ f%zUc~8Q(ol D0ӰQ. CfٙƦy+V+]6(x'(+ZH[n aNs޽ W mPXzvwN ҄Pq $:R+.lDÄV6aeae_fx,գ,E󈚆Eo 1FuĞjf#~,뚠{Yn,kV_Yj:K]fp'A2X օv.#ζ u 4]ed O[fc)VPۥq:? 2fM]s%vd %6WFndNސw&wV\ "`xКoR=a, !}Rmxe,18k> Pzdu7>I>{7۴1BNkٽ>O@_@ەR{"[i՗[JNXϻ~ekeB,"0f8Wsۄ#opGkYB1VoPBʆpY"*\~ :Ui,u> Gό[wڽ)9߂mf﫼CQAl]sV/:+i1z 3jzXjJRmf.oG_drnDPE_!TsFDDtlk c9{:9VR>?7e{UjTR|c;M0uTMqS 5RZT+r$w n9nƶpնje=lX>Vհ>nuR6%RN m*P[Z֢Qg-R5U0sj=znj:+jml~V5W*`ej!;_ӝ!0}H $S <ֺEH5Ɩդ@J\fT9)hȖ 9̫VƐ-Js٪8bH+ /uHr$adF䐳&C5/GʬGG*rEX®KvQSM~,ߎleSDޅbh!3|r84Ga 3D)5+ hI2@#h V~!Yyhd租WUGHChGit?g"5^NR$vlɀا4.rȘ7ˉ˕[ZP.|`ܬ4ٺE5rRRV`y,WWatiw34ú@CV4O3b\naW7 `2M6j[=9IGmc8라gE֑ɥ{62U zػ!a_S1bLibB'5 ;q !m"hlH^Vʵ5C˂)}:DSUyF01u~q`dLՀQoY-Ysz%]({=G#2xy޼v C}hty)9*Q"R_'R+strIV5* F8^.f@5t乎CVUmM6I(~Ems~!݋mM/m[6(.ADo\7]qQMo[ jrR7f@֙;e^z%XAVa}kdn@Hk*d!5 q)ބSQ^fYQT@y4ψjsqZ5Y-̢_(݀[M9qiV FJ=SDzoVDש'O@PPպ y'o 6#s _6TXPl.K;s^(s֝\q};]ۀ(ԛvϬt`X㒃G֨'y58}]@$IDVzn5AaJUueb2H۷dFi`w]ǤwnR?6 SsD(9ٱlE8x&\H|!KZ S:v[qV]1xTI*4\|rw:x%d>[:-8&a`-a7E:6֍*54X(RNPJT 0N96bF@Xk,k0V_CTG @jpw:? ,UmmˍOVbpf ֝<<ծQ¤IlG! 呈ۊ ~a"_?k2XA}7j@M[t&"k¨%9-/{3`Eg*\zt5Z^,8[(]d r'cp/rۿmxƶ6ڄ3Gװn^V @4ʺ!ktz=`g>sYd% 5UNj<=BT:A*(`cK8}֙ft1E|.W @a!9+ETX1cW)Y3z r>ƀ8jG;Aٳ _T>a#nu';̙sr1[Ƀ xpW{ 6H/\=ybBMl pn5ơ^hl*kHBXjDDPepl2c׬~|sȜhAWM=yag:Ah5U&R59i+q:$52e|f.f.h8&";TR 3c#6#J4Y]Hbs_emhl|GK bXbl ] 㖎 fHg>qq&m' Y.V@m樵Q{݅h!B9쵉k~A'OO0GRSdb,q6Y~#lߖ׫Ɉ4$H)v6j:mr{\:F:Nl)J:]J)g<`0p5[Ȑ@UCbkpcN R0_ mfc$az~|wWsW]SP_nsѸW?ݓ  Uj)2HV#JPź|;;x~g3@an9SoU>vB=~"΁lb!D%R6tVE9A8 ۧX^|dfo,Agсbku'^8iBd0.@̋0Tҋa1WU Qx606>]ɢl`!2QϺWwǿL5̨fw>F|;T4_}ղ4C)Ӗhݺ Yܐ4cTk,<m K;o9wj6ƺOXZ:L*D@ޘs_* _k Tb y)s=:vEVz/fsVwv[\L's\u0m=+|f9r,gaO .B1cs7#3[dWJaf[ kKz tDw y )arz馪`*_x̗$FPyJkq@7oE4۽zJ7O$(q}I]ik u7J>5iYKj0=)~o2^K睸hx/@x/׫|%y|C秳~^_ab6uctl]-#2U cȇJ~*]UϨDǧ# u5AMV9 _7UpUqJ*)ZyiAL wJTEjZK5U.g/DV36}2ò$It,F1[UbM)!9fWm ;vd,(A,NGM+` e"qP{KdO?>~\|Tvo>uPyt)s {~yGNN<7ڃ&:O( ݕ:+ 4$ubKU1mDHti0xǪ1WN0|-sYᅖ~>I,vRv pl%gKFv/Q*R5,';kiAjhKkQmo;=m￶.[!9e%͐Td1 Y@w?7Fmt薇nІpb~s(afpM /XsoXITk"̝{\A\0!8)?*"?^,0ݩy)[To>}|Bi?~Og}Semx=a 6i̖l8'A];TUwe&v}>_MdAƐ=(jދ)r,~ `cLNܣs@*{ۑTO?h#.(a亶ꀁ][hb͉fA *oVǣ ̀dbKא5{%(%Ǯ.P(ef ?Ch,&{@Y{bCNC{'fC)5XL2 jوZuJz7e5fEfKv7YnXJEpHlm6,4W#+H Wחu8~'!ֹI[e'w3vH> JYKiКvi w'BC0]M*r^ǶUg\P<3[2<8|*oqg+xC}.a{O ("753կCzYA UlRtp\&Cul ݤThC g3?S!hVf>KM(V4ܶ5m.vldBroaȁ(Eg=[$hlLQ j$aى_.:XFX0ۥd>zqR!MxǂZ9~<hAݿxX<<=N=Far J5ɩ%NGMz +$M"yW Ze'0W|w`==p4Ms dp;\B:4?=]4H3LXvya|Tx.u ۆB]5 s[n#Ƅ:S""h`# I  iS!~`u-?v. ̽>ѩTNTrRAOM'otݽ5K+E*#gm{zy(~SvF7iԑ{ Zg}$E P@4&hgiy$$(0_Mo}iK`f9`KqvN̷gF̛>՘kBK}4+Kр>g3ʎta/SkU%\X G f>1eL{πvApc[|N%?Ozo?8E>@H<L!,LQE[+Wv`,]xhoV\U)Kl&|(R'eipKiUhf)yxDuNb٤A@LRF aitE\}thkbC},ٌ+Z`_Ȗ]{erdT y4IJRCFZ<;JVSov] `AqG`=jzT_>i>7Sr/Nm:ٴmM=d[ꟊw+~~[F 3g1ܫ@nǺ_߿esc?|2jo1iA,8ӹJ p1؅.e[+)y7|4x.yM=YPy-ua&9X#~9rNq٫#~76“3)}|my`kny۴jKfrݯ|}.? ̀`};u|j(CTk_Iyh BEsr [[LŁjv-G8C$D%Q$l M/c o1 h; 3.y_>,p¨ sUWoU߄C_'O8ʍʅiE~.?V s().[_f= s: ˔!dQi>RƣNTԱ]a}djI䛻,JBö)KPkNȮ}nYQQ16g[APxKzQVp1C,}?r~\*^؎}1)"74^eS;'IbZ7bNs:ncDraoWAHA\gkeZ\,X԰(|0K<=z}e"YAxi=Uw[&9g6œ};ÃPTњ5"N{O;y=k;ԑU*#dt>~M6@lWp/lDW 4[_ռ~ m3gd y6 5qT1_kIf)& c/LjmGp]2b(}*v"sn#Betv_ϵ{,l==jgkNPX(<.B`ِJ*뙐%covSϹc mPly-u\}-)Ne*V9y'ɥ9'M?( J'ݗ#"p% `$j -b&Pd|.N'5#^aM˕CA19#jgԦKHTy"7 Z70#:D5{$ %1*r!6 ʱNBHʦ :D5i߭;Ի#;<Ǡ6̷.ct:0[޼uHVK߆`*&Yti:/xH)bNIi5_,5KCIRU%7cY{'h8Giin hh6N$iƧB}H | >JauS-F2e7זa{Р#S2a$x $]M"umMe3tH xy&(72<` ( r UNk . ;XB'f0C𒥃s`3ScF7+E{(i֮ IR뭶z9RBHe Z8C #q ՜9UFREBCCBg$tƌKD퇂^j"fٰqQG_#E𒱎 ШGk5<^mod6?5N9wGMx9TXJK22wK+j3mޞaCA+۲X0DU(71_T! hW u|!vgGOiHb5o+J3 I{ b0vFv|=NXmDtVGS>?*ILQ_vd^@" #UoT'$?G̺ǞHLAk#/h_c$<1z{u$a-md rv޸خ#[̪-5Hm J$Lzˢ]g3>+Vb!Z 0 p=}6\R7:F{8k۲݀1z_/Ӵ1#-\?;MvړݫTTH1F&R0z;5M{0X2ܨcjr]#iV(rc!ǟvU | Tk1G0;ZQH8KB-q͵AJW *ΎW͔[;Gf/l}kGxiyCb {4ȷ$E[xؐq'I P0BUQjҀ|\=(a  _p̉[kxPxWډזWsf] 73oX֠B2lD^*Tߑ`&?(<~yB;*[C";zM?B}>-ea+f~0aU,Dt2Β/aFUI rB wNzKIB$It댎Çd/q/ &츠|Y=\]d*h(FF;ʯ@m2!#CgzR^Yh,RwZfuSԛ0Sw :4EEy+(Wf.Ȁe6_ηE?bLь+5e!n#%*R]BŒC|2yo?.D z6 !|2ܷjH]Ve .b?.튑 $,GRT$ pZ* PA|U {3cQnЭ":T=u$TCaZ:0V]gݒbm;`*l@[u:8VG3J=v΂l,]7Z;Y[{u$WbqD1{@ cu-?K@!_^,y^ui$})$us { (?WԪl~d7ږ`;JR(͍[DdXfh]4tgpD~d8aT >Zv_ ]\`υ@ǙÇgXr&IG5M m fʨYԑء8pŇiQJ~M,hq"+ f[{ͤ1s )nָa/d_MA6`85f$& ɃȊ#}JlJzaeS,hu9rT IIݱKii٣nC.5i3I:s mBOMu(|YݝCcc?;zхjg/B!@4^SynH.R@hְS鬤_2Xc^yrWm܎"}ŏlTCƶVcjjWO>/4 `R:jyi"+^jvC'>|#ܪm@[.G y.z"://-WB-`b=þ&kTr Cnޯ?Y{ś-ؑWTP,D H$Oi,souH@Tbg[-|2O&˅T: X'͹WpG{~E]5^ssLC1S.E;++qƯ9Wj<:ې;A4 /*m;ק*A0 ZWq6VŚ[ 6*d?[E&OuWtn7jzm:;hRYfZ'VuwkvfAeZPFHG f\dD=3rHW #֣D0r+Eec+|dLs;ecSJ5 5 abӫ&vbS_\,Z;!F}98/,[1DGCU2iIYoC08[q:!g%myA;?7?6߮{O}7__˿^}|c/ιO/?~\}8O/櫬qjPFVjsR}e-V`: 8ݗ#2;ĺgb霁Z'7$=ܰ92BF$ḒG.E- `#5Y:"ͣ3okJyZ{ZgEՈ{j;h4atU;$2m=Kcŝ^id3z,Bű:z46Pb^ox7$HA^d^ZvGz9!3BȄrB@njfsW^fǝM>FAu1ǽS Վ8mi'C)Zr_كV[2`EWdSNٌӅ/&s!@F6veV5ihG -J݁ es }4}gb39f#UG.3+0<q Z/5uW%B[:8z? C(CչP_~Owۋs+R#NK'}D͢VtA -"-q4J7B`'A8-U:Rƭ8!O'{ k-jfԬgUa.I%Dl1`4y bGڒQY+G3jE! nmN}p{3 0|j\iQ;3qRR>u6x)8c2, _xG.ȢW?|j>ްWϺԢ{$NMđ>1TMZl=]jdMFIC; ~{bŷȴDcJ07JT5YWx|lk"q`CzEמ$ C_gZ$ `,?6S0'fa;,o@ļ VXtqZ1QQ5ǯ2:y }ߊgjceI}Jzب;g7wgN!pA G⁙l,k˄+Lk}VF)CoP+O~ Ll[ЃlN{UlZ-ehsxǎG {)Gg{$eK|"FpjWAu͞+ ܻO(bE[J!]#i-زw#3V)zՆ)>'5z1Opy{J,/9gJ%+u1Ϋ=86˿/XS 8g, 0, (dj5n`U@ÑJ]ͦԝo% }şRx|W?;d@Lä^2N'`;A0˶fVhdXˏ@bwJqGLجeQs"ϠSw/e`#]u>c^`Z p lNd342_c\S ס$ ];2& ncKb,R:)'4OK]?X ~{]:=1PEQ'޶*f.~}ph zt>&aI؍b:w׶6,qxjF|0X[obXl"+UY/I߄Kc3>/EԧFi~@#rp^?A+bq&~Tc#sWSTD[zF|J .z*P+Ͻ؇#Ɲ'ȋfXNrΜb5r-y?T]\=1"=Y˧wyy/yh]?]=6MVkkWEw_>?b{77xX}t'ǫ+?|Y==>ew6wVeUZi_fΏsXn1v':Ž#@9EH?i+oQ[Ev5d9=9g'bb8USEKYȁ~CvT/`(7P/5fw'|!QGEwƗo y!/Y3}I g$2+;@9CDʆq m ( 2_^o~@Llϖ<w1`~72$$ CA/TPpՓQuNw7,N!v=yBU錽:ԧVsn͈c%Phvm͝׋沬2NWCGRQ,؁\sF Jn1'3a3(sR\^bO<\0U]Y+j:(8ΟH:htEcR|4`P_9qmkVV|bJ:.J#Y@Dz@J[U2ZeaJa H PO^\}+`0J* ]",9Ây/p[ @[n/B&4 ?0rHJ;ΊK19m_/lyoucyA\mDN1a7 ,(]lNRgΈNn56,CfRSD9?ˊ|RZYjN}, '?n-:[ (UaFTaMjۿXզ,UG)\ဃiG6~= `rtNffd.@Wƀ_ΌۂlXog*2Jh崭hA?°i~V(.vm?)3,? Aˏ*~U4lhTy XhggtVb\˫ 'gR(×|oTj!v,Mku &:eԳo,U0#bږ)PRA? .[5[iooŠgYM+jsvxSMlo⹙m;·b=ՄP/`vkoc۵xn8p?4 > \J(.0TwgKyD^uYT xW,TGU#F2¿'W{%U [Q%_қlB,9 D,P]Vl#/ג;2ga7j ,- WTWg.c;+K4jg#4aC;]ޣo8UR9Jv>yг[/> "]zK50mDEYOIh˂Gh^DB}b/7fFZF͚6hmS d ephs6xdRUlӆLnu_Q/$_`ݤ@A$/Jy|zSfiQA}$Y[Rv.>f46ucT>X697c˴WcnaZf]B,^ hiKA\BȘ%L`%Tp6 \Jb:,8f*V.vp?H%98 A>qS;pͥ t5Op[lvIxzE6BJOW@e/HTAwOcOER2qG(l [_ 2?HټK02ܔr&=Gb#~۬ԈMmʀvnn.H a^oy1 AZ!;8`išRJ0D9aA@ fÆCʝ| GG%gz CjQ152+ʎXANR# )U- `.n)uN@ÞU@{M3Xf(;2{*Έ-툂=Bcw~ܕL٠_ˠ<zZ^ӉGb{zzyi>~|Z}.~Z?K@1PҤf\ioN˓߁^?(BD mX 鼷ƫ.F L #Iُ7bWUCjb|PG U&`JlB}4#WQ3,J57rAQO."1ˊ٣/[EOcF(ԋCC HaOd`,cJJTOΧw!ٰ(Fted2 wq1Z OzΑꁧndLH :6W^#\Ÿ^qD>“Q.]dwOY>dszIL>ҸboU^|x,3Gaž٭q3?Tkע|ZX[QRoz$)=Y)z/Q:+xK}?ͽVR$ XӆB-\3;w}8VDo]VؗFq.eLTZRb 9np7eW<'QjI $H\n4KCK '⩱fY3 21Z =íM8v>vٗ+8ȝ /U_t^=@z}~x{#ryk]tֳ:=[5"l!7 L~m&_:nɡë mfra >$!l֜=fˆ'$K{˯ Q@/RImJ0B>J8ZB>jR}=i89;rRM.JcǑ%zi8>Op#da턁Ֆmڙk'k[6ӼTV3k,Xg~f~ nv+oV1|t`v&9)F 9eS\0i߾bxT2d$n<ڑb+I0E"౮Y*NZ:,Aԧd[?[#6CO4^n~?IZzgKk UX[QZ7&[S2ٚyڒlk%h[깑ƭ5{7jfw=ѳ}苧+P.켸]oHd=!nYw(X0cF*ڲ/W"X:1p %Btd'\9[R˺3uV+ ,Q{,DK.8I3{m0<^;s/ڻg96@ v`*xxS{:-_տ6{XU?K0U]|6t֪֚᪰`l-M$5e@A%]^{7=`qȾklmf{+z}-К Z; v`Ϋ:Rkd߁#IXc{ cb_ MIxP9rby۠ZAxAEAIMwm](K:.xQBuF$C22q+k%0I2/DbDNs1=ʘ1/$Q ]M5iO,kanY#mq qLwBN}UkpB?P\Ofò.\ lGYBѾ}M'݄\FIU;`,yh?X\Mo%d%}X&1_Ntkb.h_t^D݄xjK=*p ےoÍъGr8?YVWLVGV3 zgS[|zrj#>5DfD8}/&6mO(ǹs_̹9 Rۅv)[I6-[#M:a$Yʘ cU[7\^GRoъ<5q8>l;[VHP ~S̃ >08rNxJKqϞ゙I2%se'*xJA[lt$W b!gMZ8j͑_A0`)r}eflj~sƖ#CaLڝFM?Tvii CgyEOvR͉d}8Y'w~f/XQgH`mxAv]e짓~ڞ-?0"]z^6 o3_?hYf:%g_zy c2ChF3o܀٧o.|UMTVg!} /vy=Ry VSQS:%ju2Ar$aTV۞U܏kqiTșswwNmIFzb CrJQ%dK<5`Hn'~% ևڣb=ˮdPB4Ug. #z&ơawb&s!re:/J&TGn4NpgT>WqLZ5ܲ1ОƳfn9#{[ y'S3F "H;mHZCA:,*p}vL΂4@N0mp+M8\ak}"ğ"Wi3PHpMhS#̒zbKBeXdypmh >m*@hu] 5]yقv8#S;-v 8yeb+KClu)}CTs@ʇ#Qi9]Px^fNAB,wF,D ZJD-J% #Ҩ5&b~\SWL]g떻Iz ^ 2u(ȬK Ͼiu# g+GodHAG5þX ,K<)==u!0am>l Ew,]5g|pt!QƽH-*YP0%yF5{/?(@/0=4ۚF4hYci jÈZƌNc3`Wû߈aYwg@,(X|nɽ7JC.h@ \Pi96Џ!=^-.Ӟ` ^qŽr3tK ZJkvʴ/y?H(L='ZXybfc2R9MnHotÑlU2wT^RSFMlW"Yoqag$]W@.aFs|y-JXySz8A]t mvNgLUqNtf*paר:wҸR4qPϚ8V.7k82!$Tf_0ǩpCdֲRoV%U'u݋ g. S~8[{Vp%ʙQQȝ P>k=,eX5f#m~TmpwyGU'ДMq0gHA F[Za3VFܩesj2efsa6O꿞TO;-껪j_5L"{7λjRވ P< .mg}STrHX\"o^/ jU0pWwӈ^^~˷ջկ_yx>Q MysrVn* \)ҕϢ)bkGl/} &j̨P1^I~M^af/ }p9㭋Njc[IQ1 P-)ygꑴ:AGxI]4;h8bjB.q{f>@AՔęDдH=N_T=4M=!ӭMp]3BR4Js6C :MU u>njZV)Eq_6Vx0i}lihb6jLu-Lʼ:m=?~Dzs/׼_gt<2~i{(frۀ(GYyG;ԏJFdnfl 5Kp7< a+{6P`Uܘ%# Xv)i(LzTTCH!"g[NTh^ϴWXz&c9.<>@:CP.5Za'?+Y;>SW4`*a;ZUgw@%(:G.1K9tUqV2"&K.=z+H)Hu0Ȁ|o9ݹ<9DIqVCCǤ!of *U..bJ eH @0r%|%j,1]7Tyrxgji:9'+o%ϐ0;4-Fe O?{UX(%ާ1VQ\9q 3P uk ||` ;QV|kݲ×ƻzXUSD4|c,V- Tq=eOdmOh mC4lo]q@~k1[FMԘd:EA3) ,?+)M2\<?!ڱ#։i _w5-*bN"LJSr 6B89 Se;T (1}@e@kkdvw*dhjXP{&ׁm tXE~TPP1DDɇ;pyvL ؼVCUW54'oǢaLUq߄ YI)˧y $.|7'qLLzv;&B !nw`_ZHld spZ[tI<hȵdXֹU'ݓƒsl6aڇL9i-K#*cßjÝye0\՞tط4 "5G #MuU!qk8j)k2.HYMϡגJ78f Nw5v99D0B[ ~!IVeJ!#MqTlYýO=D.)!qbjM s0&U|=wM9a\}+d.XӏO?ҾӪ\.;*2k_`Q~$פQ4J}u`S];\6ZYڥL ]eWY'J]{ OHJpfcs dÌE༒'F 7p,ap[Hq脦o3]\ʥwM)u VK/myvRcOp+п_d'!WFΞ1}Uq&$ U@q ^4 3Q9HxY.܄ *T *A+߱ AS(:[BS㟣Tgcmw oh nlfO]Uqq4 YYs(=ߗ,1[r9r% UNc_ћ=~Oᔝw>/ 9k۸\ƕ,onR%2#zFzL/xia@\f钧dRoڭI+]]1U-py׶4! }'vޱ뉤9 Qۊ4džǂR_f_*jIj (ņ3(SYqƗ_R0Ǥ/NB *8/XC -6_hL"zo$OUx/y1`hZ YJ;8:<[9cf/]fE5geJ L\rNՀW;~0Rԁ: -S=6c#gʢ?Vjo\_,$bY^6 2*lۮS [`Cȡ`9q{r2QؾS"G|b%}GU3@$`{Ǔ3K1a0d[q!wvAnj2Sjg+mdc]XFCJF "RevB;jn9Q`i|n~BčUB|Q O2.nd8P>ID~$h>>lþQ$eAL5YRZKk8=i'RqZF6T׿*JM hx'H S$dʂn4 Y)!s+LaQ+:5;k׫̊b Sc HrQQ :_l޿u8>,QaAm"b3.NOB `S oP;slw7ۡc%)ޭ *f$h{B<0|ݭcS?76z t 6jVeh;i4rM1K[2s0r7 &eKM99:6lr)%̵ FzwP 9$Yz\h_ ^LcD4Bqr qDtŔgK1E%>-`e/rJ&sU83^䍎:qZr Y{8ihv'Sđo^u+V/`;hVw6y%IQ/b l@He@U; Кss m<" fjPJ]r`T8h^5{$BN%r@bc[Y_=ctbX)M2ҧ&+'r*wU* 8P>%J *M@_u ˃mޱff%j~ VKU'ɷ;tJ=: ΢bs!/,(W(wz~ NłCB&HwFt &nNmE_S{/Wd[j9p]dnoWqoK ^eJ{R0а)|7~yYK\L?SПC4z5.SVw*ߟ!aIuh铋v޷N˾͔x[rT:TIPѥF#>8VTIAmx= //x{pr1~%t9m]-lßa"nH>+F D: th0wc>Q [$(cs]qʪ!V-X}8~s?\{ Vm{IyEx7W+K6Vw&O@" Q0:UC>1K'V)8:\≱"C ۀeӟ &QE]p*J0/(4C{lCJnjow.1*JebQPw>鍖NfՠmR}'|Y%?JDN'KxglJ @+?š^/#%)dOm}t>;UF-sgҠ0 )#d[YIgpFYhQ;-NKM2uKO>Ha/vw7T>0hN8RnbdqE/P˖n`ˮH{paP'rfrjGfBd6>,[gi:)Rmh<THY踗ZnO"KߨL)FULķ_SHVQ9 .`y>-?l ?M\1T_#sh $<%X֑-iJɬV<@ƳYE tMWpOp:~'ZL;)ڰ0& BDE.i[AL; 1aJXxr(ÚZ 2"Smra4P1BjP0"[%6$eaf^9u}__;UpXl{%;X\`jqSg &)ylSLy]W<j#CQ7ES?(ss(*&u[26~p"f;UT>zhϰ&)FŠW#^=(zZo=2ԃb"cD/Kɲ>sCzi/VdxW fЃ@ڊ%d5g`GqFvCf,$,FNB\sBchusC[ =hrr3z>wRB /ze}-CXS3eL0OM.>?z$i0j<ഫHyYp=I${^Pķʈsi j,dj;xX# w)0Y U3]?L.xS^q!=[2LY%vRZZ5 jwrI ̧qiEUVoK 5;ƀ'A&G1ua8~Ճ?8NTsI"ͼ XٽBjãw5Xqgњ\kvdjDEqb| D\00ۀx|Er6ӫ,v2=ѶpTG,eg1D'ˬ$~߳|qECs+ =V=cqÎHE!a{7քHj=KQ>2qA#q<-+䑄4%+"JW6'^L43yl{uo,8& eW3L^*u`8T`(h% L 'n7AaSo;IJR[oS"Q,_`j,Z0W&q׊h+lP=aO~&Pn7}. ?ߎcU]<h5LVr"{GpHGcG+Yv,qɷ 0~˞m^qwG<:ot;x+}Sƀ˶)|;?V7^p<kߧ\djQieE՜0P\*JY: Z %+Їt `q;ǸFxDjľoU pOAo.PWT}Int#3'r> #j9$k .'(+sĂ "SCw7FSC}z055s[2+J=Ix*jaŪﯦio2ՀX `K7{uأK/%iѦ]Lf 3]PcAض|I' lex;@^c HtwJAKu׮VMylxC{L]}K嘮Ggm;`VВ*MWcSӹ%J;Sfo;3;'J!Bek3,*H{iu޵dQ`WΊ|(91L6ҝQњǪ:4#;ƌ+MUF=b #%161ʨc!wǂxFd3pQhx-Q[KTlztP2ksZ5&adSco_bl횓2R\d=q]CGid}w>>۩ ݷVt,tyTa3O׭˶cuU":Y"]WTEV ?XYvG0+9OQeBw¿.i?*6Uvos·[58!ZNYdw5O^S وpv3/|F9  uy{Zr$Ub!\Ws"q!)Un7հYZSσv )d}b\T{$hOj2 {Kl81 ` P ѩ_6$$sKuDѝ.9FhoN%{tL:0e vRձ ƛ:u_Ǘ6tw<o#]y5ӵs\Re<ܰ Q={;ʑ2{ 9eæ'6G!E=^wtƱ䥘Ǟ15m>BzsY?7?6߮{O}7__˿>7dZ}_Sٟ^~7d[}/V˧??|˧7߽Mk 1x@J;6`oRf'4w;Nw 3~C>[RTf VBeFʡ ?yGm/ْ@j!S'ÌF018ϡ1 滬f&QY?sP4ͼ$dnYhE0$eN܆lHƒN?nk5m~f0.__dG/hW_oȷzW1ʢ^TҊ2d2WRDc"4kjٶ\poƆEOʶC+"!Nc/3_2 [yCgl)#2uɁh;bX sUݩo@.藡+3T#FBqo_ @;u~>QVTtֵawf5+ɭ/lo?RN&yui嶣!آI%}WS$d2"nm%x*wZ<FB"@Z j|-ZRB;G&7؜s&n%pP† 䞒_vG֎McfI @"Gdf@D:r_tf로}h̐닾H4gv٩;V'±-Y݂|89%\MVٹ-eG$8 Hm/"c#]T*^F $pub ݐ(5&1TLnDOq޾.|{BwV&ULׄ4d2I|I1FGCU ݫKY#̽-WxԩPi CDBҪLLM>PGt2Bղ9UE>_ON|>갾H'|`2YZ C -GM0 Dwj\ˆ쪜*.xBشZ6ݚz VѽXQ肢zL'vAO|bal$2%E+k]n׸^G l:Τm!)Z/ۖ4 z'N(&~-Pd#XHl5f3[G~5F>\A#|w5`|TrM$1c^~X#>5O?^oC]_~4W{ܬ')d4Jݭլ>wpl ѣ tR8v{ ݧ`yh;m#Հ}bdEa{ۨ>% $HU ֧kxZ9,2UTmЋ oJ..'J8bƌRw^*d?h V+ꗜ%'1%'5(WFuuitaTXl5/xNk՜W5_I{/S|4kL4fwGe-S?#-zg)ܳ/MG4:u5cWp'E_-/2#Z[X 2||~z1?Vgl뾽GOE 'GĠYV! 3`[;2y ʶ\^06XPO#OQnGΗ_(D&iE|]l)}1Y; }"4n|ƅQ/7[N4W4*|(3^bqH6ƎvэhZP ,g-z/O?=\TMO!Ѩ!mM7$ѱٶ`2W[ڟ(sGIn(-!W4gG g;roꝦ8&6k9$o=KE{d ."X&ۣQE?VoDc,"Dc97!?/OJFNUP_Ւ^!jD.UDYX0<٦Ph}ubg&[!.Ueޔ\ U]7ɱ 2ʻʑ|XoX|m9gwǧɄ]y6y "$^f0tb2x96T Oj o:^~z4Jq+”}砵?=3,eu^?pr2DGʵx8J9#⿣=|X7,F"y_ BwO1Iiľy_, WHJ0Z&Qh>Z6xYdq]M͌sjϝIk@&XXm\C=pw)]ZXU!iCS[G@0kFꮳ߾d.2m R2d!2133.I'lA=' ptvWտzx0]{o*$QUދ|cǰ?Vta+x27?6D d1"<<54jarUIPiwpOX#JTА@y-9R-#gcQQC偫K$ĺCd*HVJZO 6NBnr;QxqE~* T՝ *l ,9@(\XՎV~|if~f3 +^UTA43;߁ǣ߭T+u"E;2R+ne::T$Ot`1S}x[:_}Ehɶ}G(GrB'c< 'R䩥tbhXc#̔1(/{mC"C^x\* <1u.*p[:lXqSPI:Q9:u \+q|w_.VKbգSg<`*"( u=o!O@kjp'5UTa.k_oF AI.JYȒV[E[/^1}OxI0rwgHU]&ږT1:|NE$ RJmXQ) jm;WʓkWUKE{@R;gpcrne xbrDn>_LuIT YV 6s"/ڞeosψǯ呝APGS%1195jFI3E9vȌ /޷d4Z"+%C>S8VenLvr^E2LjVp D73HϿXUxp("nGfӄ|iCqTRcW]'/Y9mԬ_WQ =t Qiڰ)S~Iyyh|Zw֓~q!yglQpePDĕsRmrz]*Y+ςx;nWt~rQOe|XSy89czyb#~6ҩ*'7`͟kp쑹U\u>:`{5)ɚW@Mr!(0)ҡVɺ% 2cr laU܇b3m=>B>+>b6Wx6՛bԣ)bbn#P q^t*A0.D$S#"FwR@c%M ۬.ע&|e_jhu`VbQ)L ୉O+woA2!Z.{f63f ^{T%JҠ-iʔo͆Nqyط'YݶZ~f\\O&;VջjzqXaDk hՋDc=N~ t"r׮ֹ$)6ԑHf?^3EtT-@QSG'9>e֥/Zdg2tUY$MCpƿݙ7B$l_ WZyPb*RHv nG(G4R*AV!;͸/7M _D: n[P!UhR1 ǯK^=' Gڣ "]aC`P~~G"Ì!۩h(ޢNut/4ϔyG7N#7wFZdSz3E:8n4"Ŋ<\/ _]0vٹ Pa_. +bV8^crcb2,&sP܏6}$ BIl:@'ȏ [2īf9 J&۠xת"%iVԾ-AhGϴ ^Mv^!%)]=6Wr NTTǏ*sZ4|K!z(tYI Lury RbjzynУX:ҨzԜ܈Xeվ+10 (.alX5QDy ljs+M*x:Ehݲv˖VSŚ*erý&' O: ^Ez;D8?lV뮗"!|ڔwo*n@+]f-AZ@+5W,,hwdT҈l=ӝvrAN׼eP}2%;`CԞ5;~1Ӧ r!lN"[\mgeK;YE*tɈvX}_b+WWEÖ0.b(xנ*zwZKl,"BwykpŲ\(E=|XgC5u۱T"E_C!}K -7CDZOc/w`(T=CR-ajAժP)L|ܯРW>w`=;a鿮GeF|A}HWf|Bd>]0Kl0n=?HnkYףvO?~[|xeOC4F W%\x]C8A=bR\:5$V?ՠyn_dC)u{uViǮj.Er==W9GaolSpvd˻V}>A*erp~|t=QƛJ ]O6 R >jsQ8+7Wjiz[!&;;[d7Y@j%{XRv+:B^m<"|?yy/MQRwD g+"lrv1PByob%3e ( gBmy$n}E=f 0fzzĜT +_ѤK&2J_(6T8vf'D'JUY2iW03z@F5u)KV6]7G\GH2"I0''_]$ĊWd$C3 xŊ2U HV.~ӖNVği2ߗ0&S4P9%PuF%H9?_?9Q<._Hkq?o0ǟ^Np QTP}.IțstNmB;# y mg_V+]vз6.3O(ukT VҀiJ8 :+_Xg i'GIܑ8Ȉz8h},8z۾7ڏ$7>,o}UAk: q7E=QoecA}SU,x5B6 VY(Hg}.(*rHiEO2+}{rqFpc* ۡ'ѪMn DAJkι_~jO&:0YIOvyFVFdvtm΋yq63s#@ U]|m OL +.Z /_7TO osBGrE٪ɓ^KC[#O;կfX!"\| :Z(,;+{~s Sck"5Rf>cQJAn~*jlXXX^-^\27osҠh`%l5 8[܍de~G<=w9l2_fjh{ZPz C莊N/qs-VP/k(-"#F J< |6Jfr^ޮW`eh4WC~[1H @HFֻkv3K=i6pR/V y8D_`Tv,'GL+Y:OR3|;@ށ`p< KdAgWq01)GE!e793|BMw(qw܈ѾإVB#r7cGL 6vP`sYOah8 pWlIJ^\P՞g:*{$!Q,/aXg0CQ6ћG<#W3xwܾQI v6 HC~ q&NWxopHWgP-"$}Y2>5oY$C3MO-gD& ?~Kg蝄7viqA\4`6a{קwĕQ4=8`$$=F4isTv}❘gUg$`RNy-DYƲ w--ʨqLvKq|]L47 Z5D36s? R!:t}[71RܕX8E:g^ $%z~o02H&5<;Ib@1@^ GHT=oc /shHcNto5'R4vPǦ.OO?W|~ cKmHM?O$40$^;ȼ8/,UӬrYCf+=2Ԁ=*(oEk5=MڊC3:msঙN xy_FΠs 9 .<vsU/(Ι.^^6vAL:U%}6s 'O!"W=on'ze`AƠA Ü;o8}.s}Y5+Gh$kZw8xە&z7˝7mdSk鶥HXJY DvJ Dh$l=߸;&M i#D "`Fig+⫳T{]זG12j \d&*$4D  hQ$ǒyb:y?*6 iGL#%?gvt;ѓRHX`Nٹ?г"Tu+$t5 x=Pưu?Bl`yրJN#C.d$tJYQ&y׭xuא̉_SCh;XVYphC\v22Z1_T*..pGEn$ ?A^[T[=_uW T&AqCXELc9xZ}fEuLHx$mMwhT%! 2l~C2Z2 B㰫}6uj\(:u!ζ:v<ƸU9rj\Jx9;!r)9̳ke6Lo@[rÏÂJ+^|Ih}zf 6wDׯ«Nz~ps1K5)K;П&3P] s*꺟|ث1$xXןOK,qv0Rwzb$T~@n%X 6 ln)k aiy$f{bh}k *;~TqBQ:(qMnSTN^n%caIZ}&m),2BRX:uH CC;;Ce8uf#7f"밖> R'SDXj>Rx$'T,/ x>h 8y.NY%flY~;TA:?b"C4leSإ DV3Cm;k K#{lbf2 ajvMFf<.xñؕb'u/ܰo۷MWi\I\Ai; hEѡ}8w_Ɔw$juNT$wxȏ͝Tz^sBؒ$;3 P" AڹȡH&XbͧaS94E FHH==n62s~np,P7YU6*.WQߊD^M!s,qlS;D9mh.IL[lPKȻ` |V$[:]PH^i+fW|,HyϱԧZ N?`Q!jM0;V](e *|+D_]P;G69 %|XVN?vh:j܎|!zHO(Uj~攺TL(%wkiVBG6~ޜ؋F^#Amv&|5[n~rlN'1{OjC; a$x%Zυ;12H^ G׬[^ pْ.Pbe'f^9DK}?<==7?y#=7/ukC?q_9;~.>/f6w䭖i :\XaF$w"O(,I #v>B-:Nk<  3brU:9W^uKq1fCDy:Õ>\^z|a=EȈ^2j !\m& } 'dl-MɄz^Kq&D,>;/Y;F50'])d)͕(pTPAwv:W+Y3?FmUCשڐw'컁cկ~մoVޭ~PWUM5jpҦc_cXLGe wGM&y5Ze-w?l M1$נeM=Px2}УK)È!Z4?˘+!ȴcq6c<4dޙ;|Z8aΤd? ۡvh%O9vAZ A{ Hi ;f|m^9[˛X&I0zп+CPg S2J2'.-]Q?==|z~"oxu=l~snWu@X61 iiV'nKO /вh|A=Lj/$租W߭ޭ~E=1>$ƅkSq.xK# auHk29t 9TZ@";ψW>YYKAyz{4NiDfV,`${ f no ,pl<1u>_^_B=EuPͣJK a )c?g@N\ÂТI4Mh p[2 f=% [A0}yØ}~3: jDKG]mJxT,E|tWJOL*!\'N -oJN,gf(ϭ,(vݕԤkق,mN[ 5[  eJ %+7>Z | T%][:mb8jqJ w*L]bR?OxcS+I' Pl͒(A'=@;i+Eu5>a Tg6dK"ԯ̂  V-DAuf>7UwpP[܄JdJ6=ҮZ`HHfC[ࠎKM2)ڤϺ?_~OK>8R׸[ _Y 'P`JZ.MK5 xƂ 2O(_c<;̾Wm{7?Z9k;D6ݑ̫H*@b}.?"Š!{5j2ށ!.P,0ե8`/:d[ I!xRCWu _PqQ-=*wQ+jGt!&9~d4vDj#Q1F:(TK3ϤHmd;\jk3eDY 7xF t+f(h*R~ߧqE󡋊@l]ebj ¶ktaP}r` z%ʥ /#Lr ṥo vedЂ .%yD\@`0Cm;2[@QsfWa(Ts:#(~w1 ޳fie1{ * ~Jݜ# ^e^v/:iNnqRq6YNT.5i_OՏOxKd~#yT×{\cUU~$",AQw[#7 ^ϟT(i+_0yrMNerg;d8QMtyVzF *ijwZC7\ìvt< Z*5AFT ]u 篣@}:o J BIAUr+ Sj70rZ@92\U"Jn96uӄe%y%~(ҳϼ(@騛A=i^+V J$?7Wxn^Yp vc]<|.Y__oVO6߬ϝ3oVqͿ|>7ݼ|z8on\MԖt5SQU!\nģbxsr Cƨ?؟.+z| }؀u%7=+R9+[`?h >E1oh'kz@w͇6(|ܬњ3 j bLlczШ e0q#+%! T]&T#/.o;vTon`ײ/57vC1F-a{+Ir] ^q3[:A`$N Dg[*Bhȶx<+@6)NM`DrPw;oJ;aL#iW$/3"tڲTĂǤ Y['"Sנ4T)+6p nN*1pLYdc2q5w%pR2J^ea&~;춿ِ??v\o/jn/?/uh<^0R.{KA]F-]Qt]>d0,jUJM]<(K\ bCϵUQ ?`WtLiE+L!:T.yZR,bƾh4A| %ٱcy=YGGs(i,x{^;yxvz~_dwd3 l GJla q"W'zH:tb:))P1?1.5]L"~"`-J{(w]mШ7xLH$,A!#C\l lNQe0 0 E@P G ty'XbT/YMV3Oe|<ˑa}uk򙡒<\-e:'#B+Tu:֮ֆ4xN3(z:ծ# #Br?wv(0ɠP`RX` ív;ﵓ " G ,H8XhyM ;GGYY sh~W|T~lZa^d:fXGu|Ȝ$ 7tG &lީsT0JGBzYUm"kJ6-ܯQ#p2';r^Ҳv7gOeQݫX4刀lE.}/tlA f9"XX,f]!2v/Rv@L %y5h)h!<d#"c)5oܵLeJl6,U0P'Z 渙kcį`(^@r pa w S<8 Yj߫d-~r*Cn\Fےz0 =51#ko?V[۩.k|]PVa ăv+y-I' 'PCe%wa=^r;Q[Rsct0kwB97Un=93"c?wQƎlUEK38Vh&ݱ*hZ%Y b:`fHB,˝`>fҎx %ѤP\aqߢQ OĹ_P5Mկ}_VV<΅-2 F*E1ຝ@qG nDW M2;;yycrKiXw8:+`gL1b Ps .ԎY)A%gKlcBfo/`@oHDuhMORd 0]]MJJ{6c4HaÐ,9L`&6잌.eRA L4"*?Y%*3cs"ytc;Bzw7l˞2sIZ c vFyTaoXY|i^u;pЗ ߊʹU_dzqK };‹2Mpu (*Ne>ی'S>LG{MfY::ٍ6j'"8 K7.lIوt_M2%Y ֌L %?!Exއ L}n8\[TK k[eYlL(xIeb4`>eB_ 6Q}aU8-T%x=e3Ȁ&1KQp9f):hiQṫ\e6:yO(#` Gl'coy^STX̀Bbv@gM<ł!T̄Q4riM͛/&dF><ݿ<=Yo^xu:у+C go,m:"+%˻&_ ?p;ak,n++2096h_EKu'<*U;,&tt]B:3=)q7c]ӣoc3/`Zc92rӑl z ^UVsB Ccp_8G=o@p3L,`|o;=c5tu8ANS2#.pQ]q`A:f^e%\Yli>Z3VF:hqZY@vP R[ ӈhO >0cT,%׭|&HDR< TtKߞY"% ,E_ȱ;Q{+vH`f(㛈⋅認NkʝХwnh;*ZB@f,ݽٽ9b_KBVOKzti"S2/3u4 ` Q܀EwDޝhY_lj#hUw\Hǘ7m]=8wۋ Jg"[JvKwa˧}_<aUh'=I/ ljejxPA)a+c +kV_F0c<W: =֥ *m0ƙ%uh [WZMǤ-V7 NUOG`ǖkٌ qBfS7MASbyA24݄rvxLb}891C)"3ׄՏ[`cvDDd0q^X7rj$ӢJEΆ %=F|i_*4?X{l>G# 2RFl< ͍w%gG}Qa{p:*W\{zҖ)66^G{6ّqCC/i½YxC\|{N nٕSFN;nb:/tw8m4Jm)V\\@ V!g9 Շ\ЙoLhdz:Mα=opBR\Cو h9UFRxh`74Vjhzpp!%,0!ctX]w9I), ]SQQg!ϯ.|/Gk4PKE+/TG2D \BhQq8z /`6oM.r ƽSqbHp_2HcҜE+/@ʘޣٍe*lWbTŤDnVQ4!SP&Q=eU[úI6"5S`cUāwCbrZQU˷߽/?s/EOFp a1:{$\1,-sps+ W*9D(^HC60Y!Ba M:YiS(}dL"r,<,ݳsԃrt-e{p p{;3bȁ[>A_mW߄Ԟjb)bCPQ 'Yef37mβ[sVŬ4qKp J(ݲ-YtapB'b8.!T٘E*ɶ 0]B~i[dc:[b8ޝXU`nf5,Tb`R8w Yi4 (C̽쬮Ą{d,%+:r)½Cf;*.Q`cޑq#Y 3 DIbsa>ǘvozn\iECWH` <1u,C9# :p.@`~7$v&_@:L&[zd[O&1] jKFif;QC2S22땢KV_/~hSH R{hr}CijW"ŵk)^WoEo ^Bjw-[\ k5ǎu%]12M"àш9.هf:HO<<7߾ҏo C_eY{*l* (}T8/Á9|7۫I cKg™&0ߺ2xcIkvu "p}U bgG1{Q{;%Dv~-. ? % )D@8FT8'r&h>R|^dGad?ΗU:_׫cUzv)]y74EV}HM:q>R+oh,DuNٳb<;j;Q%GymzB/BSZjoѪwQ{U3q7) MDJbll$g:[,N+g Sޞ>BC D3v+uC{bmVagjҕ2sW *訜l>sw  ֕'@#Y$Qݺ-(pN;J﬉s*S*@G)#6CTAi@LxuO2hTAڳ$.ލ:`j4Jz+z}7h)ʥ imt1t3.2,̌R}W58m"0tP=I44E[SWY==\&G0N d01"c5X/_3P**Ԓlځs)k1d' 8} 8f:8j>)\=Pwšr# 8A1$LJAxzAŅL _jd-UCYgQe?oo;˛]m+%TZa28xe8a֒rNX>յ R'+j[!D]7x{5w`T=͈R~C}S+>{*q&ޜ?a&NksvxXSl 8GQ1ǀH3APtd+eC]hEtͭW+)K"˫`Y}5T2-aj`މ daZ'{V6-cvYgE_Rq3aǼv)]E.3/C(wmGȔ,Y(F&T ${[߻X7q`O!صlVLgqrYDtsWr4>'tܱ4J/p{ƻR15s<|3diN|I;xABU]3RNsѾZr7% { ;#:)6o9?vO|ctnlIjՑmGؐAw`O Pb/ vwkJĂ } vҸvTw0;m@7/ `x5S\~4{l`A _1?6TΊs1"?4?Ho?iօCehPDQD?yfЍjaW؄52*[Q'JtV[/1\4~3P@NW ..'!Niu@X؃'rvҺ{i䂮Yfޑ$mKMl9ysuE^-pz`q&YWN$-EW+[`D"*P0jJs!2%Nd+b|ai= 0FbQ4GzmvXY &Eqh\uC',FQLj/WQg|uJ &JF 2|ɑ> '>F+,+`bfʑ:vwaVeGKL眦hzrƆ* 5cbsLF==0/x՛rvŚPn8נo4RF/>Q%ɖ4etȿ`9=)>B4-c?ch\ +kκbKl% dqW%[ ì'oӴ;Y&FM{ͧFGѻh$ntlԹʽT3Fz^gAp]55/,M-kb=cbς0'% .q󦻊mO꒱ahoSAoug23Тggzl-EaH\'..XxR pt=*Qf윣/C~XPwdFحT]9/of*I3J?tclzarӽG*3l]QG.IQU*/p3.QA$ZЫJsgeNKH>6(DFqDr4XPR); |y7dhd5Q{zF4wqzAy sYj"C:(~~mH7~&w_x ?A(+g2VTKOVaiF ciSY?4H/.HuUH!7jBi>JsT'BEaE"~Dz9A~t.GȎ9Ŀ'1aRnA!YkTKߕΎo3փ MOrgUܪPx9F[W/YD ;7cݴJozl9p"Np+@*$xеF7nk." : oE q-5ط"^^ŴIdFך,b_1Ճ!*pR؏ ֶ+ˎMA} t -`M;^Tn Dism 2ԖGs<`m;QFP@DkJAyDk{6p5pk6י,(B]6i-WjU2XUn'Ѝk|i/"ޏ&{N ]*Mf3āI~Y+%3AnKswXI:$ m@.]5ԭ\(=08],y3clQ0Rv`uAej),Hbwg^4odaK]<,!pA--f87O1 qKBRt <2Y"3(+ %kV8{J&ܗ @݌DѺ0Ǔ>)*;:p(Z^b8#IR癭qQEwx?wg'`$ay 71(;zϫj"vpX`b,Fh¼jT^F1qK.:Na9-ꏿw|"k*V ٰҎ&B(2י S;zKvjv!z%P(,0&Am5NeR7 (g 3ex#q|%;Vy~"1ɨ˭ #bu_ C_!K*W4J׭ҊEeBqMjʬ|" -nן,R SMGY8UnK:I˾QC &KW2H.F@WI-sr! Ʃno@K:jp(ڵ + ;tU৐Z,p& [kjyM/qqA6ږL'.b׃9%;9X'YPm\tR͜B‡tyT ++ɍjgqlIw"qmn/d.p.W^j,~* Qq~&Dy$K CW2N5To{PcO[Nך^ QtH4n!rma 8XGι]2>YRfz^ʨ[tVۇG.]AYw>6] `%wcL\ yWJƘao_+Z@YnlfiV'lU:+?6M)V?@ˇ// 8 k*U}oNS+>V8r Y$P8]>В{kQXDCqׯ?Ƿ߇ςUHځb3>h-g#OMsCr'wTQBNX : be`iJ hgae YʹsR-O^g_ų44֠}Ć0Qچ1HM˭KvMPUjhw6+@ЫHARQ(-i3bo?BJkMs?掷AR29\_Gp] r[;H:N;v smɭeA: 0` w8Z5xȳ‚$lǧw~ǧo>ÝMp'SH9CslM6pZ 4$NJ D-&ll*fhLM]v96鲺v8-v~~9?XOJ&/R%B$L;awm஦v=]BGZMxh3VZD[@& R_b8cs]N_)~\,A1o(=Xd7Z։znnqELނz%;Qzce;Hu *sE P+9ZM,eQ.ӾR,n*pE>xkK|Q\Q|b!M~dF?/l39@2тOQvPjGχytԇtͱaT$%R۪" Nc[W!!+BdLl{BZ騚oO??co帹 A}4bxŵ_7 gaj(~5Ts0gC_6sZx45=eK[n9|%+Ž h5)z!oalb db"޾쨾vPU !b_iT`UK8btUK]%a1 -{>=E&І;:= *l:cAf3L=>c?DKSJ NlE|^M#xOs4 lB[)̑ `3.x\6rIu,v(ڄ/46` ؎FF#ZE2}E{!)ᖤ!<'.6܊IM|5.:~*+LaDl44U im:VKU=sUE L-Kf=?ݻ}3L}YMZk ޒ͔yO*3rVB$]WineIHi#x~1z2Fwy/ ] tF@rzCzS' Տ_fwsfO]# t8~ ӍB-xQ_Q_zj-fBf -f#S NG=1A}/|>>XV[LQ 6vh L$'ً1;DD$UJE)>/T}Demm-꽥Zpy5I=qsNh.K)y2?fԪP sA2\nD|ɢSS3|[_cBX_^Na}U{0R9mdE>3p?\w-NYYx3)I%!m7l&` IA6bZZE4kgΔ.ezM.Oo|{;A۞X\aq=󽲤AZLҊ.ʻ.uas(᷻þ =9̈l{=<=;9Y%N>mU]"\Dad}cMr RHIVVxg| P[a"׆\{n@?XeZ} Lsiq~b=؉42W {Iֺ 1gbV.,Ȼ쇌W?Jb=u+L ^1c𥧈fNgϾ3ZE`zajd)-RNPK,oT[RMdz {Ve(˟ ϼGԉ tj_VowMY J~q\F-VY#=z#ɹ'8)?, OL]LHp#ZKJ`KD1ZmgU\%m?X-DF{s쒼~o o62MeT 볚:Ѕ9RB,ڛB&6R:?ieV ekb>t\$~sO=G6iMprl44Ajl֏HEJBư)#cl[V_iOeyUT[˹|!DCݞNt6:^7}L1ˆzZEQgscCnBYɅPVّ oEn]hƉV(Py.T. NZX6\nqHjQ> >ӂXl1 7oBr@Y̪xW?XlZ51Z8q=ZU 3kk7('jcELjbt$06dk(E{K\6^kp*ڕHlRHb0-/诔IO>xux)oad +v D PEyλ+D8bݱFў߬F.,QS*f;C-knE6hϏռKshe)K$)>V)p8PC}C+(;@:N$Sa,Gci>9H+m,`/9OQ:lHNFy51/DrPSj+6V+g2׻ڇ00϶PIP3>\iJæ.C*fK[$SU+ `oLB),YYMVj(2g[<#?ة> {0o؇f=q^g QBNXy+F}59k÷;2Vi,N0Y9᥅g}# >džkKS4UA+R .'ŪN۞ s&u]PZv7RL 9R+Vhp9odT'c=OXAF6Q4-,bM$م^j#v҆wƅvZH.{#vӄiu +Km.7+dâXŞ[H޻F UgnpmpkdiS=wj-µ_rҮvڴU0Y4Sg?8=.=!6e/D;W=VOpVu.v12 <'ɟkב[I^|<;fH1#\fLǂ&ۄ5AMf"**[tcoHx&%jj"K) 5`A1W[!jiי̨ΰAG(|5:/JbYѩ~[Bg*g=Oty#8 :)TAzzNbώ9#oz3MECXi"gߊD WӺlBi/44kfEP!#d`c0 T#~yT!ia)UNÖ[#\j?˹av?45՛Xa]48ҔNtsr\|cZ]t13Du”kڋFjDZ/I1 l. 舛f&P:S>cwBV7#~i}zDM9,R2 ! #K3Ӓ2,ItLQ- ؊xnMXze$sdҲ+lx:7NQzq*tpVqSzʴIgpxAV-Q2n,@X _/t:L\dW²Ӛ{_6 I%xA6VȣNμefWu'A O ؉CKH0t>r@|&:YӬHOЌV,l -w_MV܅"Ꮂ nuN)7gXWJjlF˶=fYtλγaLW3ImL2d^LZ;fueVDEp[Yfey3]A.NhӨD[Zlbe-@漖!e4FPk#OP%6J_uJdzW (e.F"nkl` go*_.Gv ui%cbMjnIRtS4t"m¼҂\lr&ĀAh"bK)N}z_\iQ2͹.RGϭ$r-<;Ţ䒚OxRqJ#Ԋ 2qU{kITC#/Ź*g]^?7-Z^MOd԰]뢄}1lV܊8_br (ڜXmeh3V~;ĖAg؂tMĬSbZ=]֍WNwd@?qzQSVԲVilGO!Z<_tJ&'vY]B^1uҲ:syMKsfJ.O֕"M1OzǍ3>Mͭ_qrx9"}e! q8dI%yN?eQTW[ӶLSO%{cKWEwwntO>cw#g1/;P6vвKm! m Z,G1W i`5́,Or\-'GhI hն1c$=?8|3w2Vf#O5T|̊d=o%B9?&c ޕ8s[uͬ'LĒf:rFo0oɷ O|GglKt3Atn/c9FS팩CTl[0qI$Dr2P;VӅ9RڲwjWbw<"Kɩl&LJ^ \mסg)}>66z318Cg|`B\~Pu}0<s3_SZkY#IaN*ާzC:4yR]aԻ(P%ٴwpgbḩ?/M.)K6-fRuɵ5?@ QS|y\ KYwLez&J;װ+gg0Y٤/Eg$g?~”u\k9&|\LxcLg)ȱ uvMaSOQg'Wvb(ѐƜrV]6 R&<_"%3:TMzg>?V8,P*L'.L:Xb gNPvEYL۽J$KbgeZt,7uQs(fj8̞MWK}Sw@Y3;H$) 9y 1\ءZl -tY(d=aN j4B,uXrb)dKeO,O_? |V7.1.pTBv+/vAX]T[ pO`o> n(31JTh%zCLZ/h؝U;#Vݣ2%f5wpYX  ̭&l\Y[Mk*jC\ZQ2u~FQHY嬯+v² srԉq'ĒAnme (@fbtO>K1߅qF+:82ͪ0nL ]hwiOjh72nV<ɜ@~kiUX*g2 7d殑 )3X^~}Xls,Uٵ1گǫeg~"wvrE[-3PR[*d ‰*Yy ffo@ݻM7FLL YZo?k%8KӅVo%b$|%QPQU׻cC{b*NvIY 4nf KPc9tydb7")P\#KcD %(C nXO,`p8mu SX,c }< @uWpe>_]W*֣k M0#M0Y?Sm$SªS kPOF~ 'Wώ-Wb)4 lq}c)ˤ6*0ZMQ{B5|ΑdsؕŤ1V^'H(H֒ +4~ۚ8ڶ:\+8>t45Jbb=J&tnP|j ZfiGYC*Ď j]([dv½ 0r1r@#Tu!Ek%K U.z;RVv z}i̽T['v+15%NS&hIX,GMeJ6. 1X远XݤFATzɶ/#Y7q-i[V9ܲpA~f 4bܶ!W,pflT(S*D!2 mGy4G Ac'nk)\McDL֧gߣ?y$R)%ezoF5'K? c sKC {pgW~f%u+vvayte,15O)5dn&R1pE#-sgɶk+Jt&P8hL.l<.kmK ԫA0eɭ ?% % o1:T2EK61>2%~^U:}.*o3)v2Y;>CM ٫7gzdCP➚o،{rx6ǣG)jkC'2tMC<LUN?܊PGdmV_fkYLHzRnK`hȖ(d#4ǨF4M>[^ˋC5t>ucX)AmSѤֳ[70I4@.X8tS{gݫFe) bc6Ƌ,,Y X{|EFئܖ[^Te"02W͑w-E9U>D""ʇ=9%țBډټW8 >*R@t)8VfKmn$!SndOռ?v =Ά: vhrN6ЩT)]NVF, O%?pwwwաWZ$z=F{bOYbN =Y/֛yUD2}Uf9ܞv>"6v6"2tŝ[ l+hbTzE~Tݒ~vřr r<"_.K;bJlo22=%&͟jzW7c=nٻjazˆ^y5#W2sX9&N\YInbyjjd]W^6!8,fU<4ۼOʍ)'*R]gUJ\\ey\H8dw׿Mmߗ.Fq_F/coБ;kq7O#7T Ovj,ϔAf%X P5z)$~a.p^\Z[[p#LjF2B![,xo J,fWZӝgG; %HTg2JTV(pZ ᇜYoRU,|y]g5B˕RMN21ry]GCn$/F`&PR@ߋ6Pq]w6*RUp Xe*D${8'Gf@Ka ("٢PZDWy5][۞ݮtboߪlEmU^_oe;?flg Yo?^Ki{v~\+4>8ĎL;5\+yd7ay4T$ YFuml+P!cۤE#ʄz _=DŽgk0ilfFGEc=v.eN&\b%\bxхc -æ_ ܐ9Is bN=xkcu#FXOV1#MU鱖PJ44T:\JnR>MGO AxF,|b8+.l~6c5^TZ] )z8ӑ>@t#eYCb &qcoG-, O=TfuP,ۗWns˟Pfwgz:9"`U5j2it{6iL`J!z*-Ê]3l5֔am'Vf"Z'w얕r|8b;/8ȵSD|OuU;Uypv*+Ƒ=U3)a"XXwڥRHINj}.{惫J?_59PS#0Y@I2Xa^-uô ]f:2=^fDo93sllK82,Jr!_B2<-:gEBhvdLl(y @wZ<Uf.ԞuT=%R19ͨ'*i6dnߞjJU]~: &vy]2~a륮贄>2*\G{vިEPK!uyVBw|rn~,0?TTjZ I"E8ux=]ZI91owm!Dχmc]r"j{~13ѥ|xѢT!1rFWD4]<(1hfK-Ljpfr+ 'rT.Q*p;Ӆ}z zf*ngNe t:9#HqtD0A˖{U\|:N--׋9Lk,a7w#&߷V5ۜXR\Z|DGD|D,Ei6!(|vy G.m])TJFVx0;FnBv$yUI5 R)Eaz [$۾̸xSY #R@ zEEvݻn9[_݂H%Pxr591WPh}{xds^2#t66 W,ε) !S␑g~+GjĎBl|Լis "MmB`j%eS9K%6*- *eÛ՟Euڶ>Ώz'`[ ^QHGnXX%OcVL*5td2oï"`|?s>+w]{Mc KqZJ U>Aͥq_}XY j;;7t:4 _X91z0%x৆)?ʄBFD_H{b:RD,Ԝ#,|WcJNYSKm~ Z~o~ZX0iފ'ڑ70!lD^-a>sM` hIz9[`jaBX]\{XNiebO6HI(J˫g"{W̒y;O2:iX֒շg1oi=S(cfv_7:$[E1+}bHm8]g7s)`jkKu1O\Zuj`f nӔ`VE1RGiXB vu>~o|Ӗf}]E ANÞϔyιxxv͏@k^B%sE2I-Dkadݡ?~8hD7oOvw6}cf#c0=V[[9*֩UDov\>Gʚ9j+"MN2Le4O*)t?jUYV$3{X>@~? Z>V//ѦLrEzo]36Yr(0ǦR"e 7(8$[?+VvMζjEGf:*WPJLѿՆqmm Nbm2=JǷt1_e^dʤj+wHyBetkDboS>f׿MOeyLLHH襵πUscةߚL//K |uBXH>|U5nqrCTPXLec/^꥟,h+38x3 7$-}^]|dʡ׀rVt93*?볶s)ʞ˩mB (IfxhyVZ 4nR4s9 'QF@&PlG5QI)ԗdpW6>=}fEu}tR(Waf}ҫ~nb{9cX @۾t]l4hU.ya҈2(˘e ˝ᜨ )sjw",iJ^\L k&TQ >']D|HSO(gmM6Dt*R϶bMmEjTޚy׽_G%dlFo{U.&hr#7 htulYLOmY%V+JnS-{IpW=g P~^v&|3r0As @q9ŴkӸMMƤ2{3]π>hc# J`nRӵ$leJ|InݑT<j QMh 3(ug=63Gp;yIjt :T)VK+$J_3ؐށ.;c3nYhYԮAJLLؑYʳq>4Q4pig)RL9Wyfצo6t e!b9Opkk ;7` FLXvr KRDѬrdOjw)4)~ֹk4:?|⫥XS偺i*%@U+w#@Hړ+]zS&U0}2?~'ӠzF0p|lLeH:Y)bBDMLyYVһtvn*[0V[ KH^gmua>@!0 Ǐ9BI !q,?Sa{)#Ub'磗Qr:8_4L6!>BxDŽ.YX  k3KL'c'dt8EZ llI,#!dw*0'<`&^X^K?AI# AEI_X_+PP[W&H2IVȈвOs}R%ƞhjy""*Wp2G˝A1#I0PP[ZNʙe*Y"6EZe'|GhAqkDul̗ԣ.Q*Puȸa~I_wkH5PSzSsag-%ޅޞ+;?@{Q=< OX5v qCwb;~; gٍ#ږzٵ*#GS slN~=]ƙ.yQf#=;Q[Mc.iK덱2zMf=r)y:Hu#be2iIл+:\YNq@̈́mISVLfjO8,vr-aIrGi.ݼϻy˫R$5ߎ#=,HZj >aJ?#ל &w{h(Cԕ[ځIpkE(ZVLt] uyNf-'uRuu˵%m4Җt% ǔ1i} wk m]E|m"~,JoOuN5tGZmRS|%<\vR.qVL{++yHz6fJXYtkƛݧ5:X6Z8,$τ7[_1ܤTZuU|%lNy__lێdmS&z YH/;荳WC]M2`@jHU!dܯEd:9mWkFlӚzz)NR7 R1)3#I$m_tƽXfԆReFrd-gB®2AOl Eg{S~V[@Д8,-ʪ}a)hi,'N*=YMI\yYŜr<|: +R(cs쉘tZXO\hВ26 jYĵ8{A`jWF7O+eg:;6k(>K~ )5|Iu4⯌Y"Ɖ {ʚvٙNmG=ykILgV W"TE$:Ll JΜJ =Mh7;jVڞ7-HFYu++xUr2ĸ5g^Zƪ kI3 zBON2& Ěy4$z{2H2NpS\}klrW]y\BeFeJE„`RR"Xr2HHwta }(䔋gz@[ka!mOh8mb_baAż `+XMKKV TQ8o=JScgPeu^K.=~ZC֦5^HWEﱙ <8sMn]zώt5T`V%69ֲuUxbkzJϴHuY::1yi=iL#ÕC0LN:Eacj]Nq:hUY5^ZLp0]ipMw$='(bΝt!RugyHGv]gݚ,4**Yggzv}>Z*NM =Io~Ϝtkp2g򏌲zxيuca՘ p[N݊\ ]q{< {)lOUCtZyK&+Ij´4줊̙.= ?ѣwvM4fˀ%,.jʯ< w?ML3[;3Z(yS؊꽠vo3h4(^}Xv|J50xriV]Ϧ>j¤vWߜb3xPLD)}jVM:(m+E_aͧ*?JpoؙUyLSӵR [֜2RiYMkK\퓐W;b$xwy!L;|K/ Oh 5џ#BPa{MZZcm+I=z4)W8BOD{}Gw}H]:*1RG4 ~8f<udՒZM0C|}y:r>!soX˛UqWEȓ(YSg91Ml扻ű~QpronQ@ӅDV< Rq.O]z~lMlu#M#Lez7::pg淫z&vZE"sez(4j=EYDSs2]KH:I6Yu}1ZY$kU!g~opJ>?S/iLUjG}0IܚV_m;ژFVZ{V -rVXt慮,QMz7iCya}@E*F IpH T/>H,h+D[)ݺ0޽c 3Y Jɬ@k2j,mk} ylU)3y3=O.t&:Qy'9~ŪK%xmX@Co"jEӠkzT=pjHII)VF@vmRƅ/?e/L/gGehBZܩQG/ 󛃶4g4BToomW?<16Wk18*ee-)g egYUFLxL =+U CmkfsjagOJo֑WJ353( zHP!LtW!nY'G#zlgBVPӆʆ嚎 UL1lytdfJ*AZ5ԊIW]awM>yy٩'VKdXrgZ==UþfVlt+06!/_fop~wj $އy?t aýp|9bRᠻD=TDh;- ~K/xX@n27Iɞ+0y{&wa7ȭmcVjdxxC؈Ƿ'%b6\dgiItGkͫg߆L~L^SuuT*=\NʊILa)BYn>]N,L1ѲiӎN1Y8lOO-[j9snCgޏLNj ,|L"Օzkoc4@JiՅ~qp ,7R&4w"hϪVZٵ5B8BѴEFQ˼'-D)T)J9h-=Ӹ3g3_tDז`Ƶ{d*y _onJiX^D"#{I#"J{E6ʚ5rP|6Ĺ@y26ͺT;̷2E:ճj(Z UIr YI -~5Dlsk|zno7I!x 'ͻo^>7K֦^cl5bS3$FKQm@ay;Y[ /S="FT=0ѸE2`UgdrF\}s+{*u={ƠiY&WDԙjTUk.3+*M[ǡMI-oJl`Wbڢ;L( 肍LM'?{": v'k-Cg׉e Qſm"; CqcȮ|F9}|֧!O,s.Zޞ:d"uЛ ^K,h܇z7og[E)H ;\ܔ.}\vc=?<^WZfS76:ʝϺfy&OumbO\,R $ 6v>dj]4J,L 9Xmj10HxmHn5/X_{:ƞFǦta(efRnd Lt .W/6BQ+P?}t {YC](&Ps@-TjEtg&SWzhۊ,[^Kie'ýb[#\--͋V#M8oq1^ 4 &VE 7@#^퟊̒`6b 3+b.Nb.0~/ZZe^3F1|nɨ9j瓗VV@MT5v9[iO"ZzbJm.O sqzu1: Zzo5ajDHO6̕#=UnU`: "Nd^c%\+UZeM8)՛ ^erf 8ΈcÔ |x?!3 ʥS֖BQkN:r=]u0қp9ip0vQ:]Q 8YA7^VZQЈl#Y D}Ӭ3cmKS^ ;|4ښM,SG0eֶ_wa\[UEZLMh򉁚ͦOM6<کuqf''л\؆5chPjc[6snZ\/<@lv׋E):*$Zo֕߼RLi˩Ȏ5)xt/{gE3 cp[e(]1`7*yk}>!rXO*mWhtYKZُIܡ(`b~{x_{ ]ݲ;v++mӓ-v_Qg3V_N<-?tuvF3:>ꍸuĄ^ QUۤwOF;^ޥq oQ(^"v|xbk "VbDӈY8,w:XVRJe$/b MRFꌅz7Eq|V+>I R*&_f2MWiaxcLГlD(XhyB'&}۹Dt![NPLtCLJS݅0%i r<:s&:.1#IC?r%c4}V֜Rؐczcɩ^%m4iw&u~J:E &&3qp` SvoF#skzrS 65f?JXW7 m&tIlyK^jŗưZ%=#FD=C4Ę )&KZ̃GȫRjFnkγTP-C"/M b4iFeƭzk@"15cJ5=jrkvh}*=ձIFcdP&C47L2' )Q ֧<_n o ylj\0~ƽ802b 14Әa~d}a-FL47(P[;zpBQ 2) Ӆ^jmXzy/Rj1dcN*!Vѻ$ڤGFh0{\gS8ӂh_WiO$'XrICY񚩣VG_5g4͎Yi*'GR^*tp5SiU裹ˬ#{0CIXhkYWcjeYQ/YZMz?١ps]To3`dٳԖ\ޫQƏi.+v\Vk*$\9?z`l#B<4XVRAJIRG`6*fa N>gWwR8=xI #YkM<4e K4x_>6}ou@G5~5BdlX\s݊m+;N?Wafdz 0rh|fpGJ˜ZUUe6 /{ZҝWB9v1bpdɺ LIf6u*}Wo (.0;ezfőHrث2qY S1k|hnmk2pzwnq,9D>kO%KtªXot*5X enIzrq]%|2`iKa{FB: )67b{pMئ~fgÍrB!s9NJ׬q0 3贜qftMN@m#j2" ]U$Έ]]`}W @px2te29߉RĈ.RJCKlȮhH8;uyH{h{-Ȃ-»-ӌvE%TdB\eL @ي ({If< ud֨觹$V6M7Q6#/~lc;Z+^mHJ\[l 5f0DPT3gGTļ05j1%4ɎRt]nԤw\qe PZӧhU5T=PE jˋuA4%x*6mS6ӿLDx~ݒwxZq5{dBՅ>OdLVĶp `MZc4G3 9b[ ӳ7a4 "Ԋެi  ~8A՘glxAM&r<l ={`xn]joͫ}ӵ=Vx]E\v9Va|A:STE0k`mE6QWWn rsKzp10EлOy̽0R׿ڼRPzw?e4O2[rҫ1!$Ua0 9r"d\9^i7!:$^zB"=3~32Z[s35:ZXX=׋CG(jMMd9fxWzRE$&&PYN73wTfHuu4olv=p?3]t59ןP;nd#>E x{ҁ;1tKyZo@5?v[:,_;Η|&ʲ 鼔]p~(B+:FGN+:6 s,waY8tt\l[JЩ+?%x7E{[b/Ͽ&;ٽϮ*Ot2ڷ6k1$ulV#.juϥgyf)S!7kL C('SW˱(k:&aEׯ7H,e^W݁(5vHgU+_XA9"yKΉ"b 6Va[ IPe}N*f\QsQ(&p|((_c|mQKθȌBV9D/OyJYErϭ1>koe[knBYzQل%dQoMEߦ_k(E_ {[V[JD0 vCn[N|_ K)Y+TXsD1bo҅)gM:CԉV+4}$۵SC bjt!o Hg՚z ¸ZyʹJ";,M{K[MƲj^2숑~{px&worǢo*w Y~:m9 Dzp׏yIG{>FȐ0X2Fǂqr)U'1+!K2* c8JVD.e× Kof6lf& JsR[e*zcK8,|$ O{mД Ht[+effll Bri_a z XO:x[(J[)+1GOR{!o376l꺎8|x0{/60K< SkdQ|F)!+7$B8TA#C48zplՎ0V$~84,x}| J'vމS'_ @(3D_>" i_hvjH/YbRJ=4*NfVQMƷpm:lđtT'N{ga4T䠯)KLw+M5tH˵A(ZI,P+$R\'b$½ lwwv-|gDvИo&1-&my^Ab9GA?JٻcC[̣0yGBG=1}`7"CVχ?n{KyU30ѻCxTk8 7jE}%^%mjiDS~a㬊VkCB%eȾLeZr6y$#6OLylZIq)>A0ר5tXi/1Lb6 > W"%,eEU)f]@T)6SuyB$KXX#[S*K,ZrR*taZز]r1 QhǓ+/ϗuŧ`;K TX#]*/#aF6xlnj۱8=U-BPvG׫平g+,ڥ<9JAA*崁i}4v2CGkJGg fBy~ftE߅S2oB}C_4fiLҕjl|3ӛ\4mnsh0[n7տ x{7\eśCk{ܖtFэe&7ƒHn ~9Lo9?*oX)ex?O[=!y/S!QԅQr3`%O2 ~:@(|o$K`}>¨WD-}UyzŒ&*<nG? Ģx˩!LChiBQ8|Bc<37r`^2 ]/k'D~oF)$OLWO7X 313P cd@FMO(KGK)r>dz_^_'nѬ~Sͦp{m3[lZ'm9}ÑKq(Sl9%yen4Ddѹ\G"Ŗª|q=3; c k`-_`!Y\}E_qL8aC$71'v7d OϿ⑙°M `OɮQ43ٽ\8%.39BHZjtwafV sJkAiyٜ~i`AaTfg:HP>ש/W'w(Tq$88m88mU>x3 4pZ>O~yݙ!0TŒqfpڬ;v,~3 ._6@bÇ6uW)Wݥ4zqc#Xf'.r^g4MO u)K.$: ൅_ bY{_7013 KAk$¾_Ƨ\zQ553Wo O~5Ǖүqg]3oLY\^8'JGvp¾ '`=LELn'2`w|"Jb#ԑ`0DJ_\8 Z7Nx)qi\ GMNP*I0uB%F]<E>RN<2ѩLeퟏP!ɘ` S`)rl~щm6hw, [X14n}f dЄ> 6= > "lQv Vجa+ ! rⓖ)b"v>g2YԻz2HdɀIddRp?v@YȄ&D5tU ͔x4DCBDO6 DS@t34 ' хSq/a'IVKVhǽ:MI&-Yqb `ygc/ I-3#u7DiT/a7 ;`7F~EGB0wb)_9cӨ@F]tJ6N">PZ)ZNĐ B\W7Zz]g+a5stUPV$({&"l5k*ǐN/RcsOH"c6%6$/KTI==m8tCؕbceRBň#)uĶ9`Ft+v&ȮM,{6V.gKpw "wĬ\PJߦfc]D/%fr_ޙ"1'^-H5":~ATӍBkp68t!1-*t!Oa䏸J2YImiJ&Ƌ"be="[pdg*ؘQk-dVFx9192#q^Fycu: eH5}R\e%ܳ\*Ķ4!ᶕ>>R.2"Țiq)OLyJΖ;Crg bn71r_Bb9AwO腬S)G!JgiPd:kī\‚y.#Be{Oh-d܋tJ u?,A<,X`rJey̟ n(q 7֔(?;, 9s}/hn8;iFm(lSx! V1k? d@YF[g`0+eXr-Z&AX& q {x>xT?E.ٟYix$POG V% u'8uz.MfeOvEHXM,q>Nr6ȂF7cXDnZDžY!%)|8 dxyo)՜NQ`UhL&3VL+ψQ#XJd@6.H@: 6I:l|<U]㦫d"%պUKUX8 Ӗ]`)+S/ZƤ=2p gC帒Rue-F%r&7Y(m+m,ÉE_Ge 0/|]$-UHR6\e\[eK.b-q90@>*c{,c>F43m y faʌo%O %_dh ɍ5Tњ m KTW"npf{{o-,ղa9bb*2G*,6-'ʵ[Q( df73 *eMA%)X31V=\?'۳"-Kck#$r;MUJH*i1,AߟYMk4nYzE2VH$; /fdjZX?AZF1hW&ƯOG X'rP}*oEG]+e)c][ -vt6 xʒ3ySN ޓaf\ xOapXQ*Ϲ,r}hG^eOUL/D0O,ll xfw/;/:)̘AY꺦Dsn_W* |!żb7nnVO/L>ۧ`h"7K`3!b+~ɋ]gᡪv՛mV%lpC_tjOQß5EF9fIo,w? ťSvzXRtx;ft_mFZ"Z㩕8iRc. Ӏ dO=oM mEKvC/.lȍ+i1y9s|j!Y)΃ f"Ç}pw Poa&fgww_=>-R2̧d R-GV~n}*qOdx|FcĶnB }&]Xzalol7a~g݇>m5̫C^V@n|mJxy 6 sQ`v.|D "8[B]gb;77,|pBKUy4[ S[<x3Ç{-U_FTߌ-A %r(eN@E 0ϛeק7lr4ؚlp߆;qz@-iv~ $%v*F*h+a& h3lw&FmXfҗV7`$P`/oLIFB_CXbv# ot^8 Ca-+ nt0:XCrm7=mwm0278cowyxl?> 9of{!,0^R֖WCm}AnC8 3 ylF5>dMu3mޥݕQovVCf?;!'OL]\mq'`16پ~3|Wkeo|۽D_M|aSVxVylp\7U!czf%"2ܳ)LwuLP'H&3 H,6%L'P_wWSՀ8M'|{?ʑ" `襕JO'UNsA,aVʸ @ CME9w\Ư}|yV&\.,qbaÆ]8@a7'(wyVoe]Ta-_i#24L}tRL_l YJxTe8وSvATy" E"zGڷ|,`Ab:WY){p=q:r΋3o]0\ C 7k"W½,,.~Q/+Ɩa$`Qm IV J:c6ڄ>0Ӱ8}00 ػmX0mؘ;؝f\[4hn)3!| 6O'[瞏'E8Itl2;ؒej,R ƄڪMpD< 2i. C, I|ۤe.Nq!RC4ӈoaT( *xPN) .2`=4ǖ&lwZ}[=pj;UUWa n.mq?<m8ԏwwõAqzE?macvIxG+g>,U˟bo{֣0)Oʴ\W 1'Ǧ!+%U \?%0c FWP^2=Ό1c}fm+BEg z4tdŠQJ\{xM㤆 +j?o&zp3G g#c`42ɈpWE=yaAk*TV:2PO#H\TYTڄhג1exX2 X l<pȊLlwHNZW.~dhBW{Dp0X0fk}9}ac q*qgd#DRon9VZGH %J<[Wؐڎm}*8t&̸rOQ\OSm?Xǐ 4z7HK0Xyy!l0 l0նDr3(%,7_gю_|<Ű漍|frёfznsFϩ!AG~ ]#?=h.b=0ml|v%JPÐÆ%Oda3]I >C w/Sq= ۅAb{9"(6QsS(1XNp\bуy0_qQvsĽ Ukת5H>gi%?ܡtfG*sf,r-Ȫ%,ya5<ɗ:`&/A1FiF)gXAns9#$D (B/T_U_9Ol` c1$Аj$>2X?xOėgz®)3Y21,-w!ZJX #&!wf଺U"^8g*J=50LUEAnS#T2Uyܗnp C D~3Wa h:ti*K\&~T&BDdXFh]\ )Q^P61T$F#bȘ:0/&&uIʄ ^;}oqE fNfut2±۬f()MH%{%zԔM*Dpn}Bc ~PvoG,ÿKYf7+E* |)! L *zbر#K.w UeQR.B5yu?@/ uFp[18戤I 9[ cpy$ K:LJ &?378bGM%?G-p1rvx+scvmUn}!S,SIwƲ76V>óӾG7"e[ d䋯G0_ğ$ ZDq"];hz˦S(ɖ5ʁ /bÒdkXY(tiP%dh0cCFo]Bpa7:C+.8Qt-\0$x'̫yDÐRX?Њwiw |0DYG}w *{Y{ܱm Ex5\! gwNCl?|)\uvRy)exnNK㗞I~2󓅳"ΖJ.9c3gOi/䖃1r)ks\P,-W؋< LVڢIgpB}{T!3!Kf0)SCXaJorslzJclȋ1(&RV\nHi )^LZ8N•Ӏz{`})G(!jA? ƴT!/ܾ- qWh/܄=r!x5%{\pZ˷Ld*^c?{` +,A{DYMx|1p>³g o>@rosijv]Bx -CܹT,U ޗ~xG{\ܾ1jJXv}!PV0+x)hԻٻݦ ;l‹* .QDiwoCqJi^ H vsɩ¬3 RxNG[-)yn9*TEBU2c3lpL Ȩlm> B 8IF ʺJPq5.wnϱъPW `O 0wXŏ{:DzҦW crw$g w;V# װa$Ji.=Ez\F\^D|/3vN`^KP#JuP'?:+w 9*|{Fҩ)E u8I|tUu>ֺóânKerPǰ0ዿ+6sRc][HFvb#f")()v OwC1~z| *;rpwwX vpsk2N#XE¶b a .`j2aMS: * m}vys5-e6-Ft+iq-nX9_X`$ͼTzzDv}ڇwUi2 jP !|+z ; Ij=\#SJ4#*.!J/Cu[$ ^,#̂K'!254&p\9!l3_vnU@]ǒ'#jKYpJ6xfUahlBan (Xp GXʕ5T^Q4"dm q6Ty@ߩ]Рسr ۰k7o)5n3śT}j6+QILSL&ulZA6Av2}"z+ DT#},aQ @6sMҔԊMT2cQdךj >L!eg\D( J$Z< \Rk5KAU& RsGк(31_JF6xJS0}e@~ה3p+ ^o v Wٖ"AsL֫^;땍&dBr3`J?{M{\һCV 댠*_)E [;~|!!//̫ZiWQ=W:QΗ J/?UސW2XIBF(p& jPXoK J" 䭣%#S㨘˭'P6e~ U/Y6EU\$De `账 qF"+.c*Iթs]Rkec^ո<15њ)DdE{K ZHap[Hp[]HZE{jnZǸ:匒JF(E[ zmкUXRc¢I\g`gڿ$H+Tz?Xk, BF`5سq"!(*7\CqpH%I\G p^YFָ(0xͰٚn_;oj'Yu0 c|kjF0:c{x$N n IA%ڄ$ {3e^ljfɪ'*QĹk/2% 'P2MMᄿNa!P!Ejf!V&y6MlbI˒嘂͑x=믰%0dlrBkV9xߨJ]Hy؄D- )䀋Zs׃$ )jQ|b: T8K3[R aV&zǜ}1^ȶ

^s>߲$()s=X1"1P4s7`˺Q^º?@(6 sS f/#\2QjcggS7TIRc`&\, xL䂘ҔPR/wFI'ɍjL* aND%q~v;0`[p}`qAH!⟃T8svap |Q NjŬ({GJ]JFlˆb)4$z4,Ƿ?+Ym+)O+ʙs#F`a11׵ 4 'DUS2ӡڡ$̬%T:VB&uJ-HAA@Zv(w_`bU:X14 /;er0U|> µAz!>Pt;fxo(LtId g\0J_+S+ݻ)bZ.3 AsDb %pabyCP}a6[|<¾k\f1o :&_$^5;]!٭X}dʕK+POoLjN@;uzBN"tMlOl.A?BTGzҥ}T&N_q),M.\ k832*+=DNͰC#@•GaI,M.M(zbM# lϓ[FAIwfƳOYYoO.? xza ,IJ`D.'?pwMm,IC>c "PQD9sOkέ@CIX泹YNoܰ^Fy@z]0*}Q95='~y ܆_ ev\/ 2(FeYU #TMϽIo2u HpllmQv[ +{Ȋ7 5SL0E]$Lv[, 55FUipx'CVl7o_gOi`S1TZ!n"iaQFuhFX%K!.kJV\j"0(n_j]o0 hH%7_/9M㛮E1T0GkSF Gg`7_Twp`ٟg@}x:wѺa}Lj6 'S}s_]kjTo'v&xcp蘪^zs[Vۿ$Tf pWi8 gQX*/UHmOTasC;:,GX>*s Gv;&Lu1J-ф9J XȺ(Y%"W:Wi~Z܈\sWuq #ENQ-GJrI ̚b+~Bx4 ,zeLu `2=//,peʼIq-6/BvGG]HxI7Bw' ڄq*ZP)&Lw8Vx@#{+x!p;l"J!1 gVn)V&ԁ;>QL0WGRI/H^MRg^R'7rნ`Gx<ûАt8ï\zyp%&݈DJK MU :L8Hb\#YYՏ׏E,So v1:% ^'.9[&ެY5Z! CRo+יl!kY|+6Ҥbe6gmA>qjWes?Z0wj N8 Q wO֯|)İV<D#ZtraA4g8y'L鷼-r&jcZV4 wSU*PTNl}X'/rNrZ3a$HgȿQoxer/Txy:4{K#P:QGHB.Ykv$SD==SF(T 뜯hS_$m@YAl.e jz2R*Hѭ$07pO#$?N8Cx>X3ر Uߺ<.4$F&-*X̍gnJpǪ`jCt,{8Ʀ 5{igP 5 ňKǂS0qɶO,lHd>facF`kZ|VVE5+ÏFcOYS0^JV`Bh-3h IxP̬3hwg׾BٹxXHBh#^D; SWGF}>k+/:-^VpFDśbkb:EZU_rWCUXR GR&lw=|qmocWV^M􇫧\R.fĶ$s!m DĻTԲ|MY26R~s; ðdI_ kF`MH &*{DlJ/cJfFa+Bxtc1[36'h"_y_U,u3j?~'e{ĪYτ:Z-5ԩ\Rr%,0-5[|NkM1E FArlKeZ1gBQ%tC}y}e*A/j*j!\V!͵W3os6N=ˆ04k@ .l؇tu)Yx GZ6'%C'-=ӻak-5`\<ۅ h&Q)ҨHf):jQ񪜾h;x}FƩ%õuN"8ulV!D2J[13+fI3AJwTٱsɝPm` ylFO:< ^\fyb,2 1g TPdTIlNZ\Nl5;RȬ\6FJDd]o.#^$j:)OC2m$\_|>=U\~wd{Pj'070_QH(cVF@:g*PM5R(p3mn .@aw ByXUֆA-4"t3(ԇ|PϺcvy cgP.OŦ@Q[c 5 (!y2]8cҹ" Q2$a!ꁗ~S5t&tFpULTaÛ1Q/5Un䤨z}5}8ѫЃky/7 B^qvmnˬjR"Pel_4K1JrU9Hb0h|*2ڄ}/IIԧ)ޭUш!fTױnlSh(Jࡱt'cҺ/q!x5S-W+҉#P L Jj+LIq/!nw=ii l>x \2?ugQ$ɝ[I}Xm.k¦|Kw&";<P+= Ž8f&cX^%%$o=2OJ1ˁ7`YWmz7!N%DXΥ K8`u6؏vX 3 +>gebb03YՓg҅n),_(sgI+)S,4!k`SpUCP/m! X$o"\E[(H!IA_[w᭶К. A+ίah| f&-ܹ|2!oO&7yJN2ɋbܼ nIqm{5.fᾏ4)7Ig@6\ `$ЍP)J-X5^z $>+_.2{FJ(MT.>mnikjhX76l)6.K]^/vw&;1|gOUfZ+]{Q5\+uJ3_ bꃢXXC*b%s SBMF#Ŏ(Q²).RXWX2`St?L s˦,l4$PnFlKv 9xmdāh:JFI8=aGI#)Ԡ& Yy_= k@_$88 sQFƽPܠZF$ߠdJ i$g|fxlS[c,6}%Ϸ ބIo}ss̿N9cJ7 Sْ/_B0"ILRDۊhu\7#_Q2vBD4t7H'4cUT~ e[v'E#cǎ ?㳅W}P;!JCp몴[,m#{&lxUIS^_\Jo/.LRn')?K#~=ޜn7` #$i&XY š ^h{,ޱDT$YMU‡ Qo((&iiU:x(E\^v^/gV//CcɀƬubԂE KWB0xXV'gN_Yvx,߉9ݡll*E~/_CBL2rྗ3 K&&AM:5\h?Ԗ j$BHjxnjcUj!8>qޔ46!QH-7lX\Q_W&_XdDTp JkZdtkW]%@1A .q # 0r҆*:nb"p듌Z'(-5 :,fsڑ7QQgN1 + Gc lV;8p|0 k "Ͷ{J o7_^T=Q8u#=)īm}yn[~i#Nμsr=4QJEoN%aXTl-ݾMxߨ!#~i\pbJ&KƇ1lTĬ^Iެ[o8q˗W*hǸbˆ3fCAmHWTQ}`?ۑe&cHۍe@e# $⥹^i^S5srTy`)YM8\K/ (bo橩{wMh rDᔙ RC&b-XR 0+ nTwrÂg .^11쉆7Uzqj׿'>[c<u;3'zase p`[i0+<7grY_FzӀm msPSc>\RoG̼ xZ Bo$Á:``yY6s5LT_x/;g͔( /z-b+1x]qԓ M'֓4!,gx%E5sQ/UH )mهGƚ,Mv2AvK0[|SXKQ3/\YvlN*W.yr})ɧ110R60`|N1P.rW)]Yu~]T8BmGl9T.zQXDN7.k#~Gfh@lᅝ żJжI@T*z)l SqVߡTuVC!+ [H#˪<+DֹR2N]XSWd*d33S1'· $})<[hGg} C<8FfHR!u7͚b+Ҧ@v Xv!n!x\RMTX>>Ʉ|pQu'?ڏ-!mb2\/@;!hbQB@EAg/qP[u7<ٜ 1D3gbp> }V@8QW,3a)Z>1EъqoZH]e$a%W6Psf3:/|÷h«#T%% J3 ؝uY"Hb%^$ƒo!] PuF4E٢W[ fN ҅0>40SXWXʓjK+ƣ/v'h#;¶]oF|C^{kQ(D-㯿o E0d#r"@Xs"5 ֽ4N.ӿ_$4ejuϬ6!#i%-MåL>Cq,ɖR%'O>])yL=ZY)i?Z}tE-1xA'FUmbmy<1MF4Uٚüd5X[ a,; ڭ[+Uxi#xE †{n{^3aELbNӹ [sTOۼA(i0-خCF \I]K<N>wYѕH?LKXȱe9˸r#  Frs䧨hI$*DEEpbMq.2%nyaMh,؆GJPwc$ QΜ'# hӉ aJQBm$"t_kEk^^6hr$~r wX+tq*!dǘ{J6&Cgz#vc [^(,x}l2][Lu)K0_Nx9A'דVB4 Ϗz|FA< ?N'GY|;  ܌TBV/w&Gv$|AS$_OHv\gbNK4;~e I1] oՏf(@c Aέ zow+D wnڧ_|w&X;O8|c:S >6;$>af6 v X=z$OX-q 5 |>> c-ʸsVgέY9|JMbpnGyF/{tqzGiS$|̕| aѵgJóBhQs_h(`L᥻^u2]ho|ٞ#Ǽʫ6/,h@>Jk‚A0_FOhBNӟ]^uxCAc}5B(/@^ z e=kÃ}e/Y<3?U Y gۆvi ӻ𶭍1%n ɧ^Pnڵ8ʿDp݈5Hs rׁ~LH.0]bo/@1'j<S7OppJ J_ V"{꽒]E\EtakSFV/%J:jk X%-QllH` zbvEԶKo,~, ciF ^a6/u0|z᎔jc}2H+4qUn7: x̃ 'i%ʺUW[SFwp[g?DhjL]ա&XIeԩ{җB,!ƂX Z _&z#t2KSIr_C D:ճeqS>JQT=STbؼ& aCkh` ) r(;cbX$dd :(; +3%auL} 2L~E>^#] Pmy o*7ա.Q޼sw,Da]?XuʖׯUJ#P/iH_WQj9t&/ .5:7ha% Zb@'0 r'\ f ov~4W_frB_XtB{}Ґ&W"HNTIlSH&L&Μka8ɀ9і"5g28#. L(&\/Z34p>z[FJQJe.C_sSFetX<\dW\o@KRuW5H࿣Ot^@(d!XxUݍ-AEapJL|/MeW*222ɽxL>3"HD4~R=HE9p'\ 8cc)^@K~.b[Sh A- ,WJgCvY=z,\Cp]Lw~XdA^xEUA˘z^L^PJe5T2֐ y1lz? M{\M{@+"ACO~*%gK)*z8-a7eG5yRGS]|, .F ~`o7wW>nlYcc>xB~Qz9/%|YoFnÁL +rGM~۔6o>n5Us/ $Qp(Su#%\]/Fp:8,ߣuoCfXwȯUb>qkxIWԁ2xQn7,Z\j$J%`|܃ J V7:0{fV6$Bd(~Kڂ\-XQ6;s/c /nۅ]+%C6奖x?\{l(SEAk񗅋)d]ÚBkx߱f).skz,ʏ/h\(R$P9J7H %8Q& `Z$1~W$}(Ļl)ײ? .c Hc]affNUG5I'` >'X {m'{91*-7d~-s=vHGڛ=6hI+<ϋڗE4Zxմ ~늌Ę1Mp`:e8 , g(6M'EB%ۧl^je}{Q>ޢ9R:T=_t) ƥ;k5Z/f^w=,+_)c}^u?cѭ"Xn\W_/=53=|d'W$LQR + ?8g K(Sb{$‰F¿*-ꦒINLh{ C_P\d&/UP.'N:Q{hBiχԜh VB9-Kx~o7 {bDC!6Fp8eH,pl]L3 }96p-ܞDID~Ϯ¯RO-VoL VX LjN.䉭|{@.+waLVV".dqH0Pkg&CXҀJc\g,zEOG vC\jncIRR3dF|. !rsLL+S5VFEɄDƈK~B(=&%cwtXXOY:tnY-V9Q#m_30/M r$Dm%[Nu7"n"LU_^XğDU, ngXlUg/4WeC^*t]U@AMqD>ẲQԻR"2m=ћE# Џ"|@܊8JRAkp0& f@+I@jd܇ǟfE0'x>/fdv04oQ+!xQ/ɤV:}dD3H,-|o<z pqS d-9XFk]3kd6P=aw6:3%:I*b`Iado{ `qe:[RA+UY[?ܥ-+,Ԗ8fRe ?.xW%f"O CTX&Sγ4C#zr/0k|N$eKi\ŮW ײL?!'hrkῷv:g&f'jFHʲ㹃3s\-k {&?ԙ$&S"N? &P>NAM$EEۗ ~5|@@flg7b%/عCUXX봀n căQ2aAeCK 6oޅg}uTMlgi;Q<EgvTc}v (Ȝ~ Naewbq~^ߡ(E.wX| od\ fo Svtkܓ'BޣBjjhlfcHze/f^؉jc˧םXʡw:< `"f^J 0A^Tݭk5$0HQ<8/ك +4uf&.Ԟ28v,U­ ل 2I RfΨ`0Qc%VBZ4L96(m_'DQyӨ+$6[DC,TFYkЙv1$r]6kT53{[ b. (/}, .ʤ .z|6:ȚޗHYMIL-#_SXl~}?28xTi*\yP U [D^<];ˍƒU OAn憼Ab  $56;,g Kie[ MŪVk$*<{nWs+-^>9WU '!e#?ͼ@|tO_9/c/HE^ѬPoYen9}XUoj썳r2`=JF4\2yw{^P0~Mلrf_73w $an"ݲNg(keT)GeC8t( {턂:-"iN6Lc.k M5y&@Dƞ,0,L<# Dy߈)zvlEq%i1E[h&!IDN48浬 l=+>4Ȓ~Ta%Ƈ1e*&b+3N=]ɋ/Ȉ6P!H—.$0> y}x4 2jwir:#[XW‡_|~Ms b'}K0 TfHDM-Y1tvM\4~!$*}:b> EcZ7\ B$>GZ+љb y#B+o!PG Pᘦ5jڟDe=7*` 1Qr@Ԣ"3^md OP5CXQx3[M"hSFU'jat #<5UHy`TZk5&MәS3"X#BFt GB`Yxj;I\@bh?)C|-w$'DHI}(er&ԁE^LPy!f1nE`hk ^x)(>K=*8pi}: =E6,b {t)74UC=]skknQXňd\DcɶfRkϮwI3ۈ(%A0w)pO^~rݡg{:DLvx#jDm5EX`#T]j.xB\H/G_MbE k*$~囸(!b< qoԺx0],<#"0ɋBepXҒYJ\Ҭùpvg'AeBh%(U&a(4xq>\ʹFʽA iీ+_&DS/4 m00I*筺3 o?MXjY( ˖ okm:ayء:8T1W?bj&rQ5 C!&짻3.]RR?"K-.0DRD^1%2Tfj kST_vbhC,ѻ8"rQ|h\1#ͬ_Oxv?"uAv]J8ZnI$\xjah=᠘z +cɞKDA?c,>C)BG󐫓ۥ?~cb=$-zu{-w7ͶS\~E .h$04˧J:w\Zw2~ۖ!Ώ_|Y+ +MJkVq`H"9phulhsz)ƛe_gvl 6ۿٽ t[V4Rse=u,:мYZ9;8ɳ(JibxᚰTX&,)m;<3ZoCk-پ9H^:S'kW$D]X*4r(1Hw=|@ /+<ȃ5k~4F#4#SR)qjlޓ^iǢ~G1aoM[UpwKbl_X[AJxVwT>P~O4ev?k$Es:+A 3,{hN)""NjD?Qꀠ1SI/a җMW3藾P4D)}4k -W~=8?kEGcohsf;s"J2\zp6njxpmnkR#j0Q?hX^283-x) % A :ݪ-}p`( ,}qkbb;]'/~m8śkM6nG1xc(ė@򅡂RHR?CX^?p_S6 8Ϯٛp\+W wȱnmOºZ]U]X>p1 [sq^90ln> mlJaco`!W:~FC9ǂ:iGP%79t:@C 6e3H f7C*FEBX]NA>)kA};<Эqt䚫 ktJq m_UŮSZ?o;%z\Wb20Nap1R+:ΏL',1qXP) ۝RdW_0ۯ |!ZfkZe&W)0صϴ~Uc.x ~~EDg?NVVxX?gE*HVl[IRW_J;sa--8!37R8csḘؒ j>s"e%`ڬ"յ6^Ys'zUiw~０v05gO=Dh"apu{ 7 KtOH\D,F^ 9!iFN 0^,кɼuH,}nL}Tx'ȎŬXLNbۓ 'RƋ(wR(& ҅lB+! #9P0wS-G" %^]7jCٓc|M4T2x Q) ]'AT:6ǯP0k^1S ! /ў!=PB?* z3pٳjS:?/:8akd#:5ְO7]Xm](g7=B_XDg_D> ɗlI&7Vh<9jN܂rlܔkDϾ(QVԥI^zvs N9 H;S.jբ~0L8%ߥ\Y]"&WXjppXTi_:˨$& \T$]Mɀ. POc8Ъ RՌUϕQ)ik5!g{/X)ͿOdvmIkTUq~TBu)5CkZ < HL^ w[Z]+YNj#dHTC_xil/qykSMj" 9`wS(eg2Ad Ǥ Enh}kvڄot #9]Q9D[zDݦzOm;er\q'!?Y~1+,4Hpjf7iZ.4@ ,51&]-c*~\R]W<|uSj^^r Z  Voo>x^@o0tPoV zT׀jd_f`H20|Zpg_VMx/~Dg†<yYJJGJq _~3V1?u yfRʑi_*ؠU^P#] SD T{YU126^<X_W}}2(M3'L\̧s1 ě~lHd?=~^̓z~Zls/jʼnҖΕ(Ry_&X(I{ngqٕ(fpLtFYLQUP].7LC *Yk_HS}b߰kV/X 5a ]`Fb޽Vn;Sad68dIx6'O/{26.XH ԵW(x@'H.">^1{rIM~OD|;g3=G2pDU6iz OW69zIʻ9gaW B}{]whoW0Sy7=\-!۷c Iw'N5\DG{`8{Z@]v;#S)(LVd53@fP}5wY`&=`92gc2Xpb%#LJBۖ)I|Z2.w ۸Aґ~<%&=t*3ڕ+k{ԤPU%L$ "ݽ$[Auw\#RO[YֶCB͵Nրd>Hj` h6?SZ|ЊAFSꧡHk*Q |ԉ<5^j*-m`k!Yo\هofGpf_?='!)GsD*@ֿ+?'!z[ hR>g/y3~,~z;!9V|=6 פ5תV+9`w^c5=xoԼrӜռy{8>ݭYú/CM=Iԙ㤙~gx=G٣uӛ1*כc8kh٩Sf1us4v ԉ"Ƶ +[ju>n+(v:ѵB\'G[q!+[hgb|,Dt6h"3ը.)֕[2Ga`WKp gQE[6ba+W\-7OnխogUǀx!ne*09;7 *缧[Kt(dYo bV# ^}җsJud4UAt]a\lPiW;wV^uՍ}O"RAɘ`*ᱤGzORiOr~ceݖعؚ#mKsqW+ȹ'ID29r=~(df]oZ{ 7'\1t՚=D>=}9~ W9כX.~nʌXaϬzb_e5 dQ0OvӚGxo_yyɺ珷}ºuҮO20򈡃U{p4#^/"/ަvE,_<(K(c( ɢws3\#tkޥq_~g9&fJsE-rܵ6& t[ g6/_'M(q,;rAA}$uxr1J^6,vDa e:4䦥wSHWbcES{[\{(M+"0O7m*G\w)EQ0,=0pTpdNlq Q_E]y_6Mm׽n=߅о^;^L}>\w3Qka3_<H?:N:˽%׊a#s7k対W=~ȀТ__ ^+?٤hr}4֦= lST 7h0+ @4 ' bZlq\Wv~u~wƋW%br؞glOWܢq{jiޑb=zF{(+EPnõ;]lƂ84CW|e5.6 ܠo@=L5yo]{2NW!f8n/~s} 'پIEHՎA_B K.6.O8ʹo,.!.=<_5w,wr[\!NW6(a4ηL 礼Z_C $vl%mA.Y!4k+d1hj6A'ww^k8_v{Cpq닿c 9쟞 kg)NNJ5I> #<'?XG8-)Zj7]SgA|&hxoĨy[C=`!(EIڸŶ뮙lb^]r⹟劋0~ 'XE덋g`e\2.>s9*,y@M6u@.TzSРM$R}߾XߵFϰe/A\7WX+Cb |+}4_LvsЛavv3, ctdZ̔5L1'4AG Fp2K C0u^h;_~#[G74J3+ؠY/^n|>󟴱Uӯ/~rK݁>[(Ss w,fTSi5!Q O}+Q9`7[K ;~C829&G;QW6a~w?~o? ;I{cҍkydj3mN$7U܅Id=wj嘫z7d+Q[xi9\F/ ~/˗X>Ɵ "qU~}5/~|?ܽci7Z.~-n,*1{3v/@jbb 9izk^uKyin9oTkRʼn8j2 y(g[|qCa%xN:`-K T:aM'wظK#LT;(fg02Y|zeȂ LLsW?#\a-Ur  C(-9y Vtľow}ye%[9m|[:-]^.NœD.o;`btԽ?7a~,FZhM8 ]e𩪝mWy{bm9鸶vy=#J7[N}_p~[Mo _Ar7-[1ŔLg|ёxGofGrIpdWiWh(Y7:1M +~Ãv7߀i_oW_#_k/}7k*T]C&>=n{Ҥ妪)@,NZe%-ޥ# _I<]ՖaL"gE ' ֌ ΪV%GY8go p+נ`1y Ik՟7vw}~G{/}5q~凝IנVWPzsPLcXW*°iʅ>i _pi?ok: -[Ggc uV+ Jo9yX8׆h-6 Pɀ8RLիۗtk={P VO4]V]V_l%)힢-T⮿% h6JS~hXKm4&:f)7Ba{47= e) E9X[³x} _Ïw/ *"5X"H.t'\o"fmjI?'2>.QNvjUh: p׶^s3vϳ|8ƏD P;C$w<$Hcbm]o:u,3|Kf uѕ=X1{;QyeJu\9&1_w/}yuIrlX/Y$7'k:eGF+4A_P&LPh~ξd): >΋~zM9+}Vb%u[X:cEE=ÂGҎ5@:` ųgqӺ޾hiVmD8VfОqzX %[6n*)(|Pp8wL_My"$+TBHP+Mj6O1lK]Px|`JSx6S~) K sZ^i]wrE{oIiw  h">!;qx8|?J-IU!3ƙArZc1=R@g.3R1MPO֞3^>k' ᰝ8F:HDHp=ҞF@ff%c}Z/ޤO^&:0kCd'o\T5y7T%9g^8ElR&ʓ5 @K919i)d/}9 ,|`!fEvZ '{Fc3Qfӌ1' k*2Gi,@!b4~i5*{ڔf﷚Zv#B\`^¾=_r 8-҆f6O#8f6lH 'cL5q5 ń Acsȸ_0QM54. !*Tk<8e<)X^@~o^о)W O45=ϫvAބHhF C([##C]^5߇/Dc2ͧ\i p9SiBޛ@ࢯEija"JoEY)tluyXs%D 8P>晆/CP>chى"إ\Fn`KwŃ۟/ƗW:;d$lp,\%8d_3hˡeH`mfazA;*'k[;1]}kU~}NA%\mx p~"ƪL})>N [uއWw-1C n,حCPDxK1PJ^DN :~(˚8%S݀q)Yh[Rab@ \x.y;`e߼{~O4}k_uE2@ q7?YxR*L*`}R1Nm9KFe׽ՂN?LWGko+N4~a"360' t,<6W .}XQKƗ4ıB>{IB/~+?Ì?8b {v4d)Ǖ> 'M~~Ľh/{i( b4?}}4CQN hY< |ϐ,1{4݃m#ؗLOd2EL@;Z/7gmk2iapdfS7a,Rx\)6l' }GcQ6 fYHhtl࿞GU)US3 7,_NvJiT*@g*tpw7߭}}wo_l\?ys˳Q@^ݍ/'v|*uyخbvM7GGr8 {UшD ZZ<1bN0PYx@<,~Ń$D@<~ 7Te%)Q#) +{ю3ʛz_pD*%_ѷ" I!CqE=9i%S)7ȹ'\_Q)k'dNm BaSN*q]߰Yb %RI&uYu).j"F=¯KN9Ǻ?>=s>ZnC9y  )y(j|ߜO3JG~nVm(6'VLR*}H1󥴉X15 Y˂ k}u*10Ʉ*s/ƿ ϧ1BFW0-Ku=HuH`KHt p zu?Iv4\! )E̡fF[ݡP;՞ڮad2BcHRsctt@H*k'J$-ɨ ǁ^Srا@;4ܧC t9iTw{8<-ݶ8߭پ? ՏSCک MeuA+ Mim% _w "`"R$rv(v٪c 57'j"a Bqmh-ƭk= = +N飓ZEe^@j53Y76PuPm $viŠMïFfxj};8ږ[|Hraƕ.q8y34FݪRاS/;<.\-R۩Iajx"( CtKffHwëqxg顬&>V(ڎ&eo#2Tmgfm^;k\`$ o t@{dhOKF@ NP$)vpm~9J$HE3qlvd@:IC`+:}ZOg{YzddҥFCݨҀ&gTD ´h @J$ Ը*E*L+5bY`dJE֣KQD'3^ X9|z\AyԈwɣ=끹Vi=${3DH֧Eآ ^;עzSNy蒽O݃s̚~\pyRIJ$G{*{T{usV&32,L0:s!*)%[b SgzxFFSOKΕ\Ex[uXqw B7O ?g6tiGp4:dy+mG_똈tEf'"Р#$ IrfL?- je{T8fWoRh윲 @dž);zÅxGX%J*vOhK~%=K;%Y Zngҁ}Z W t= S=[e6S>nupߡfxվG`дX43jLI1@n2T=ȋL|S_dmGd ,\yo]2|*SCmpquj0?roq\u"8N#4 ]v),H2W1 t֬ƒ}'[ N`nF'$?E|c(/SRxY|VlҳVӷb?ѰfKaaV5J&ZE\ͦ|[_K"3מAv^OD>m@!:0t!(*$l؂=ឤjs?T(9U)܅HyQUv]&Ac:m-1:k'2$^eXIwX-_@[\K2CC BNQ87K-=hb;x0WAWLۢ ƳDƼVQLPZ[p=]`RVb9|i/Нii/SL;W?'pF]'c'XOMLugߘ 1\;2u*#':tkϬKW%6'P_(*w{CK1);0ԲM^iT Yr, U \^D ~|Q4'uģLGE6|i'=,3. 1]DIT)TY8Zn4wK^X' \SǓq9]H_a-gؽr`|Y*(9SUh[xTbrEoꖞ+pKc=`Ii@`4r㉃'kv@} 4e(ntsr2 u1^r^1@Sq.z^rv}gI }y/?X4FZ֟*>{}E]/x~'ϘgԩkNṭেu{8gc]̞~%+BK",{$|IhajYi:Uto gt`DU=a$ѥ$%4@դ/90^!-'NQy&_߭ο2d<SmODƳsd'!Cd⋑=dg GOGƳOA/>g_|>x 滾("B!yV}3ۚLSis,k^GiSM x\|#{|qyCxdXdOժDQ"P󋟆g?5G/5>_|j}5$<4PQ󋏠gFͳE/5i9٫ ;>OO|ڝo"ve@3IfRл>I(TSnGeI8Ny0{aQ( 9*E8hxGX% ea|eaEYr6i@s`AW pl[n׏Υ#,37wTjy*9\IȺ88YYJ>REHmp:iHB)'[|$@Y2d,!7=b$d_e I ŸIYuˬ/c #p <(tGT"76墵փ@aT$dΆ[sR]HoVu5PDISz:AFG>J= *ڟ+uP^%XA~o hnz<+^q#E,&VQmJf4v{?3m>tsD -~TK݅9Oea8Kܫ~%\u`{7}HXKæfԇaW)z㽒;(/B mm) O *vW<O~}|R/v;Xi(h$5BNg$](1+1Jڵbou'`8u%8Y?ZhzbOΕ`L?W}6 ӋF-{q֯dTzE5ZcRHM^SD (-ٿMk߬wZ;;ں/8Yİt,dXSJy23+vu/9?IǣRNސ=Y֓/ƕX"?h=WI;a}ưe=9Kz>?^/S-T$N>ejdʧ[7+g{jr}myYD3F8"䱳Vhozm[<څxӓph))Xo!opOOo/-./~ޭ%a3- ]A'%P }$;Kh62F+WU+AEF ό-$u)RNnW8CJ\dJD瓋ugq|At>eݪ+bG!]zvgs)kXYLEw&adSۻFS8Nn,|mA(ea#]e٪|(5tO9TN'٦A>ݴU[ }!w腊aϲr?kPoG$4:sMe)Ewp"R<Cw](̎?jo-3@vN5鴭2y/NBؚ4pt*9g :ƽoi[vJr&X"_R!@hkB!=%ˣw^K6$4\p`MYS.zNjV %64{K ?NiC )7gc,A?:i4%VJ\_ xIZ,1uum6kS}q"Њ$}]O/t .X_ژtz! ! ')~CT65G" +0l5 m8׸Ki;~6 U_ 3$B} G fvb Kx.@dx-[P&ĝ:m++CVs+)6bo9km߀GǼ?d~jh2ty5TGF&n"-[D;݁hgufGVo|݅ےra^m[حqu n2~' 𝊋___ߕe]Q]|Ep[=+X)&.68i/<!cQCj]2[%zi`ZѐwHV^gH;.,ZtSF1NوyxS9(۷2LĄDH+L\Ǧ[J@k5,o#|,K9#Sl|d>;YijfL"VA <]0B ~x)#짫fHeV>c$,T>$t|ƷC{~󐱫z-;u噄P\F}#`,g5ԨE^7 Qqho#},#VGA/&d_zji}&]_dcisiqQ8ȷ8ٰ~zjemlՐ>QÆ%(*F W}gd5)VÊOg؁^p|Rg#l~DjsA<ꘅsbZesq(BA!C _Hٽ߷؜ JުkcC7^JaM9f,ڷNt0juzuZcVN?Bxb5{A=ƨP"ˁM֓k't6^DTjX*3PCIg!(FpA sui9YaeԝF5r4Bi Jv4=`)B-hzy} H tA( ?hpKs T6c5ST`Gm, E#1<Й4{'?99` o= LtL9גE5/OͼE2dT1ޠ mPb͌/ ).6fܪ.LnU}pʾ[܋'U]V}ܭݪݪ~N/U_CřCUS.wʾȡ s.>P}CUYE6Uȿzxqˋ7'|EEG>;wkW]Ⱦ*U/x̾* Wej_uIU.>˾*}gWeOW]|}Uvn_u쫲Tgw?5ͬSDK̬.0>CfV'Y]|U361fVͬ.~3¾~}~_Ծ?i~- m^_󫻋v{mWחW~']7zsOgϗ'//2?Ӿٌ>_i;o%ڟlHZ=h#8V$v~2 #\kq5hke^Ce*e .(S}OVi8',"" EvBXh\ؖ{9i a(5șj 8k%. t^eOCBSG.X(n c {}iy6SZʃVi- PkMg^Wɵn1۳-Mi# nzL%OzN}$rG(zkj-Tg M[}>rnLfSxq&iafuolNcR\ OZ;w "6qKng:IP;djo,CQ >tIF=-B>7҃M,[I2&B=<ӛ,ȇt9eɴO!ރ SRT4(ǤA'މJ7`OCÇahvGyAu>b.d֤[^X)CP晲∹`͔ϰ'/R}Xw5lFc`BZp]qrp_INېvk(cV(,fdZ-pLnWP2[ e­F93JQB)G%}5W29[bXu#ǿװQZtBuebㅨ}oOnzYEMj݇bcw:;H{#,EҧEx&Cx2JR6 |FZ}#YXT0y밮 B2Op )M0>A(a$^0"Yl:bo6B,XX~86d4n-m#z' εdrqUUXMz\>dۭ9Qg9ԫk ?^v Ga!ؐ(eʟt se΍Ur|QA*L6 O\#>\1:H( ,ܒՌxSo5l\?U= / "ӝ_m5'wj" M*>:nPgQ|~mwfK7n VPJIX+Ylk76TpR".3 O7o\w..vsۗ2,{&0=Tj 8 l.ñ{HMAi>l'ϴ{P߄4tU En }{[]PgQ@';F Js iSE6XA6Q1N~>W:G_*9n$T̘tƤH{0KxE 9Y\C!ˀM?Ac~ڤ,7ޙq}B'sEJީaWVfoZńN~1K0KW"6v߼9ob+kS6w:m.d+go%.wlZTrvcIm0XSu9Jc-H.,H`*o[Z訪U =Bg4A+ALgjh]WU+ <:olk3]w2\ej},6Lol&Xu10W۰sa -|/&bOw̸GGvyy]0'EGeJw<+ӎqCSŊҫR4pb_Wzv4e/ֿߓFUJ Ѓ~ftm%+9I/|:chQ*].&[IvmI/wmo%$$7t5-fLtyFi"u;~&B}'pa̧ù;;QH֕%Sr(um^?je :ʴ!,(1vO }d"q"=z77كcajt1thk1:mΐriqr$ {R?fgsi0e/:71tB|ܨgA6Qiɐ), MV\ԼSꊗ-wÛg^< R>Jθ f v6];v6 K2U1([OjZ Q&>BlaI).Iҗ4u8 ȈToD1 >oAawBTRYqBeeLː9 sWAsz0i*O\CUHǓB+_@]KΦ3O/ʻڜo2]~JI6k#$WHamjY@GmaIq?\l2/ SP4qoձa.Eܤ͛KGT/zZU5@ʞu"ހ~jq=m $K\[r=ɧB2T~ԋP4:g(ρW}LHy8Dz (4KϰΦ7 (oUݻs4JǠa5قRA= 3d?jO&r4@r]= §盳/ E-||ţ5?IoE(ċODvs=qLؾnٓ䷱wTO8 iVvy\c9 Q>YY=1 M]OXXe<Ak3~4CqkRx|C3t{I/0so6_c\ D㐂ږ|F b*w$ɇ|Mi~xZ\z>Gr QFJ<ϕWG'e\/X97,1܈Hq@xh7R)PpOxd&:"qE8G o:&F,٨d}+2OF@?k~弓}#E\ّavY-к^ <ꚫ`s2h,cD'lYOb66xW 0eM9k&e, eGDy;Ea]0G=c.fs9Q1?%T"9˓^nh!4sWT!iSfB0gQ/cڳ[?~}ZFSuJS=x!Wte˝JRcv 4p[~ I툡bd7b%aX:G)y E)`±Ry)T"&F; >o9 sKK2ŅRķmHJ\l6q㕯Oß D,RWMw;9ךuqԾbshh[{u -|j*uoȿʄṭ-^TF>[dߐ*)(h*MAJT2 5a\dՏk]N2Md|kBG;QWD%(#:~6blτ3Xakb% %T q舕= ws ݩM vnD}s^JC('Tα+өO+ef~0m3T';-Bz ߷' :^Eݢ[5c$R<S*^p(4 I;Ծx.Wӡ^=cm/;hL:õ{J 雐=jfT]|帱Re29Ӫ[1SK ; &*D5csll䱫2h5͊bf~-n.ҤяcPKEk़[h¶VʚT@϶w $.UrVTjwl.E!`5~ڵΣu'gU؏nt?c;uk#l!m+ $:xTJGf7ow׶>y {I܇7 #nAXdnkr`nnO7voԀGbU1h9[rc1:*2P%JӺbqIWF\r=D~ƟHsܚʪ&YG? o;"F8Q"NRzLw?ܶ'b_`Xȼgbokm nx愮l`YKsp/Ns 9-Xc24g(ַ9mfj-[wGma:Z-1> م;$y=cFkߎ//tƿRЦ>kᇲ-(d!-Xiթ ZÐFAD tZ OY:^MXG!\/GZ@FMc9B$0ZX݆M<6Rs/+΁t^$/C *Y@qSrWOm *%acUc8ӗf"A:0[ ;s~Us#?e4=$OP94lO ҃]7:|I= RD0mSuVkёpICYZN\R MI"\pm*[,,l1xmRRύ'5:@,ݚ9ā9Dpi s9Xߘ_ *zZ4ڋq'gR9ѴkRw4,vpr($1/L/hMm $0[GEDjo=W gɖy.[.c xS( 1>S$x/΃%>]% ~&TiXzYyZmn1, iB7jf2!ganT<ۄc2 4q.br3̥z*R:ͦ-Y H$ee\&;H 3I")ٹ^ޛ< ʿ%>B$I^5oy´gaFì8VI}ɊU.>6Y4N@WyR&㘛޾!.aPx4(-y1o[L|7\Ko2 yZPtB7Ih{k(R%:dž=O@ c/ņM`ȼ'TA8\)XyςdɊ]j115d:$3\ϑ]aG d& Z4Q#eDXDH*O#$1KNJK~v1:>]Sn!j)r:J\V.2&܀6%$؍Ȥ$xr1ШP0'<8a21?Zǹ6%u wm߯M닻?/Ow_W>#MsË}҉#'r4-Zx:qzxM3u`Y\jc8 if6d)shǝG ҕ‰iiՅ3= @¤P\m0fv(b]yau6O׷/Ю'i` lͫ~Ņs~Q+,j38៌[fљg:2SC щ[B`21 Rn*mv|ίyyߞ<եd{>#k*ӭ 1O М+Sj#F=Õ镢E؃T#ed-zFwt^z#ä~|EvJ6J+qZuF.NAjqڑ$ @oU U=ָ$cpO In)t q@C|' E8`r<08 D]p7̯^>9?(_?< N "ܩ(5XE/R:?hktH\|k97o8*#(K 43Kk}%xZ5M @IA׃B"}RvWd[Eh0_ZY 9rv/AΪ_Lքh͟n_ߟ-?BMhq3S0YXG}|\&j.>Gxb+E5.mSNTJzPra,ס!t*+"p2yCVKm\l}E5֜S.wL ,>ڑ6Hj P_yi^5x)($>mJYiˌd8"c1;c([x7wˋ۳uwHǏ5_5uw b=8yap//SVջ(;}W-UhQb+yAE YBֽ0r& TR&noy}/.ECt.p^oZCvdž&qMV`hOBrq) E sM45azoxY[/o[a#'\y("t΃v~aV4Ѧ+оF/S.NzuӁ%#LiPyҽi{vwtܔ:saܖFN^nEW(1ȝGf, WRݲ Ii!R)%[eCaU7--bq⥽)m}c_8wnQ~/Z\,'\ݻ5r7>$%0C.9ΦEg:o?vG_OOn!Z gtyd UA!6?$/|BM>qs:ha% YFhT6AVODUCS;3>ڦl}<}`TGf`1bHCtW4S84+UZ:GoΞ姶(bS:qD--(N^K`km\ln\&N ~UXI[8v.kau&ٛ&eѩ,Ӂi+&2{VĘ0d}%)]ky5 'ZY f\.ORXu͓V HvZ.;+*9Tu vq|A<5S;# ;Vi3Lgq :zg8NeAO{:.3~581Q^iU/?ԋ2m,k J&d\#4Mu`/,mF[3;*R#=,]д N7>޷74Wh䒉X67ɯ*+9m̃Bne}>:#;woٍ<';<dYwH/bOM *aI4⃢UrLbqZ а ٷ- (f޵7 GQdeӲS8I;%q|﷜L{im_ۅcTw~IxPu;SƧYMK[A="*;VżV #`\{Vώ,v!)ЎsQ:ze2W%6谨=bVSucϸ"[ `N-nςeYV }0ѣa6!3E|~͛A}@4دc8?6JwNh(chN)۝>W֮Ynm+!b' 77/xHD D!Sqh?J09Nq`N0=yNWU{A*wjhYhɆF4) "[BI y$t&^]s0PJDܐfZ&mxMOLok} u$Cȱ㽕 J{|x eÞGsY 8lS̥d3}e Ƅхuן(o!37ڥ.jx"F|ƞ?FVWqd|'ڤr t'932'wTW6OC|5g}hBKVucIkYt>qO~K#CUxҳ9&-;H о"P$)神 FraY;LYBU@&<5F9kF6.ͳ96akͷPWћq 6n*3xq)L F׎G{Gӌ7 OUϠ)jeRfxԚy Wg݊d&澗-RN@*`Xɵte#3ؤMP.%< bMXi-*R7ֆ.1}JsOk27BI=tT32"2~m|?+l|;~q`3SO-{v3)'W\{rA蛺;(d{ brF!ڵZm2asIY[$,G6Kd yI1`S"a_7fi_<幇)U2S FuM(j;V:l9Z2eJ/)Wn>=,j1t*yϳ!MNr< ]J~5I>r9\{0==x;.iH3ag9ɉ:k#v kcI# %8w̔C ϵU#FS&cZ I}i -Ϛ,grؚymqX<ұonC9:k+A>QC]-w?aJ|p':wXg_5XLF *v`%r-sk&j7i&q|ɝMHފ=cJӬL99-#R&ҁ$8euh^Jb~=欺 D]JE17~ti6 ',̀)ȵhN'z**Zzr+v~mҪ:zD֘߶Mnv~0uɂ<CkmP4te9xcw,©H=bF w?dfs>ZI):_<}KI]OO(A]%^"LmЇ95ԞuH+@Np jZ"  A"HG3'iŨA\mCsWx\\&Zfx f6x'V(/h1,O<̎d)UEn0Q@Sb눲Hܵ# jƽǽFMb(ƀ"}$ ܦ>wJx+(S:̿ۘ# ++XYx:& )za4Q2dl{g?yxW9b74aw^BX7;%{Sm2IO(z"Nu}d3: ]-v)r;R#)yccA Pw*C d="]̣ckLq=ոNC3e3"TVRoz#4,ϛgiF;0wR6} rrN*NQmL*xKq(MyhlOSy72&!|3,1F2doB*H(҉G,!S( a՜? 'Ѡ|5}:ma*͔ǓQO{ 4+WN~)}<3F]G?[O1U>N>4`7w/ēK2M;,cx˞]'Mќ72ȇ%YQ,bZ.ngzVk s9Uu 3EifVɕAӴ%nQ^H3xZBO:W YZmTi MGzŦ5 Eۓy6+fl,hqh}pFGpv"`,_ic!7OTW4F~QeXmeNJܱ8+{]ES wPGO6G'OzT)wZL`X[D®9߂]~1fJEQ:Х=;Ek z!e2j# ¶+؄9п儁V=Ǧ~7{o3t#3Ph 'iVx{ "!mӥoL:2iӛ{0qBY@H$l$dH0+^\~y(xOuڛȂ(u˱h#J&d]2xiG h(vQopeќ؞eqPmdL !_ncq = c`` YDpbTe1(zV,Ug8q1K].СR &UiWҁ)0BzL ϦS%ز15AqϠV`Q' ?DCV 8 vBDha"jakn6{d]m潼 UL;Y?3ڹ喷nt[,@)ShgΥ[` MZt%ȿܸg&kM>G%aG2ݵ2 (cw!$|Rl]#QenZx/LV$kCB7dUl(n^Z$n|V.#~PF}jR*iW&4#: Or1mMJXd8$sdM8Z7g uf%q yyzA"%(8NkI=(M8jǾ M74(#ǚ$$')q e c#UcgG>q6G"aN!;P%ЕĠ%7ouJ@cWuQ*Ɋ}\c@?᭷ Υo0W(^@uBDgQm2UiIq6e.v# $l'*r{:8QjT g2kYZYBt N")vJt$E'|tMU=ttڞGevL;n<-jŭ>e}2 'A;X%` nP{:* m9$ŭ8 ʹg!h`01sP5 RGGG`CH YNg.hdaLM=*,^Ԇ0ݤddm& D7;䞚?/X ՙ`m-@-?>*,LJ.b ;: 0mvw)s,t6-Z6غ1QNu1˖!ywCr1 I8m![NL/@(&{kބ[qF8r`߶g{9_2 Jy:omF&dᣃw:}tZ{:ViS uYߩLxoL'tod D({y9S:t< -9[5BR鄮jm؛(2Aj.ύX10WCC},uMe8F\ FPc#d<7ak2 H ap5K{ ًZ ċ)4֩NtfN6 Cmƀi EFqc45c[Ώ(4ty\߿J PhkH}ÆRI/[4-\!Q^;눍n`SczXOHqkq"##I!e/s i{‒s%QĹ*39Q*VN}٭.g<<M>#^u Cc*_Oz U˨'d+qW2Y9i:%YBX-osX⎓v}+8sk{˟P-u'L]+?!sZ(wֻky쩆TO,qHw7 j)^oޟ0O>;l4CWe?l՟4LAILJnF$EE&@9ڨt{S;Ad2~6(tT04 tP"'k7+p"ԟƯ1e~㯋?Ǡu tww?><0'`y=s&iN-F̲L 9))sLJe.5!.j 9S$2h->7lo76u3ds}2{ʇ!%a©No#oR7'*m<b PDSW;8t$Ӎd1$ h%FG]xXƫt={FسOCNPО"X@Z!Wo>+bc d2`Poq`rz,ДkN"64g: [.kez@"iS,bF'c# ;:hx 3jR`-wh+:zv15<2A(Ʊ' _uwczȢ)P\TN-/1$%,̙PQurZJ$O1ȁ¶WTj@ 8;<U6p^<>XxݞtyumO"{ML (9QQaUP>A}9 xɉ۳l(-!rCZisi ~ya͏LFt`-՗BS6h^Ty#p/Y]N?1jFk,y`&sѵpx)1r*gC=ڮNewӲRbc> fs2>9FW2$o&D)@"4;˿^y,N ӭLpF ڞ}mM7~3!i^yZ̮Y|hD\ QɏA>Xٟ)rS󁠩]dxc'!WʲL9{ZqtA$r\Va$ʨuw&=Fx<t=CIJsͰ?)tpLO -F+*+(6 MZqDGyf0 X|ryK%C} W29*;aϓts}9FU_ULHg󇨜 ]@J>fZ̰gcw ~;s~-:I=F]5KUX,F q=ayJg0rj~4al@WF7La"Yi٦ 0G:D I|Jmqk_{`fTw0eTy~Gvz*cr0DG{˃F 2C%I͍\*"0;V GQ:%2]Dq;]!9[#淑[.稩uRЅMa/" q(:e29i/*Piyy ~1"8XǔX>5"sh%(ܛf'2lX ,S~U"n0&`rRڽ٠0+s5,HL"@R.rNZ7(kReT.6a%:Ps̙XB֙OށL% ֌eLL0p>>h*r344m*zZ,3 ]7)>h` gl6`DeIQ8#\Hy½w,)^uX0YCN7VH&~x.4cimȓ-S8P}mGG~:ECjfͽ2Ewe7O1H#F}^ݝ®3-Z?$QL ({MۘU`%:\QTFoG$`)ynBb:+MsZDx%ߴx)POt% ̌Kơب/)*Lqdn=3U=HKf[f!eVR;RݡQ3G?.xgL{VTWJ;j< ;shajZw"RWI~ 2mǰs [=M>`:t]i6-Hr*"7Hocu BPŲTǷcRDYsL:t)5WacI$TZX RVֽLE2jQ +Hi\|)mF̫ kֵ{G5.}Åo__=ĥfADh^#/.f+۵:lIo!3cf J"M/A 9,Rnebpfʹ|:gP.!M2Qsh;_3`$R>F3VM=[2%l5t?̀#5tm3K tYxYiDX͊VR^zُ0LQENi5笏VA^VNʭϋu_O>`H6 Dyvf*(ʰ 8U۪;XO yH8FB$UBXBz*M 쁏J{i A+8$l[1`Bl98@avpBTOܼspM71%'ڐhHVacxpAߕU4tOgFwΩݙ'8 LQ r[|npY38ѾO31&S nhN rHhx,Iޓ9'['{!~Dc;O(W;E5rs5@;o1:&ےiQ=kh,mky?Fj_l ^*X ƃ4hZA+1Mv߉Ft}SeHN7ݙ+ %Y63ɍQMߊrF]V6I.zj 3iKlGOw9TH<Hѩea=sv )H*GGYu3c-mxDݺJ3(4ǵX3łL6Jz 1%qXR[+.WfJvFP\vɣԨ\#d0>9[wy?v )8Ƌg޷Rͥ!c2E~qYr!DSN9]Bc NRDYBpäz!/M8 ,M\>Vo)-z TԇIO[7͹"^Z~c`-чb+G LѬQˍ-QI՟{)hy24dxYD% /Vg-Q7gz%h#" qChDj,@y |Нa_L'AKAtR\s{40*j3do!2HbuF83.ﺔUu}@VӼY.Ջů~7)Ow/_/:߷ëjo.of%y#o۷ϖǿ]vut9*/6_g7Ȟ+';fNpF[G)1#cm>,4֒| J%7Ny&X$%GcdTm_AūTg 'c ˭p$K RaOf/.-$"`f/ޛiCKϕ9?BQUJI7C9dSxBLG`*V"ʍ*ΐٍ @+DfNE4.cG1eWҙk0Q<^>3\o@9'e8R'ޥ&gyxݔ*=A%tDZ}ML / 핿 q-[[qZ-Ƌ}JӹAZdtFl .Vp0\ڿ=+:_t8<{uU$Nb$exrvs_˫qruXqt:)F'k 2EAE`)V8'XL^a+`vuɉ0QbhqHDUF_ĭQ[ =h|BNX ,j5 {{8p`J5L-60{tr`N qb|jED`ӭ[[du"g#:!@0w[[ZT$_Z+SoFSȽ ](ψc* )?~!/ lV#[7L#yLrfpKUxZ 5Wl]Q| eF~N`uQYxHgX έo_ko+,Qֱfz[乑߽}nW^hg )CޅN3ƈF=`j*B24 :AlS9rYW{XѾJa>ep7zl*M{"B$g ɂ+%ʩ<Rj!q8~=e-Df9@_R`681TQdD&˴h_g[Oo߾zr%YۉQ2'3zoHVGhz ", Du *|tkCYgP͙>IТ + ;VijB5NT':uOz~'FHF"!zcs=B穅7^803hC4,YaК7l2~hmd-HaySN?1ɎQZ?f]k3=tt<RI[2H+ː;4"CV PJ'" s@XRi9Hn*+PxG:Zljd!Zn?z]ʒ LU:?S t*1 kGĊ3o^|;_ۗRG 33f9tᭁ>K#Է13!ڇ!] ;hms>ge:lʼnVQaTV$MHXLp1)^{{0`b =Nsw&7B5#۶1`$g񋅮etGR~1bqWw/p%ۿ zzy0v~$KJY_o-c/Υ ԅT_y@?6Z]JUX{T;yygVXm7.ҤEc2Iڈ I8^?-$)5SApl"TV<;C]KI5M߬Lrkb[Bd]SSH'acܧ[:S2ȘERhTi4` ,/i#uӫ4 LGNX[&$PV'HNBkv Wr5aB <ѭZjLƜ\_JAϩu;2'鎭8I>JX,f%i,#研t٨[qqgVoE\F)]ퟋ7e t)8%m`pbGARiP粀gfɝӑ<|޸D \oջ?^<&l|9Ϙ[i?.^` x׶onP7,m0^ K 67L^  4;!N2 yfNɮh<S3W1 zym>"G=4DopwxD}֜Mi?vi"XcpXJ tuI5\ 1ԞH(Wx-P?רJ)v)`cWW),b NFCZF)Oìr{x mDEmF#l|:Дufq]BZYy. El-%ڝ<QѧO2<6 ah(Esuf\|\F3eJE䕾i4J<jP*C_'-*2ډ[SWw-cRoXKީ[jzb3p4T蠚xq?,Vds>mSytq0,=.?Ɋo'C4] ɚ9 p*3bwoWta (.]^{է+P) 5 i5c]%1y Y6B>EwM!#X6*kfB 0QpHo=I;3߬ww$cޏTw܊$Vkq{&rif_[x̉؀8%p ptϰzOv6NOm hD3yzjJ9WD ,N#F@8<\Ou=^_ Muk#1$ްiB'cY D;̕ʓڬBXrcܛX<;<=drP<7֒nLD*LM jcPTZe2=ՙŒ۸e9^1Bˌڹ!^>"հlUi9_ e [Wލ8{{ܡ[ w0C{Dw4Dj;Ŷl AqPp3J/(=ʔFnE/l*ꯜUpUl78&`YqhåM (H$b9zp̛6mZ'I#I Q<.p<+J)cXxʝ#xZ+1Pܠ~2*UF3N9'~$fϵ?HV=t n|]\b*6roEXrhk4&C9:kO},h]B<=X Gh@t,#hqDTQ;mrDGpJ#?캥Dؿ 9y-F\`&A{Md#l6[RϰOH htkRU~u{|cRPMͪJ0uR÷ չ7gy#.g*\DYs0w(L~$LnO%!=!&Q:1J &|OD܎NP<ʼvwVdwٰ(L[A &x)~a`Q:.Pw_)S%=K+lK 9!cD= a*:K/6I8}2X1Ȕ-;ظ #뷰N4 64c$Ymm5?\*&*6Ȃr:q%Mx 5sc ޛFƒnv+|H#rPnl$Tt[ b*{֔7Θfu.#t[<@mD,ۻoMLJ6Ž 9ḁn[Ϋ8%qJxK9n=7;p[gW5 hna՘^ %6ݓ*G @t~w߽Ya)#``WzV1#O>H4%39b#:g\jVch.ԑkm_+ tCwNe.0NS )nIUW=b7tNde *gSỪM?Epxp]e _J#j,ޝ8cg igILjYS$."LsxgDJ!?d=v.0evΤfh0&CIxZ KȇFT3qtjLHeDƍ~[ow[VR(@iKr3씝Ljao%Η@ ܸf}7ADE/E(O< 7-"OmW @ܣ3 *ޱk=%O\,&ޔNк:mBD'죯MzԘ>(ZRe;__X;h!-1+̀#}U7%dc(M\w7;m2JtHkR2i1_>S=~ɍ̾i_fGoxf!">vwe_*:I+qӘkxLz$Or!.FN߽[Qj?%Yo]2v4,5sq {+OϤ{cr&x`xV)g W 1­ s0zGH3bFs s-|TG()O q 0.솇VjNXM4}LpNvC Z9I>} 㫘CՔx.&[_ "t>)G~K窡O44~qTyn3rBɕԊzh+EgY 7PKȍۥ .v+{A' 2 & w-M~="h0([ 0P|V)uS?Y | i/Edx*x4ʼMz˱$rǕ|k:X*ZtjlK.6'Ȩ$ d{HkC\;P<=PmO^u`Q7{Dàc=8-g}14u+;"xPL&AIG7f1dgdt|Lcn&NH #ho2${HXsN%g42e8%|ҼWv˳cV%=r̊Xfי$ߛ1\.[=*l;6w㿄eH *adS^6}]=ss>Su}y|`K9Y tsjسcre( o")ȃ2P?ʑC78IկXY4{]f"E3 G}Q_઎‘{W 3 Jf4FvC/Ãs$MsE҇\̉&a!c1eODeЗgVlT ӜfMqH_Ѻ25R6&Tއ,1LBZ7Le,z~)ėK}XJ5kpVoM%[{QTֱ'ىpSV#Oc.|X>ptVD»S }i'd[/'TIIX)+3T&)+GgaRJy|(xO΂io U27ȴx鳹[0 U-SdV ЛHX}7HJk<cI1U>@.'uYF< ي>BxB˵X.+!CAOkkbqֵ\AP%(Nm ˴U$΢{w4xf48 ]K-;٣34{PEC'Na~"0 ؇îʔɢw΍ʼ)4}FgSUU Q_6}?' t,5ϤZ(]ǡ$ed؍`8i!|.aKXѠ`Rj!H`B4R;F,Z QH^}$K6[A ˠ%PaMv$ne) Tn sC#r-)mܵd_yof'F򴲮R /P2,@i>nɱcS9OШ!b&QFD4YU91l:R|L^T8UI0;d~A'&F)\] MᖭPW߬&UT2nrA.8xߏ]{)";O*UΘR,7\ }A#9o;;LT.LkmLH=QHefQl{8X-/2`dFj=v$1͒5~f'8W[2TfxX%Oj7 ,iY3)XԦ =<:'KfU 3r|B'1 ̛l+,;ꚡ7|U?39.;Kl'vI6HD|aL:j  ́>(>](s >h̅c,<$LcU>rur%:n<m\djFNh宅QY5Rm8g?۔!!㒃ZC"cz2d_- !y t@D⫅ ?Wf}p$!I7Z@1jq_Ee_Ywv]i$&3B466VB4"@9ٚ1&v((h*s"Z'Nra,~OiuQAw<ț Pl o 湖ӳL6١&U.KRGmYs:)ʱj2xdyjd չ, 췫~˒ދҦWrgbr:9`zo1\/;Jo=L_̉k ?vP#AOdGbg$_D4 k\4T@x]sxrJn$¾z@97y߭=t bY;/ksrvf\t#˚܇Kg3nC>򸤌`Lj!GG/XY֊Ȑ y wr'+}>zs0.,IA&kQ;=ca.^6d3~ݿ^̹dh9ק[f ЫFŰR=QIW/?g]'u'K6.#%Z>l/9v+ZǯsODKgG<*f<! r)/ Em: )p]2;gai6q8Dz DRnrx:iK!{䪳'Jp:0)AtȺRiA:KD>7OX؇)߸28dPa3U a/\j{WoG^']fј\omUPf( ]CXb| ( Tw5&p'g_z/Q 7}RnV#wÄ(37.:QAgųIS' HWbF=exaM@6g^ TynGV9YRC&wQUh־(PDsy4Xy.‘B|^Vju1zbm7k M?B\$lCgD6:^P}`U2dmBFYf )OBw,נg岙V͌RI꺕u2ȾvDi߯ߒO;Ƿ_ O}FCjf|yctîCGۿ7 ぃ?3^JݽMc~ 8[-j]>-NmPLqK}FkCɚz9l]x%-vpXUFkJM)>P9;^ZlsHzVpR;ymzepӗoeeG <<#=+RFWe)ڜ3ܝA)ވ)$ʞ=ԫPqM k*78B:QWN r1ːFf!t.JRO0 wcsK TKVD-ލҶQ`Se'/.W8מWEx‹Vjڳ=KYp8kdJ'80f̜F2V%;Ck]%Ee)A$0LJ UrTK>l' >vFA}`hH>E"jS{ P?ܳͣq(LvDdRe ";N(L #ЧM(ޱԻI:wqAL%MԯD:ڠhWytuy2ud>X݉1=vdN kпE z]2n:fv ` T] .FNWD=An*!`ػ˙gq7$\=Gb~= :hϜ\mV\ZoD'9,8fd֦AqiN(uض1T$ Yy*J`ueüdÁvvId=eCs<f옟 "4@ J3BH"F f H#3ỵ$"?gH]&Ӝ`Ox0խ6"Db3>}p&X ?P|N)~Kr f?:/Oo (Wl攕F6e-%Jc?gds l)&P{,=D*Yup c`=4'hspyoc%j3GKrISk+]ҤRǑL.SkA& &yf r.DƧy( 8.ﺹ3poc|, 1ُ)M!Y~&;LA3OZJeYWs8Hҩ)F.97ؒHG?(ްkǒ56/ݡ=u׍$[ ι:rh֟G{]h`.5 c,ix)2gb#\ӹfmsO|()8; i2*ud tIkVW~ɖoE'Sq)*CK~noD~M6lf)`~ Úu29Fcoi7F=(i8r< u-XFpͳ Hox5.P͞;L5X$͵'J}7@:s ;'#烩Q:oSm^s{j`<@9y9,U&OZ|ƸsrOo{y9g!8%_y<0jwRM&,|h9]Y5Էۄ{: o14z}:(UҔq<()]+!< b38SL;yNfdД[LjUsӭ6Һ3Rf'۪ Xi5r~P\4b/MP7#GxT2~Q%! ʂY,)F,aP4NIhdOI]nFnCv(!g17<%J~#l78YTe>0f,"ԡ"nQ jKE;8@N넹&qwr;#+l(%P r^RN<mÑ ُmC2y$Ǚ^<iɰ 3ӭ;m_&u.Qn |=tVf Rjõy_w0vU:f^x5WG>?) {=f=ړs@̞& ^nLL:> u_$ؚaMZvGO &y !pMJ0UVN6U/Pi[:$;l 6rpJI"W,Q [cBaCe^`pЇ[H0_cxݐ$\npZmI?{RmpuJ.qSRQM+b,U 6Ilx_MgE3Rs=΍UMJƿjG&*)\2>0՜ ~"'`:fA]oO_s3~ONWK>!#)`~o]*v3c.[ Vx t\l q-Kj " su}:""~5z[ʝJ߱W+U⣾0V8݇ ԥPTS;J3̆p|cbV^zyaT3ʶ@CP*"r`iU2/k\z1f}$m{?k~#]kLB21!yHk}lFۿcƺ=_J+Z/@Zsx_8q0;aّV]@r4E*ʈcC|u{mLF~AᬝWjy NoYz)r{م=jK! ~_A/{"ѝWcs1$[e+F4>ekx>߄͇/2+ }>fz6ǘ6V`i*;a'4PL.$P 3jnf#VgAXkO+;ĭ$ ûNnfsIҷ>bY ຫ}uK~h֕r/kjeE<8~\v>(Ox!q .EX,&_g2WѢ% moC u}yIh/!q=6Ne+O')It+4NvE~df%S`Qz $mAɕ_)r'QЬt=Qo/9[?%}1֓EZˬ r~y,kܱ(XXG1/߿ohٲQ\^^tRknQԀu z-h}xDrT.67YEߵ@S|X(7eKCz>D.[n&?$2iz~w=S"]}){R2iO:ҁ<\Ӷ|p{MwO)dž x8c BXMak6zHL<"ķXś dq4xt)uz_ rNnrRbr%4]luڭ_+H"|ίBUÁ7م(ٶgq6j) Y\< Ry y5AQ/iֳ$` ǩ@=H`MehBWoxs*?_D:X/.%Q//O}PH0ZՐ(G`jyqznvpn8+H%ԑC\jcm@9"al3^(ƃ FKٿ`Y$ԗZ(zsl jlXBv X\Zz*H \Qq=gKÅuRj2)q鯀A,/1MK8 r0{jʸ~`C=<)V|]$g (Ҕ0CK_ 3{^DwkhyAZ>cأرEݶڨõ|怘nлj)u}+d] Zu)닝_o 7bGVg^sfb]`H^{Ks d33Yy- \{|[0^vw$7a=d]ؓ{u] ~puQSNV(" XƼ@u)9r#]7/>gWG"$_՗bIӧ-&~ײ}1=. C8(3ٞᦳeoArLj ʵS{1 qm;DC=At]n? ' N{c=Gxua/"~(fc(g:[_ɣ|y"m+\<6c&/`dZУb@ur+o%؉HWɱwtƱ$nE 4: .Z1>ͬw5,]-u=׷][_9Dюa6ryC)J쨃xe%H)^#W8 y'DӞƝ"Z34 @Cesh ( 8.fټH _ -f.UoJO"zKL'V\ˣ›ץû2;En5>N2KRMjЉ;M6a,9N˼'@S H!PS)}:|a3 RU_h3v_h_i0'%XC lSXE^oWwo V۞KasdEcN/gF`'xY5Et~mEGGK~ԯgxeSBp>zzjn]D$U*)$Æ8YuPV#Fq\P\*e;;Q@SEdt_ !ٹ 7@>{m 㷟$5DF m"2I`v V8[rwxM6bG^y.0`iջDoߴotbq=P荳1[h֧~iQY& cAe[u$ Gsb4fU[ch ѠN Cʹ5T̿prȣOxH+nt*~]g yZ) /IUjb'WF U f/1YgݢثRLW7jV_ߌ-h P'+߶⏝O{gyG>U0r_frt6f(o,S%$}vIZpƌ7n5 \3-bJLmY*?pc IRL=it2aG/n𵘌/U zn:}a.}i! fQKiY|44F͟S{&`/@?WX6 pua5|X^k9.ٷ ^GI;n]61$38s^&DSI{0᫪cNc?2Ͷ$s*V(lƒg~6R㼎p'fcdBW%TRxYfQ:׾ײgU5/!EIVu6Spjmz?x]MvDtϰsֽrw`Ձ̎r5\HÖyWlaL 3WPeeV NْH6DŽ\I$E s C(ЕMVjcDFv$計tEp8vvTyYF'TH|MN΋y>A:G=F1Eǒ$JtUF2~>lvHhmCO,A#5 ٸ:*~gS:/c>sե' YZvMu`:DpiibAӫσ%G* BuDPdMs\|)_o[ʭ]*Z4ff1WG3as͆by^wS$\Ah‡GCa`xP&v /&d&!DЧpwiR><:: 3&,JSPq/ѵ!&+Xαbn ]u"ZQE {5B$v_! PQ1^JCƨ琫bY=y \ Ru{ -'3*Kr2uZȂV^Mq<,u`2޷/vՃݲCH=-6ĉt[L·?|py?h}o[їC?N \O>K#*dȴcȺRUF`fq9w&FlVcFq&7Q`T,gc(96K7q;싪Y%l:2ur?D&B`-{-'RBhT?_T>I# f` oup͙hӎ}'6F+q|ik", 0 C,d묺L> V3extnQ(l{ B~a} "R$qLΫ\T xҌ΂0ʆC~({ ՜*0fظ&. q+ACg;]SYhҦNO6?#f>&'nfG'3CN] THUo0 ~~r &(*rRgȩ(Ngcr+=,<Ž@U1GsE z|j} ؑIbXK hQ{͢JbSh07g4=}h1KW& 8V"CؑI_5弢'hvl Iwf%A&&lNywIm(]mJ85% ("_e{ڠsUz/#(˙UږVs60G4;߻ ]\?al>pSenVmpoC"mmFF6 ;T=!5wptN sB+C xP)RYF\wtru1Kn}22Apap4I%e#9%Tt؟lI/zs 8]ipydMHH BZxJ˅=bM"<7c52/&Inp EfOIed-߲.\'K`g94rU]ZO5)#_X5?#4"T%;z_?/gtVg8^ig;ZُTTЩ$B% eKcf$cw.F*9q "[.Er?!) :||D%{b"l՝2"'@0۱G$N}߲nBZwRw|Wꞗr@%-R Z:1 I/!J&ؕo۳5*, 0\;)tQQ0#ٳ&=uޱ? 5 _>׉S@H]Թ.O7+ߞLB &"2$ҫ\U;HBd?h|HNip ^JU<#qzm7h+s!1ɫL u ]Ol>th uG%MSf+ld'{h9<º]I04^{9ޫ=Wxx30m9r\K X UOwݬ:Ưq}bfC/$*]L|Z8 _jޕ'w}t# < cf]x~t7Bj{qY^.Ke!͍:ԶI^^DHhim-[úQƐ'loC.o髍Ncnwt҄wpVW\ĭnPblAn;R749K>cQbS{nub5819gz$'-/@i~wA@U YO0QըɌ$o-ٝ;"_ɩN<)Do@^oqӭY#va] pf|[FEŽĒ>ØRgbƜU&ӸCԔDp򦂾Ǹm8 r*7 =|* NuKFG-619g1a|6s^̙k>Eu$ve>/> !>826L\"]2SC@p$.Sb򞨩5-L](Ab& 3 `} ^ .R_HӓuԖ\n = nF%@²Rqx_J&џ5E`/;U`bvX\*3s/ ]Dx^ Mh\|ǀW-571)`[To "Իԭy_~TVҽkKLVKNVÐexjl3\UNiK@)8ʲOײִis98 `ڙ!"et1ZP"7-@M:h3؃ Vg@O55b5ye6&hML ]s T<ڢߑo? K7'ܙ7KsÂ^-jʣ5(bxRd^"?7 G\:Hxi uER\-jsjgU +o\{ӯPxl -E'_ ;cԘ~[z[0&Xd˭=N&-2 .T..oϬz$\M?vܸ}1hFBmKDEp8U0AlkQ#Sf_MwSP#{H( R59Y\jQBv($JWb82e"sSG싍o&2}rv3O}ybcZJє0ybofZݷQƌvudL@"Z, Gr$c@NA Ƒ-xv?6Frޮ2PZuChdkK"jad' a9x3iZv-xs*孌8і\P*蜦Ӌ5R Zޚv"UkAݙ ,m'Q50! V"$TAlJЧma(^z)5B,)y.IF8%YdOD1q`yXTv1f]"m:l,3XeI<WS2$YzK'uT]3i)ͱY8<9iDuIiU8=ހm1:3`={*6)ljUڛ;E&P N% xky @U4^}tBS|G ^n9`2ؒb"`Yyp2*@VX/ T+TTc tt퟿߫E셸 I2<^I)ɾ.(gaFg>b t0u1GMC#Bq.r7ߛΏ99 ھ`=h`1G&$ՎirDSsgt}.7mQ #*: >21鿘VtKW_e+l"9\]Mb5iI&SX=^m ܇ Z- `ʞ-K/YtGǞ#N8+IYL;TO}~baiӳ̚\5.Y} xe[D4<[!}bѾGtX1760 P!/ AIb\wJR%UY}jeBWzm:UMޙ~dv`D =)P.zZΈV'2Ê !vب_lSMyJuVhq=%6odt^6Xΰ6t{\zK m.%í7|m<慨iy;=ti%PFaZK=SO´#,׎mW's>iW?cUH)x<[+l{r9J9ۙ这ﱽA2' #(0zE  "8D+9X"ZB^qu/¢ \ȨKd2vɑ/t,^V.X3\%N5[A@޻W4o!2ĝgu֐P0߅uzI!mFw 6+aKj!ш^ H6b(OlL: H\"fT-e|E#pOVR4BGҦ2Hy_ {i_L;jYOST[46pteHΑD%](|JO'Ya=<$ fC8I̺%<+9./ >2.[h&x%,$Ix/°LԈm")n[i8%.l5sl# kB6 V%)XƐiߖNr_%av\0R8M'NLCwؘ>6I!/_LqW[[1.uo)^>D |jQ4u/]ti)P %s.Žl "3V=O("HUYL("t@3R#F< TX Ah,~")V=GhWt|by&Y3ƝSH0z77rU)aVH51L`\12r*A 9/)Cya֙8j"X-fkmt,pIjU$n]i7KL`3m;gl'\?-F ŶyM|Q1rs3vɦ=[{0Gfg c5BxMCobWWAt'Xx(L̒^K_'N>PΐQJaGregEwww!#|:RpsӼƔw|9Ua>qgHF,Mc }Tc>55 n#.g9TBoA8ɤK_qg!!ٗE/&?-|>r?1|ssLQeN*N|Q'0m\)9şqD:pk!ڑCܐ\mQP=>mq=C_kbDiHnP` >Ƥ,mwe`AÛf{ a CF-@r |TEjV{)f?Edfݜ[f™ǦDÅi +g¤7%lCۙvchE3Ú ۧ }A=c_ y+DJSfNdo5?8]ůyO%.ӁZ&~]NpbqNH-eKP.03f x;{9ب٣UX ~ N%0*zQ*8?)WK5J$a'e!QX4P4[dZ2Cps&]) #'8HZ5e 5n$T i;4Qd^GϖQjWq !^o?c~/zm[O; р7:70+.x}l^=0-lʓdơ6gsG X:y6_Oaw/<ƚ̢dd&@6j'` {\8ʣ(@ϚS\pl~Sb:l>iD$ϖ}E=me"0ѫJnՑ^$kc@Ztz?'T:stii6ĈLb8ݝ,?S҄_ɨkA*cق!92@ j#ν3A 34K.?YU>D_<'Oްcuʾ.dO`#ce8r(ȃxW+]U{)I  u5vsK1dD9Vnġ&Hy|Ŷ6"Py -vQxc€ UvH2ay{t2r1xWGgp8})(__w)3|Yl8r`BqvGv\|_WM#Oj:{DQ$t+0MBZb\{TiJr4j|HcN\R`1<, by SMӒhCܗwa[V~ۣ ޚ:sO"NCSZz+dοxrn`EP%J٫I[Ɨ{SB7FҮƾ4+:[?BMIv}ۃk >*ZsSCuyD0Q]ي+V)EظV6k\R,݀gRwa^!=fɪ{:K(rSmrDwERlJoͷ+OQ,J}ʣ3QTXWhcqe@mp܊jDIU[sIBAmGK9ƇC>Z_H|~cmG5h=U()Kmo !lq: I2 JѮ:lN3n¤EXs²cεio, i7}ʇO8(δj!71!cuu@f"yF97Jz0|vr_nOV%/vu铣U,} Fͺ!%M]# yY% e2!Tn"z; y>dD!HSoyo`g mTEIo܋55S"Czl؏Xsݦ >"=L˓L%+33?l+>=pC dxV_gC&Uҷ:_K%PpX2TT !zN36Ì+dvX9|1`~ 5Zq4`ZL6j8){ -OaX= zTE) :סَs-đLO1Z/k1r@d{sp Zs_|-֌H cҭ Q vL嶊3s +B>q 5$agΨ?pKNAL#">Mg5L¬a} I|r,LC}7kdVVd˨%%! һ~4g?ީHQ{ ɋ.J9Ȝ (1 jeNSAc5(1hmE[][H!P–w' \J'@+\m.=ۏ6-#$CIQ[jxQ <7=C6FT)o›IzEy"ɓ5!$8sϐ%F>DfHO[rs)I.R"]{ ceU.7츥O2#fF"8W%a;0ކXn4/Nseѩ` f}NIl]v0O5cX].,X\E,ҜTP_/dB`2̌x+#d vRp&*^<3Nf;8A8beM&XmU:)F= .vSJ4y -f ~]dC,f'j}x CYn31X9oul%jqr|$'1kOY7[=4;{%%sϛG "[1F26p .*r:H>"@;5]Q*PqVn&3;o8]69GHx"MdU'I0CWp6Yx͕txUZ]!L¢0[-KuJ%evǺ< !法,+C诎l"+c=dT'+$S2Khf[oe~TVëZיK?ke=0*У X^Rz?Ht>!~U nQLO:6R# 83Zrk`yd ԅ7|}KUCC>vwWO?cw ޼ !x5D׳-K<0/`L̀=D;DXO$ǒ֛R{xH_X밠 (\X*-_6NB)˴grd ZoEf !L8bW k&]7o{1|r ,z277,ީ} .CP!0cE]jO7^#8O_%zjd`A"? 1+:;ndV滿nΆ.H~%6'+PEp]Jl=fc2deXqA:b%Z6 ߈?j^W[Li uw ttx0YH5CD\=` ;3ōps#IMRDJUfAa*/Ǘ1uٻ*{;Is"h#S- cs"+ڿ俉( WA${Iݻ੝N-(=ev*T%Ѿq>J`~VFArMq]tdNN,IIE솱VF7E68LӆS*6 >jm*O[b%~Ȕ6Ʀ|KzsƜc pkpU>Sk)TP`?LSek!\7<7W?{n>~6o?\[ȿY‚|ASyCta692#{VG'EBuCΟCs;vVx@smJkN>qz: wTR߬$ sCg|Ï2DrQr<&UEA/f,܅$8 vςr 9 o&qF~7~9F!GH&Y pmJʓVIVYy9XGU:L>&Avhy;ǺP݄sa>U@94PTܰ!`!_;fTHf .Gv)a&T6 >Q/ee+u&F1J8SEHG48+䶙"~'\{"ԏܴ_ @=7PP kfQk&FHm7?ct%\TfE@ s,2Q/ha9*)qb*sΘTpeOg#:7s8,s͇l([`Aeox8 ܗ)>?VFN;ˆFZpXXIf@ I_ E7 9xڝ7>KaZ&z@p7.q){2]yO_%5TBR^k0pT֎H5偖n9)#~ttA#2`֥lfHWX󶦇5=EI#Ʈ9 jsɑF^'@n@O߇ 06'@;/G}j/!eOĕd)}`jI,"jK3ӯmGw(5/pTd/D^:q>6/HH`N9k¹5 ;/Ա681X %TVLcҠm{24ՔNBIv*ϤK 39ܤ }h=~͎A(Hn0D uO4 3/jknI`U6X/Ⱦm'kt=}qv8r۳c!:]Uv7=TAC.۽&*'%lk7,:,MymI8Nj=av/osMd<`K:CnFKWeq~‡\"gޒXQ%_T4ASS݀|*Z';;|ˊZؗ_S)^tb0Sw$moD/ Ȧ){,SX9|Ag'Π) Wb8mi7$FK\&]=/~[\:~UH2S39 F#Ae|/]#x߰oTR8E u'd|ݦ/E %|SJrۦgK+0B/.>~HOzi z6\2Qba 8ykRzlXEc*!&wgx>x_3b8.Yd:Eјe}vd5{<[~ ]!n} po).7Vn͉EU[=MQd;w(A{ՕYx$݃'M1ķG !9[fx~_L( g!6~`5[r`6Ep$* -{X>ce%=:Gý kܷo,эV}96^/st^ <糖g*wGs+sdHt{؂/0;*BowW$k:>s 耻 (`l21{OTuW?5XN;s*SOHb.$Lq4@YP2!,v~;UΝSj[6wb(,u8LD8YzF S$m`ΏyJЋ":r,7_@Tz4񉗊m]Sһs9&7F<5 1iLy\OVR0gK!N?:)/Hk'K"h\=ut6Ѱšy݆;)#71` +;1)\1(APP'nGX~ B΢?B̖kowgPѰQ^E*cNuhN ]gF N騢 :l<3Z`*rr~V 5Γ0H9%`SSXdW US2^ifW߲>U41` %r򘬴13e5l\K˓?38A,9Sj'M$4c3t2 j3 !8*J5޲o! yhŮw83vi}cYH$0s-!s~]"JF M0{IЎj6PM)05:"ӊYKcL$"|?yiӽ)c)rRmrUw#A/cGk5v|acJJkz229Sv+FUGko+C.MJ`>u/4{9ݗ(\J}bnRkqϯ Tq*LauD\SY݄j`CĞОc"m^.^w{9!r[rw7Yx!5|,SIB7m#GAq A&aJZ.F/3{ϡ ?>z=T^ϑĉ4`6by-H[C6'yKXqV?A*2CBڐ8yi‡>y F}fRjycA[g g0Nzh/R^2992!IIke5ZCK4ʁq@3q]5jDLF"5n 8& j|2!S_&d *[fJyACXQƅ ToGo5ԛ^ x3d YJ%ŷl~!pLxi`x yEJ'i?O~{^/[c1M GnKvI<}M0[nζҜI8W/~S["%)[ǀVxh{\ ΢;Nqp?uRD t6F +7P0m"f4\'KDvZ#yc0q];z;,ҶH]u[!2p4f8G` TUdec f`QzQ)^h%'3>w;VsNlf7f6;9ajCܘePYx OetXs\E}3@ӟv4qqզIX:2CaؿKSdF3Fr #$3@K?.,k97*Dzb̃!`۷v. S*}oR X=ӛ&l<2<P&M9w!V"r? [iCG3(N&YteMS5F^&Jt/ S},ф{ [IGv`f@G+$0p&tW5.ڳD?<3;n ޺ s:DXprJ/OPLTʱ?B="2ŧG~JJ2JPh?:yfmLDWNIsXst~>U6%Kc"it"ZH* =@F!bٝS_%\܉=xyG6.ܩv#)"o[ ֿ؛Ճ힮3l2OZ B@9n隆]0gffF G4y u d"wǰ_%z8[%eAĻӕ.]2E·KkR˰׫BtáG[.d(2#lT8)EmBx o7 )w .F{,U$+uXMNQ?2qRv<,4̩ߔY^*+&#gbs_Am)gռ(%pn+lo޹džN d甇sz -qF!A9yu:PAԳDg)[uoIH9DT?] 55!N9܍Qv ^oV8ivV .J#VCP jR!<) G$*a@&,wH71O5>/߂$7xUZDioEq*u%wpX=|Cm9BY6kgԆo*Xԝ9Iޝw\~{êy&߲i>uMD ;dR0m4m%{j(% MVqctn (#o#3L޳S2oF|'mfdb_A!O:ZsfuY)͋ 6t,Q*̦Di::RPn6*ox"$g-vd7@V#RJ(pm1ch9oE*&6Ѱt-5W~8oX8P1$ÂZW%aGFYC ڣaJ|Otk<E/F.GFe Ԉ-4J^Dh7K5h8'CO'LGV%ZW?@rRq \'DUgy3~/FID."Lmׇil6԰x-b3=a& 2 6DFH;NHR! pjmoHQ ejJӡmUP6X׀ImHpw>'GآK9Aa:!mCmaGQatpA5Έ{khC[|TMYpŢ7>US)zbSf@S}:DU`T-T&׽.DGz76~/bH.z%U:6ssZL+5w*SmY#I &uCZYk"q:(p4Ƌ",Fn,Xj}*7 -G}Xz,Lg/Kìg4G7*#0y2K&`ȩI Rӳ)ȉ%_'5]69,i=>%ʋ=/A~.'~vRlg`i.%PX\ =ziTG|RT̒Af*F6Ÿ ZMHs*$Nom#Bz܁noY?Sy}u O;ÿ,C9KyLw<柧0l',LwG3h,Ez~8*=!ly6 $Zzgu1xcw9Zu==^Z)3T0!@~kP sP&U:ij#goe3v43ôc%iK+~6i`՞b7cN$t3<;),E9<$Z5c9n!FP skA`y(mLC_|o~|W7G{m!dt܈2IgC=Ehia<NjG&n~rH1LKsizPq(xuVS>0@{$fm2%) ̒#R`d/#IuVF8p%9kcN|U=DL0ҕ92Z2g6xu?vH;ޜ7 ^Gy="~ ;.?*Cz[؉ӗ,E tJ+SDQFv-DX3t3_>ԛ2b< }cx2tO~fR_Bo&\&QɟOT|o3Pa+y8D!xaOTR `:1zo=jqUΡJ͘%D~ui<_};}h  ܊4Ĭ=|`L:h م4N} tf|~e)s}8z80a!\ >T.f2{l\mFoh=jP%@q%OUpSPY`x:G#Fg͎n^بm/p@ r |?F>lu 4Y.A)]v.w?E{N)\'} kѻs^ A&lmSm6S}=O|籼sO{dvP3)ͪH =]&'[Jݖ b}@MjAALbJ/Nkᰈ7 FV ܶ7x4ҙzzbaSSmpy*uv":=k-|h- pENnT1[jus¬x?PbhA^W>(!fRsZfd,a$#Ij>J!1{64J|A+i@GscflƠ)@쑜vO*-^wa2XbӱO[}[!,1JdDFHxj(smt:T E <Aw ny°[§YX_L]**Gp⌁ѧyyQsPO4,]//y ȰE@WWE`xU?kR a 5|oH8[I29; fo怃{  z,%^ސjH_^BLj]rI78OF o&@vYԥ&ui~aS@⮀+{^R; y lC}߱$廾#$ĪW&V;]00+IvN>1|P:-ėLɫs(EĪQ&B *l-GZIR0B;u69A4q7=*6; Xq0+gf tCfΪ#HL!N}SyJojeY;Շ9@ywkƽPmM-0rɺ8/wuo$dJD{{A s2ؤ?@ŗIDN0!ZaګpZT@ x~ Lr$1Eᴓahnay"V;YَBi)D"iJ$/TE" hA ,saXW-Rq튧&?K!W/XA &Uj蒛JKWF/'c9o>;bYTKgr (=RA[mQr^o X4|~+-. Tgsy=}|. ӞSv jS%Rk%8u5NsB?sۤ,`gږRC_ùx XU%G% xDWk, o#Pck[ e2hcB]t$: <.|]m̼o*#bD K-y!e ʥo٧ĦBPdU44x_XZjj,y2(Ōtmxы@nD=|fVƾ+4jgVBnv[ aG?Zh _f YJP6Җ\)ߘ&noJꏬ] 6B1<1 C()8j 65H<_ԪbZ2>z;d;$8rX)!|ZUSH g ~t̩b8VrϠJ@RޔKaI9juSh /D / @ ǕᛂFL̐ʮʎ'I>V{;c nϞREE}6|9YL縣x<eY7|Ną Yd$ t1ҽoښlrZ9We Ֆ҂kE^Ƿo/o/v_=M5e\Ҧ+';Fgf3Y6tKJk8#WfbXA&%n8C H,q0ck۹}![؅|fbO^saM% - E@6#$ `vd v"3+^Ht0@MIo.AHB4#^:-UZd 1epް}}6]-l_+}|Od&7fj+TSHdVYG ץvFKxU 4ijWDx|Au0'r*cPgj6d'Y o(!?ȼ2RK[>omX_fhbBKoRD%t{1a*.7zu~'XԡY6 (P@pTW AY2,w5l0/2ڻZȩ;rq rs;~ M& (%-kM+l .JkF#!yxZ5q) size is: 2 * 12 * vttblsz etab: 2.6 MByte (Can be reduced to any size > 101) size is: 2 * 136 * ETABLE Tree: 20 kByte ( can be made smaller ~1000) size is 12 * TREE GameList 12.8 kBytes (default is 200 moves per side, can be less) nextpos: 32 kByte (nothing save rewiting all move generation) nextdir: 32 kByte (nothing save rewiting all move generation) history: 8 kByte (default is 0 size: can be removed) distdata: 8 kByte (can be changed to a macro) taxidata: 8 kByte (can be changed to a macro) hashcode: 7 kByte (#define ttblsz 0) First of all, start by reducing the transposition table and static evaluation cache size, this is done by setting vttblsz and ETABLE in (gnuchess.h). If they do not fit entiely in memory it will have a detrimental effect on performance. etab caches the static evaluations, it can be made smaller too but should not be zero. If this isn`t enough, reconsider if you really want to do this port. There is`nt really that much to gain by changing the other data structures. Here are the macros: #define taxicab(a,b) (abs(column (a) - column (b)) + abs (row (a) - row (b))) #define distance(a,b) \ ((abs(column (a) - column (b)) > abs (row (a) - row (b))) ? abs(column (a) - column (b)) : abs (row (a) - row (b))) gnuchess-4.0.pl70/doc/CHESSTOOL100644 21542 13 3270 5163133715 15034 0ustar cracraftuserChesstool interface save - save game to file test - no - op remove - take back 2 half-moves exit resign first - machine first restore - opposite of save clock - print white and black clock white black hshort - give hint score - list moves setup - setup board. never quit figured setup out. should be like xboard but ??? repeat - show last move a2a4 - move in algebraic format o-o o-o-o e7e8 - pawn promotion always to queen xboard See gnuchess manual page for all options that might be set in startup string. easy - don't compute while opponent moves. must be set for xboard save - save game to file get - read position from gnuchess savefile undo - undo 1 half move remove - undo 2 half moves xget - read position from xboard save file setup - setup board with subcommands: # - clear board c - change sides . - end setup pa4 - put pawn at a4 black - machine black white - machine white go - tells machine to move first gnuchess3.1+ or gnuchess only hint - give hint time - tell chess program the clock values gnuchess only otherwise its hard to keep the clocks in sync. post - include PV with each move as in: 3. h2h4 -7 d7d5 e4d5 d8d5 b1c3 a2a4 - move in algebraic format o-o o-o-o e7e8 - pawn promotion always to queen so game looks like this: Chess Always first response from xboard or chess e2e4 human move 1. e2e4 move is echoed back by machine 1. ... e7e5 machine move a2a4 human move 2. a2a4 echo 2. ... g8f6 machine move post if post is set b2b3 human move 3. b2b3 -16 g8f6 g1f3 echo back with computer predicted best line and score 3. ... f6e4 machine move b1c3 4. b1c3 -102 f6e4 g1f3 4. ... e4c3 quit 5. quit -141 e4c3 d2c3 d7d5 gnuchess-4.0.pl70/doc/COPYING100644 21542 13 43070 5212022460 14610 0ustar cracraftuser GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 675 Mass Ave, Cambridge, MA 02139, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. GNU GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) 19yy This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19yy name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. gnuchess-4.0.pl70/doc/GENERAL100644 21542 13 4356 5163133716 14555 0ustar cracraftuser GNU Chess Copyright (C) 1987 Stuart Cracraft (Copying permission notice at the end.) GNU Chess is your program (as long as you follow the copyright and licensing rules listed in the file COPYING). Your contributioinspire current and future software developers. This document ------------- This document is not meant to be a an introduction to computer chess. The following books are excellent introductions and treatises. They are listed in order of difficulty: Computer Chess (2nd edition), by David Welsh and Boris Bazcynski The Joy of Computer Chess, by David Levy Chess Skill in Man and Machine (2nd edition), by Peter Frey How Computers Play Chess, by David Levy Current Distribution -------------------- The most recent distribution of GNU Chess contains the following main-level files and directories: Filename Purpose ------------------------------------------------------ doc: ARTICLE ---------- general gnuchess documentation --------- ARTICLE.2 CHANGES COPYING GENERAL HEURISTICS MOVE-GEN PORTING ChangeLog ----------- specific gnuchess documentation ---------- README README.font - ChessFont copyright info README.output - how to read gnuchess output checkbook.1 ---------- man pages ----------- checkgame.1 game.1 gnuan.1 gnuan.hlp postprint.1 gnuchess.1 misc: ChessFont - ChessFont for use with game and postprint match* - script to play a match with xboard gnuchess2.book - opening book src: Makefile - unix makefile Makefile.dos - MSDOS makefile not updated, needs a dos fan ataks.c - sources for the chess playing program ataks.h book.c dspcom.c eval.c genmoves.c init.c main.c gnuchess.h search.c util.c version.h nondsp.c - ASCII interface for acsii terminal/ chesstool/ xboard nuxdsp.c - IBM PC graphics character set based user interface. uxdsp.c - curses based user interface postprint.c - source for postprint checkbook.c - source for checkbook checkgame.c - source for checkgame gnuan.c - source for main analysis module. game.c - source for game. test: directory containing 16 test positions from Levy book. each file also shows correct move. RESULTS.p11 - results from test cases on a sparc 2. test1 test10 test11 test12 test13 test14 test15 test16 test2 test3 test4 test5 test6 test7 test8 test9 gnuchess-4.0.pl70/doc/INSTALL100644 21542 13 270 5163133716 14555 0ustar cracraftuser1. edit src/Makefile. Normally only LIBDIR and BINDIR need to be changed. 2. in src type 'make' and all programs will be make. 3. type 'make install' to install in BINDIR and LIBDIR gnuchess-4.0.pl70/doc/HEURISTICS100644 21542 13 14574 5163133717 15206 0ustar cracraftuserThis file contains a description of GNU's heuristics. Copyright (C) 1986, 1987 Free Software Foundation, Inc. This file is part of CHESS. CHESS is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY. No author or distributor accepts responsibility to anyone for the consequences of using it or for whether it serves any particular purpose or works at all, unless he says so in writing. Refer to the CHESS General Public License for full details. Everyone is granted permission to copy, modify and redistribute CHESS, but only under the conditions described in the CHESS General Public License. A copy of this license is supposed to have been given to you along with CHESS so you can know your rights and responsibilities. It should be in a file named COPYING. Among other things, the copyright notice and this notice must be preserved on all copies. */ -- requested by main author Heuristic descriptions for CHESS. Revision: 12-16-87 Copyright (c) 1987 by John Stanback Modified 1991 by Mike McGann Timing: An initial quantum of time = Time Remaining/(2 * moves remaining +1) is alocated to the search. After this time is used up a check is made if the score has changed more than ZSCORE points between the last two search levels or if at least ZDEPTH has not been reached or if the choosen move has changed between the last two search levels the time is doubled. Evaluation: Here is a brief description of the heuristics used in the positional evaluator of the GNU Chess program. Many heuristics are functions of the stage of the game which is based on the total non-pawn material remaining for both sides. PAWNS The material value of a pawn is 100 points. Isolated pawns get a penalty depending on which file they occupy: (12,14,16,20,20,16,14,12) for files (a..h). Doubled pawns (which are not also isolated) get a penalty of 12 points. Backward pawns (defined simply as not being defended by a pawn with the square in front also not defended by a a pawn) are penalized 6 points. A 4 point penalty is also invoked for each attack by the opponent to a backward pawn and for a backward pawn on a half-open file. Pawn Advancement in the centre is given a bonus of about 4 points per rank in the opening increasing to about 8 points per rank in the ending. Advancement on the edges is given a lower bonus. Pawns on the e and d files and on the 2nd rank are given a 10 point penalty. An additional penalty of 15 points is invoked if these pawns are also blocked. Pawns within 2 squares of the king are given a 10 point bonus. Passed pawns are given a bonus for increasing rank which is a function of stage of the game and of whether the opponent blocks or attacks one or more squares in front of the pawn or if the opponents king is in the square of the pawn. This bonus ranges from about 15 points for a pawn on the second rank up to about 300 points for a passed pawn on the 7th rank which can't be stopped from queening. KNIGHTS The material value of a knight is 330 points. The main heuristic for knights is a bonus for proximity to the centre. This varies from 0 points in the corners to 30 points in the centre. Knights are also given a bonus for being within 2 squares of each enemy piece. This bonus is a function of the stage of the game, equalling 4 points in the end game. A penalty of 1 point per square is given for distance from either king. A bonus of up to 8 points (depends on stage) is given for knights which can't be driven away by enemy pawns. BISHOPS The material value of a bishop is 330 points. Bishops are given a bonus as material falls off the board equalling 10 points in the end game. Bishops get a bonus for mobility and Xray mobility thru pieces but not pawns. This bonus ranges from -4 points for a totally blocked bishop up to 18 points for a bishop attacking 12 or more squares. Xray attacks on an enemy R,Q,K or any undefended piece are given an 8 point bonus. Bishops are given a bonus of 14 points if they lie on the edge of the board up to 22 points if the lie in the centre. A bishop is given a bonus of up to 5 points for each attack to a square adjacent to the enemy king. ROOKS The material value of a rook is 520 points. Rook mobility is handled similiarly to bishops with a bonus of 0 points if blocked up to 20 points if attacking 12 squares or more. A bonus of 8 points for Xray attacks is handled as it is for bishops. Rooks are given a bonus of 10 points for occupying a file with no friendly pawns and a bonus of 4 points if no enemy pawns lie on that file. After the opening Rooks are penalized slightly depending on "taxicab" distance to the enemy king. QUEENS The material value of a queen is 980 points. The only heuristic for a queen is that after the opening it is penalized slightly for "taxicab" distance to the enemy king. KINGS Kings are given a penalty for proximity to the centre in the opening and a bonus for proximity to the centre in the endgame. The penalty is about 24 points for being in the centre in the opening with a bonus of about 36 points for being in the centre in the endgame. Except when the otherside has only pawns. Then the bonus is turned off. Kings are penalized for lying on an open or half-open file or if the adjacent file closest to the corner is open or half-open. This penalty is up to 23 points in the opening and goes to zero in the end game. The King is penalized up to 8 points if there are no pawns immediately adjacent. A penalty is invoked depending on the number of "safe" checks available by the opponent. This penalty ranges from 6 points for one such check to 50 points for 4 or more. Depending on game stage, Kings are given up to 10 points for castling and a penalty of up to 40 points for moving before castling. SPECIAL If more than one piece is "hung" (attacked and not defended or attacked by an enemy piece of lower value) an extra penalty of 10 points is invoked for that side and the search may be extended one ply. Pinned or trapped pieces are treated similarly. A special mating routine is used if one side has only a king and the other has mating material. gnuchess-4.0.pl70/doc/CHANGES100644 21542 13 36652 5163133717 14575 0ustar cracraftuser GNU CHESS HISTORY (#include "../version.h") January 8, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Changed the transpositon table to allow 66536 positions per player. This means a 1.3 Mbyte hash table. Introduced simple rehashing. And also made setting ttable 0 exclude all transposition code from gnuchess (for machines with very little memory). January 3, 1990 -- Tom Vijlbrief (tnosoes!tom@nluug.n) Contributed code to fix undo of promotions. And a bugfix RMBLY was to small. January 27, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Fixed nuxdsp.c to work with my changes (Saved games format) January 26, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Verified that the underpromotion routines works. Found and fixed the bug that caused gnuchess to report mate and draw prematurely. January 25, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Received the underpromotion additions from jhol@tolsun.oulu.fi Made some optimizations in trapped and KingScan. Added more comments on how to improve the search. Added info on usage of the array Tree in post mode. Changed the index in the transposition table to unsigned short to allow a hash table of size 65536. January 11, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Formatted gnuchess according to GNU standards with indent. January 9, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Inserted a missing comma in KTHRT. Removed mvstr1[5],mvstr2[5] from gnuchess.c, they are only used in the user-interface routines uxdsp.c nondsp.c anyway. Rewrote algbr to generate move strings for underpromotion. (ph8k or h7h8k) Some optimizations in CaptureList. Changed row, column and locn to macros. Made memset default and introduced a switch NOMEMSET for computers without memset or where memset is a speed penality. I tested this on: Sparc - no change, DECstation - no change and Sun3/60 - 4% speed improvment. Changed + to | in some bit-field manipulations. Fixed the castle-with-moved-rook-bug, removed kingmoved and introduced an array Mvboard to keep track on how many times we have moved from a particular square. Fixed the check for zero division in Time controls. Added BINDIR and LIBDIR in the Makefile to set where gnuchess and gnuchess.book gets installed. All I have to do now is to test if all this works (-: February 3, 1990 -- Tom Vijlbrief Noticed an error in the rook mobility bonus. RMBLTY array was indexed 0 to 14, but had only 14 members. Added final member. January 1, 1990 -- Stuart Cracraft (cracraft @wheaties.ai.mit.edu) Some special openings were inserted and some taken out. A small change was made to allow the program to detect draws earlier in the tree (via Stanback). Thinking on opponent's time is now working in nondsp.c. For some reason it had been deactivated. Tested GNU Chess 1.55 with with Chesstool on a SUN. Match vs. Fidelity Mach 3 (USCF 2265) resulted in 7-3 score for GNU on a Sparcstation giving a 2325-2335 performance result. January 1, 1990 -- Hes @log-se.sv He contributed faster move generator routines. August 1, 1989 -- Jay Scott He proofread the opening book and made corrections. June 9, 1989 -- Tim Radzy (unet!nplab4!radz@ames.arc.nasa.gov) He fixed a bug in xchess/board.c. In a post-game new-game situation, castling wouldn't be permitted under circumstances. Tim made it possible to castle again. May 12, 1989 -- Joe Garbarini (garbarini%kegger@circus.llnl.gov) Recommended changes to documentation vis a vis chesstool usage. May 5, 1989 -- Jouko Holopainen (jhol@tolsun.oulu.fi) Wrote code to support underpromotion. Changed interface to accept ECO/Informator style moves. April 30, 1989 -- Various GNU contributors setlinebuf() modification for xchess/chesstool. check for zero division in time printout. January 17, 1989 -- Anders Thulin Provided extensive addition to the opening book for his favorite opening the Vienna Game. This was drawn from ECO. November 23, 1988 -- Stuart Cracraft Installed new version of Xchess that is better debugged, works on the next version of X. Thanks to Wayne Christopher and Arturo Perez. August 28, 1988 -- Stuart Cracraft Removed a sacrifice line from the Giuoco Piano entry in the opening book; the program didn't seem to like the positions it got from this line. December 30, 1987 -- John Stanback Wrote a short blurb on the heuristics contained in GNU Chess. It resides in the subdirectory DOCUMENTATION as the file HEURISTICS. December 17, 1987 -- John Stanback Modified criteria for positional evaluation in quiescence search to include positions in which the estimated score lies within the alpha-beta window; fixed a bug in the king proximity to pawns heuristic; fixed a bug involving passed pawn heuristics; December 16, 1987 -- Stuart Cracraft Added automatic 'list' upon exit (both in display, non-display, and chesstool mode); command-line setting of tournament time controls bug fixed. December 14, 1987 -- John Stanback GNU defeated the commercial product 'Fidelity Excellence' 5.5-4.5 in a 10-game match. It was running at about 500 nodes per second (typical of its speed on a VAX 8650) and this would indicate its strength would be about USCF 1875-1900. December 4, 1987 -- John Stanback Man page added. Command line arguments now specify regular clock settings if so desired (useful for SUN players). Thinking on opponent's time is now disabled by default. Estimated rating is 1850 at 500 nodes per second. October 20, 1987 -- Stuart Cracraft Fixed GNU/SUN interaction. Chesstool and its features now seem to fully work. October 5, 1987 -- Ken Thompson GNU beat Belle (actually drew due to a bug, but Ken kept GNU playing through to the win) while running on a Cray XMP-48. In this 3-1 time handicap game Belle outsearched Cray GNU by 10-1 (even with the handicap). September 26, 1987 -- John Stanback at HP Hash table functioning. Thinking on opponent's time functioning. August 20, 1987 -- Mike Meyer at Berkeley Mike ran GNU Chess on a Cray 1 supercomputer. The system was very heavily loaded, so the program was not as speedy as with the Cray below. August 16, 1987 -- David Goldberg at SUN He added "chesstool" support so that this version of GNU Chess can run under the display manager "chesstool". August 15, 1987 -- John Stanback at HP Hash tables, more heuristics, a modified search which is more efficient. He also discovered a bug in the piece-exchanger. This would cause the program to exchange pieces suboptimally. With this fix, the program should play much more strongly. August 13, 1987 -- Ken Thompson at Bell Labs Ken ran GNU Chess on a Cray XMP supercomputer (among other processors). The program got about 3000-4000 chess positions per second which is comprable to today's fastest bit-slice commercial machines. Also, he had GNU Chess play two games against Belle. July 19, 1987 -- Jay Scott & John Stanback Many positional heuristics have been added. July 18, 1987 -- Stuart Cracraft Improvements have been made to the opening book. It is mostly an MCO book, containing major variations from many of the major openings and particularly in-depth on Sicilian. May 11, 1987 -- John Stanback at HP He donated his chess program, a fairly mature and strong program. May 1, 1987 -- Stuart Cracraft He added several bug fixes various people had reported. He also changed makemove() so that the calling syntax is makemove(movelist,index,board) rather than makemove(move,board). Having the latter tickled a bug in at least one manufacturer's C-compiler, so rather than write fancy code, we simplified it. April 25, 1987-- Jim Aspnes at MIT He added all sorts of useful capabilities, including positional evaluation in the tree search using a table-driven algorithm, modifying transposition table code in order to work properly, though it doesn't improve speed too much, checkmates/stalemates detected in the search, en passant captures allowed, detect repeated positions, iterative deepening, quicker quiescence search, tournament time controls, sqattacked sped up by a factor of 4, compile-time debugging options. January 2, 1987 -- Stuart Cracraft He added a few more Tal games to the collection. January 2, 1987 -- Jim Aspnes at MIT He contributed MCO variations for the Catalan, Queen's Indian, and Reti openings. December 29, 1986 -- Jim Aspnes at MIT He contributed all MCO variations of the Najdorf to the opening book. He also contributed a LISP macro (written in GNU Emacs Lisp) to convert xchess game formats to GNU Chess opening book format. December 14, 1986 -- Ken Thompson at Bell Labs He contributed almost 200 games by Tal to our collection of Tal-games, bringing the total number of Tal positions in the book to 10,692. Total book positions now 13,207. These reside in bookin, bookin.bdg, bookin.tal. Note that presently, only bookin and bookin.tal can be used. The new Tal positions came in a slightly different format, which we have chosen to adopt as our standard format. All book games in bookin and bookin.bdg will gradually change into the new standard format. December 11, 1986 -- Stuart Cracraft Added "averages" for node-count per move, cpu per move, rate per move to list_history and write_history. New version of Xchess installed. Started typing in Tal games into "bookin.tal". Added "total book positions" printout to "book" and "enter" statistics printout. December 10, 1986 -- Stuart Cracraft Implemented aspiration search in normal alpha-beta search. Speedups of 3% to 40% have been noticed in most positions. Occasionally a slower search will result, but it is thought these are worth the usual speedups. December 9, 1986 -- Stuart Cracraft Fixed minor bug in write_history() Added another Tal game, 2nd game of 1st world championship match with Botvinnik, a Benoni. December 9, 1986 -- Stuart Cracraft Enhanced parallelism. All parallel processors now communicate via a shared data file and are kept running (in idle loops watching the shared data file). This saves us a few seconds on each move since the 'rsh' need not be invoked more than once (at the beginning). Since the shared data file is now implemented, we will next work towards a "parallel anarchy" in which any processor can use any other processor in order to reduce its search. The current scheme with the program being only as fast as its slowest processor, is quite inefficient. December 1, 1986 -- Jim Aspnes at MIT Added a couple of Master games from Modern Chess Openings 12 (a Fischer game, and a Matanovic game). November 30, 1986 -- Stuart Cracraft Added parallelism. Can now handle multiple processors (sharing same disk). Later we will add the capability to use processors not sharing the same disk. Modified README and MAN-PAGE. November 26, 1986 -- Stuart Cracraft Fixed a few bugs in book-mailing mechanism. Fixed a bug regarding situations where only one move is available. Fixed a bug in read_history() that caused Black queenside castles to be mishandled. November 25, 1986 -- Stuart Cracraft Added two pawn heuristics. Reward pawns moving into a phalanx of pawns. A phalanx is two or more horizontally-connected pawns. Likewise, penalize pawns leaving a phalanx of pawns. The penalty for leaving is a little more than the reward for entering. November 24, 1986 -- Stuart Cracraft A user reported an unbelievable bug. Investigation of this bug led to the discovery that GNU Chess was not picking the move judged best by the tree search in all cases. This resulted in the bug showing itself which further showed that the program was selecting an inferior move. This may result in an improvement to the program's play. November 24, 1986 -- Stuart Cracraft Added two heuristics. Penalize king moves if the king hasn't castled yet. Also, penalize pawn moves which produce doubled pawns. Should probably have something for isolated pawns too. November 23, 1986 -- Wayne Christopher at Berkeley New version of X chess display front-end. Fixed bugs include multiple pieces, runs on SUNS & Bobcats, loads saved games. November 23, 1986 -- Stuart Cracraft Cleaned up some minor bugs regarding history. Added "Illegal command" error message at Wayne's request. November 22, 1986 -- David Goldberg at SUN Microsystems He complained that GNU Chess was memory-hungry. A few minor modifications to hash.c reduced uninitialized data space 87% and text space 12%. This should make it easier for GNU Chess to run on small computers. November 22, 1986 -- Stuart Cracraft "read" command was working, but needed additional tweaking so that history array would be printed by list_history(). November 19, 1986 -- Stuart Cracraft Added "read" command which reads a history file (game listing) and restores the board to as if the person was still playing that. particular game. Generally cleaned up history mechanism, made it more orthogonal. Revised README. Added doc to MAN-PAGE. November 16, 1986 -- Stuart Cracraft More opening book bugs found and fixed. Added capability to accept abbreviated-algebraic notation for entering "book" games from files. Added approximately 2500 new positions to opening book from games involving the opening called Blackmar-Diemer Gambit, a hoary line developed by Diemer in Germany years ago. November 15, 1986 -- Wayne Christopher at Berkeley He modified the move generator, resulting in a 28% speedup. November 14, 1986 -- Stuart Cracraft He documented a lot of the GNU Chess modules with brief comments for each function. More extensive internal documentation may go in later. November 14, 1986 -- Wayne Christopher at Berkeley He created the Xchess interface for GNU Chess to have windowing with X windows. November 14, 1986 -- Stuart Cracraft He added a "randomization" feature to the opening book. This will cause the program to select randomly from alternate variations whenever -DBEST is removed from Makefile's CFLAGS. If this is not removed, the opening play selects the first move found in the book as it appears "in order" in the human-readable book. November 14, 1986 -- David Goldberg at SUN Microsystems He responded to a query about dbm(3) which eventually resulted in the fixing of a subtle bug in the book code which was causing the program to sometimes hash to the incorrect address and thereby produce a book move which didn't even exist in the book. Thanks David! November 14, 1986 -- Stuart Cracraft He added the "oboard" routine in util.c. This is the reverse of the already extant "iboard" (same module). These two routines translate between GNU Chess internal format and Forsythe notation. November 10, 1986 -- Stuart Cracraft He added the "enter" command. This causes the current game to be entered in the book. Then, GNU Chess tries to mail this new entry to the book maintainers (for inclusion in the master copy of the book). November 9, 1986 -- Stuart Cracraft He added code for an opening book. MAN-PAGE and README were modified accordingly. November 8, 1986 -- Stuart Cracraft Checks and mates are now noticed at ply-1. This is a more complete fix to the Oct 31 fix. October 31, 1986 -- Stuart Cracraft First attempt at fix to bug which causes program to check human's king when program itself is in check. October 31, 1986 -- Mly at MIT Reported a bug which caused program to crash when an illegal human move was played. Fixed. Also, program was unable to play as White. Fixed. October 22, 1986 -- Stuart Cracraft Pps now rewards moves which liberate bishops. October 19, 1986 -- Stuart Cracraft Added bitmapper routines to distribution. Added version notice. October 19, 1986 -- David Goldberg at SUN Microsystems Interfaced GNU Chess with SUN's chesstool. October 18, 1986 -- Initial release date. gnuchess-4.0.pl70/doc/ARTICLE.2100644 21542 13 14727 5163133720 14741 0ustar cracraftuser GNU Chess: Experiences Learned with Communal Sharing by Stuart Cracraft (and contributors to the GNU Project) Limited sharing has characterized the computer chess community for the past two decades. Occasional research articles give hints and suggestions for useful features, but rarely reveal the real details of the critically important advances. We will here describe an effort underway (titled "GNU Chess") to create a more open and friendly environment of sharing. GNU Chess is part of Project GNU, a large-scale effort in which the philosophical goals are far-reaching. We will not go into any great depth about these goals as they relate to the larger pro- ject, because these are described elsewhere [1]. However, we will mention the basic issues and the changes we hope to encourage. The start of the GNU Chess project was a natural result of the experiences gleaned in writing a chess program. While the author was at a progressive academic location [2], he was able to con- ceive the idea of a communal chess program only after much heart- ache. During the period of writing the initial version (which has since undergone many improvements and whole revisions), it became clear that the best features and most useful hints, the very best of the heuristics, were hidden and difficult to find in the literature. Sprinkled across many books, research papers, magazine articles, accumulated in the community, during the past 25 years, there was literally a void of true, empirical programs. Locating usable programs was difficult. Many programs were the result of academic work in "ivory towers", and hence were inaccessible to the common man. Other programs were sequestered in research think-tanks. Na- turally, developers of commercial programs carefully guarded their source in order to protect their investment. On the other hand, a few chess program source listings had actually been pub- lished, but these were not really very strong, often written in a non-general language, and frequently more pedantic than practi- cal. The idea of a reasonably strong communal program solidified. When we refer to a communal program, we do not regard this as public-domain software. Rather, we refer to a program which is under the shared authority of a number of individuals, the prin- cipal contributors. These individuals have experienced and real- ized the positive results of a sharing community and the rapid improvements that come through contributing in such a community. Further, these individuals devote time and energy to coordinating the contributions of other individuals. While they exercise a certain editorial right, this is usually not exercised arbitrari- ly; instead, a discussion is often undertaken. Eventually, a working C program that played chess was available. The coordinating institution for Project GNU, accepted our suggestion of inclusion of a chess program in the GNU distribu- tion. Initial distribution of GNU Chess commenced in October of 1986. Interest in the project increased rapidly. Contributions came in from many places and people. Interfaces to X-windows and SUN-windows were donated, thus allowing very fancy chess fonts on bit-mapped screens. Also, contributions involving large portions of opening books such as MCO and collections of master games were added to the distribution. Additionally, tree-search modifications and heuristics were provided, and occa- sionally even entire rewrites. The program advanced in strength by several USCF class intervals during a period of less than one year. During this time, many unusual features and enhancements were added to the program, usu- ally under the coordination of two or more people, with one work- ing in a distant-advisory capacity to the other. Frequently, gra- duate students would give up significant time from their thesis work to devote energy to contributing. Their corporate counter- parts would often give up project time to make their donation. Contributors would often enter the project in a very forceful way and then having made their contribution, learn the viability of communal sharing once others had stepped in and contributed to them, thus providing considerable reinforcement. Frequently, con- tributors would then go into "hibernation" for a long period of time, but most of them remained open to contributing and were helpful when asked to reprogram their particular contribution in a more recent version. GNU Chess has made great strides in relatively little time. It has run on many different hardware architectures and has been compiled by a number of C compilers. A sampling of the com- puters on which the program has run is: National 32032, Vax 11/750, 8550, 8600, 8650, Motorola 68020, CCI 5/32, CCI 6/32 (tahoe), Cray XMP, SUN Sparc-1. It is our belief that GNU Chess will stimulate graduate research in computer chess theory and practice. When students are able to easily obtain a state-of-the-art program in order to test out their ideas, they will no longer need to reinvent the wheel. The students will be able to investigate their research areas much more thoroughly, because they will spend more time on the specif- ic research areas they are concerned about. Basically, GNU Chess "frees up" time in order to get on to more fundamental issues. We also feel that as other researchers gain trust in the GNU Chess project, they will be more likely to release their results directly and rapidly, through journal articles, or directly to the GNU project, and in fact become contributors and join the present list. At the very least, a communal, ever-growing program will encourage the few "closeted" researchers to be some- what more open in their approach to disseminating advances. In whatever form it takes, the progress toward elaboration of machine chess is ongoing, and we hope that GNU chess will be helpful to the community. Copies of GNU Chess source and "book", as well as additional experimental code are available from the Free Software Foundation [3] or the author [6]. [1] The GNU Manifesto, Richard Stallman, Free Software Foundation, Inc. [2] University of Southern California, Information Sciences Institute. [3] Free Software Foundation, Inc. 675 Massachusetts Ave., Cambridge MA 02139. [4] Stuart Cracraft, P.O. Box 2841, Laguna Hills, California. 92654-2841., cracraft@wheaties.ai.mit.edu. gnuchess-4.0.pl70/doc/ARTICLE100644 21542 13 6623 5163133720 14555 0ustar cracraftuser GNU Chess by Stuart Cracraft copyright 1987,1988,1989,1990 Stuart Cracraft GNU Chess is a communal chess program. Contributors donate their time and effort in order to make it a stronger, better, sleeker program. Contributions take many forms: interfaces to high-resolution displays, opening book treatises, speedups of the underlying algorithms, additions of extra heuristics. These contributions are then distributed to the large user-base so that all may enjoy the fruits of our labor. The original and continuing purpose of this project is to permanently end the rampant hoarding of computer chess software that has been the case for the past 20 years. Many people have contributed to GNU Chess. Their contributions have improved the program from being a patzer (weak program) to being a grandpatzer (decently strong program). In its growth since initial release, GNU Chess has gone from approximately class D to strong master strength. It beats the Fidelity Mach 3 (USCF 2265) rather handily when run on a Sparc-1 (RISC). Since these types of RISC chips are becoming fairly common, the age of "master chess in your computer lab" is now a reality. From there, it will be a short hop to master chess in your home with FSF software. GNU Chess's structure is a hybrid of the Shannon Type-A and Type-B methods. It conducts a full-width search to a fixed-depth and then continues with a quiescence search for many more ply. This quiescence search helps the program find positions which can be safely evaluated and which are not too turbulent. If a terminal position is too turbulent, the evaluation will be highly inaccurate. Additional searching by investigating series of captures, checks, and other potentially imbalance-producing moves is quite helpful. GNU Chess will sacrifice pieces in order to reach known winning endings. Also, it uses a trade-down bonus to encourage the stronger side to trade off certain types of pieces thus reaching a more simplified and therefore ostensibly "clearer" position. GNU Chess has certain types of knowledge regarding easier endgames. This allows it to play these endings somewhat better than might be expected. GNU Chess has time heuristics that it uses to improve its handling of time-controls and hasten its making of "obvious" moves. It also thinks on the opponent's time. GNU Chess is interfaced to the SUN Windows and X Windows display protocols and can display its pieces in elaborate format, similar to chess diagrams. GNU Chess has an opening book which consists of many variations from MCO (Modern Chess Openings), and some from ECO. For comparison purposes, GNU Chess running on a VAX 8650 is stronger than the famous Chess 4.5 running on a CDC 6400. On a Sparc-1, GNU 1.55 (or later) is probably about 2350-2400 strength (USCF rating estimated). We wish to acknowledge the contributions of the following individuals: (in alphabetical order) Jim Aspnes, Wayne Christopher, Steve Dougherty, David Goldberg, Richard Greenblatt, Larry Kaufman, David Kittinger, Hans-Erik Sandstrom, Richard Stallman, John Stanback, Ken Thompson. Contact information: The author may be reached by a variety of methods. Via U.S. mail: Stuart Cracraft, P.O. Box 2841, Laguna Hills, Ca. 92654-2841. Via Email: cracraft@wheaties.ai.mit.edu The author may also be contacted via the Free Software Foundation, Inc. 675 Massachusetts Ave.,Cambridge MA 02139. gnuchess-4.0.pl70/doc/BOOKFILES100644 21542 13 5255 5306654650 15020 0ustar cracraftuserWith this release of Gnuchess the book file is being switched from a text-based file to a binary file. Where in the past the book file was "gnuchess.book" now the primary book file is "gnuchess.book.data". It is intended that text book files will only be used to generate the binary file. The GDX based bookfile is the standard binary bookfile and should be used. This means the -DGDX compile option should be used and the instructions for generating a GDX book followed. The Makefile will generate a GDX book for the basic gnuchess.book text file if "make install" is entered or if "make gnuchess.book.data" is entered. Larger opening databases can be created using the opening data in the misc directory. If you use other than GDX based books follow the instructions below. COMPILE TIME There are now three choices for the binary book file at compile time. Compile option -DGDBM creates a GNU-dbm based book. It is fast carefree but not very space efficient and slow to generate. It is highly recommended that it be done on a memory based file system. Compile option -DGDX creates a random file based book file. It is space efficient medium fast to generate, and allows large books. If neither of the above options is choosen the memory based book is generated. The size of the book is then dependent on the memory you have available. Creating a Binary book file. *GDX based. GDX based creates a disk based hash file. You must specify the size of the file. It is the most efficient book to use. gnuchessr -b textfile -B binaryfile -S #entries [-P plys] "#entries" is the number of unique position/move combinations that will be kept plus an extra 20-30% since this is a hashfile. The size of the file will be: 12 + (#entries)*12 A book with 528k moves which resulted in 319k entries. There can be multiple entries for a position. I put this in a binary file with space for 450k entries and it took about 5 meg. GDBM based. Use gnuchessr. gnuchessr -b textfile -B binaryfile [ -P plys ] will read the text book file "textfile" add create a gdbm file "binaryfile". Data for 28 plys (14 moves each side) will be stored, unless the -P option is specified. With -P you can specify the number of plys. Less plys less space. You then just move the binary file from your memory based file system to the name and path specified in the Makefile for BINBOOKFILE and it will use it. *Memory based. Memory based bookfiles are produced just like GDX based. Misc. You can add entries to an existing binary file. If the binary file exists the entries in the text file will be added to the binary file. If possible use a memory based file system when generating a binary book file. It will go much faster. gnuchess-4.0.pl70/doc/game.6100644 21542 13 1572 5163061477 14556 0ustar cracraftuser.TH GAME GNUCHESS .SH NAME game .SH SYNOPSIS .B game [start [end]] filename ] .SH DESCRIPTION .I game creates a board by board postscript output file on stdout for all or part of a chess game. Input is a 'chess.lst' file output by .I gnuchess. When combined with the .I ChessFont file and sent to a postscript printer it will show all boards in the range specified. For each board the move and the current score are also printed. .B ChessFont is courtesy of Andy Walker, Maths Dept., Nott'm Univ., UK. (anw@maths.nott.ac.uk) and is copyrighted by him. Moves starting at .I start and ending with .I end are printed. If no start or end is given all moves are shown. If only 1 number is given it is assumed to be the start. To use: .B game gamefile >tmp .B cat ChessFont tmp | lpr .SH "FUNCTION LETTERS" .TP .SH BUGS .PP .fi .SH SEE ALSO .nf gnuchess(6) chesstool(6) xboard(6) .fi gnuchess-4.0.pl70/doc/gnuan.6100644 21542 13 770 5163056211 14722 0ustar cracraftuser.TH GNUAN GNUCHESS .SH NAME gnuan .SH SYNOPSIS .B gnuan .SH DESCRIPTION .I gnuan produces an analysis of a chess game. For each move it shows the move, the score and the principle variation selected by .I gnuchess .I gnuan prompts for input parameters when it is invoked. Input file is a .I gnuchess list file. .I gnuan is a modification of the gnuan program from Truman Collins (tcollins@pdx.mentor.com). .SH "FUNCTION LETTERS" .SH BUGS .PP .fi .SH SEE ALSO .nf gnuchess(6) chesstool(6) xboard(6) .fi gnuchess-4.0.pl70/doc/gnuchess.6100644 21542 13 27161 5545473353 15512 0ustar cracraftuser.TH gnuchess 6 .SH NAME gnuchess \- Chess .SH SYNOPSIS .B gnuchess [ .B [[-]a] .B [-A aging-rate] .B [-b bookfile] .B [-B binbookfile] .B [-C cache-table-size] .B [[-]D ] .B [[-]E ] .B [[-]e ] .B [[-]F ] .B [-H hash-depth] .B [[-]h ] .B [-L language] .B [-l listfile] .B [[-]N] .B [[-]p ] .B [-r length] .B [-s savefile] .B [-S binbooksize] .B [-t] .B [-c hashfile-size] .B [-T transition-table-size] .B [[-]V] .B [-v] .B [-x] .B arg1 arg2 ] .SH DESCRIPTION .I Gnuchess plays a game of chess against the user or it plays against itself. .PP .I Gnuchess is an updated version of the GNU chess playing program. It has a simple alpha-numeric board display, an IBM PC compatible interface, or it can be compiled for use with the .B chesstool program on a SUN workstation or with the .B xboard program under X-windows. To invoke the program type: .TP .B gnuchess - simple curses based version .TP .B gnuchessn - fancy version using curses and inverse video on UNIX, or IBM PC cursor controls and characters on MSDOS .TP .B gnuchessr - ASCII based version .TP .B gnuchessc - chesstool compatible version .TP .B gnuchessx - xboard compatible version .SH TIME CONTROLS .PP If one argument is given, it is the search time per move in [minutes:]seconds. So .B gnuchess 30 will generate one move every 30 seconds, while .B gnuchess 5:00 will generate one move every 5 minutes. If two or more arguments are given, they will be used to set tournament time controls with the first argument of each pair being the number of moves and the second being the total clock time in minutes[:seconds]. Thus, entering .B gnuchess 60 5 will set the clocks for 5 minutes (300 seconds) for the first 60 moves, and .B gnuchess 30 3:30 will allow 3 minutes and 30 seconds for 30 moves. .B gnuchess 30 5 1 :30 will allow 5 minutes for the first 30 moves and 30 seconds for each move after that. Up to 4 pairs of controls may be specified. If no argument is given the program will prompt the user for level of play. For use with .B chesstool or .B xboard, see the documentation on those programs. .SH BOOK .PP At startup .I Gnuchess reads the .I binbook file if it is present. It then looks for a .I book file. If it is present it adds its contents to the .I binbook data. If the .I binbook file is writable a new combined .I binbook file is written. .PP The book .I gnuchess.book consists of a sequence of openings. An opening begins with a line starting with a .B ! , the rest of the line is comments. Following this is a series of moves in algebraic notation alternating white and black separated by white space. A move may have a .B ? after it indicating this move should never be made in this position. Moves are stored as position:move so transpositions between openings can take place. .SH HASHFILE .PP The hashfile if created should be on the order of 4 megabytes or .B gnuchess -c 22. This file contains positions and moves learned from previous games. If a hashfile is used the computer makes use of the experience it gained in past games. Tests run so far show that it plays no worse with the hashfile than without, but it is not clear yet whether it provides a real advantage. .SH LEGAL MOVES .PP .B Note: Piece letters and legal castling notation is determined by the language file. What is specified here is the default English. .PP Once .I gnuchess is invoked, the program will display the board and prompt the user for a move. To enter a move, use the notation .B e2e4 where the first letter-number pair indicates the origination square and the second letter-number pair indicates the destination square. An alternative is to use the notation .B nf3 where the first letter indicates the piece type (p,n,b,r,q,k). To castle, type the origin and destination squares of the king just as you would do for a regular move, or type .B o-o or .B 0-0 for kingside castling and .B o-o-o or .B 0-0-0 for queenside. To promote a pawn append the type of the new piece to the move, as in .B e7e8q or .B c7c8r. .SH "FUNCTION LETTERS" .TP .B -L lang Use language .I lang from the file .B gnuchess.lang. If -L is not specified it defaults to the language used in the first line in the file. .B gnuchessr -L ger will use the german language. .TP .B -A aging-rate Specify aging rate for hash table entries .TP .B [-]a Do [do not] search on opponents time. .TP .B -b bookfile Use bookfile for opening book. .TP .B -B binbookfile Use binbookfile for binary opening book. .TP .B -C cache-size Specify evaluation cache table size (in entries). .TP .B -D Toggle DEEPNULL at runtime. .TP .B -E cache-size Toggle flag.threat for threat extensions .TP .B -e Toggle flag.neweval to force evaluations instead of estimates .TP .B -F Toggle flag.noscore .TP .B -H hash-depth pecify depth in plys for hashing. .TP .B -S size Size of binbookfile for memory based and GDX books. For creating a binbookfile. .TP .B -P plylevels Number of plys to include in the binbookfile. For generating a binbookfile. .TP .B -c size Create a new HASHFILE. File size is 2^size entries of approximately 65 bytes. .TP .B [-]h Do [do not] use hashfile. .TP .B -l pathname Pathname of the loadfile use with the .BR get or .BR xget. .TP .B -r length Rehash length times in searching entries for position in transposition table. .TP .B -s pathname Pathname of the save file to use with the .BR save command. .TP .B -t Show statistics for HASHFILE .TP .B -T size Set the transposition table size to size entries. (minimum is MINTTABLE) .TP .B -v Show version and patchlevel. .TP .B -x value Use .BR value as the evaluation window .BR xwndw. .SH COMMANDS .PP In addition to legal moves, the following commands are available as responses. .B Note: command names are determined by the .I language file and may vary with the implementation. This is default English. .PP .B alg -- allow algebraic input (not implemented) .PP .B Awindow -- change Alpha window (default score + 90) .PP .B Bwindow -- change Beta window (default score - 90) .PP .B beep -- causes the program to beep after each move. .PP .B bd -- updates the current board position on the display. .PP .B book -- turns off use of the opening library. .PP .B both -- causes the computer to play both sides of a chess game. .PP .B black -- causes the computer to take the black pieces. If the computer is to move first the .B go command must be given. .PP .B coords -- show coordinates on the display (visual only) .PP .B contempt -- allows the value of .I contempt to be modified. .PP .B debug -- asks for a piece as color piece, as wb or bn, and shows its calculated value on each square. .PP .B debuglevel -- sets level of debugging output if compiled with debug options. .PP .B depth -- allows the user to change the search depth of the program. The maximum depth is 29 ply. Normally the depth is set to 29 and the computer terminates its search based on elapsed time rather than depth. If depth is set to (say) 4 ply, the program will search until all moves have been examined to a depth of 4 ply (with extensions up to 11 additional ply for sequences of checks and captures). If you set a maximum time per move and also use the depth command, the search will stop at the specified time or the specified depth, whichever comes first. .PP .B easy -- toggles easy mode (thinking on opponents time) on and off. The default is easy mode ON. If easy mode is disabled, the keyboard is polled for input every so often and when input is seen the search is terminated. It may also be terminated with a .I sigint. .PP .B edit -- allows the user to set up a board position. .B # - command will clear the board. .B c - toggle piece color. .B . - command will exit setup mode. .B pb3 - place a pawn on b3 Pieces are entered by typing a letter (p,n,b,r,q,k) for the piece followed by the coordinate. The usual warning about the .I language file applies. .PP .B exit -- exits gnuchess. .PP .B first -- tells the computer to move first. Computer begins searching for a move. (same as "go"). .PP .B force -- allows the user to enter moves for both sides. To get the program to play after a sequence of moves has been entered use the 'white' or 'black' command followed by 'go'. .PP .B gamein -- toggles game mode time control. Assumes the time specified for time control is the time for a complete game. Input with the level command should be the game time and the expected number of moves in a game. .PP .B get -- retrieves a game from disk. The program will prompt the user for a file name. .PP .B go -- tells the computer to move first. Computer begins searching for a move. (same as "first"). .PP .B hash -- use/don't use hashfile. .PP .B hard -- think on opponents time .PP .B hashdepth -- allows the user to change the minimum depth for using the hashfile and the number of moves from the begining of the game to use it. .PP .B help -- displays a short description of the commands and the current status of options. .PP .B hint -- causes the program to supply the user with its predicted move. .PP .B level -- allows the user to set time controls such as 60 moves in 5 minutes etc. In tournament mode, the program will vary the time it takes for each move depending on the situation. If easy mode is disabled (using the 'easy' command), the program will often respond with its move immediately, saving time on its clock for use later on. .PP .B list -- writes the game moves and some statistics on search depth, nodes, and time to the file 'chess.lst'. .PP .B material -- toggle material flag - draws on no pawns and both sides < rook .PP .B Mwpawn, Mbpawn, Mwknight, Mbknight, Mwbishop, Mbbishop -- print out static position evaluation table .PP .B new -- starts a new game. .PP .B p -- evaluates the board and shows the point score for each piece. The total score for a position is the sum of these individual piece scores. .PP .B post -- causes the program to display the principle variation and the score during the search. A score of 100 is equivalent to a 1 pawn advantage for the computer. .PP .B unpost -- turn off the post display. .PP .B quit -- exits the game. .PP .B random -- causes the program to randomize its move selection slightly. .PP .B rcptr -- set recapture mode. .PP .B remove -- backout the last level for both sides. Equal to 2 .I undo's. .PP .B reverse -- causes the board display to be reversed. That is, the white pieces will now appear at the top of the board. .PP .B rv -- reverse board display. .PP .B setup -- Compatibility with Unix chess and the nchesstool. Set up a board position. Eight lines of eight characters are used to setup the board. a8-h8 is the first line. Black pieces are represented by uppercase characters. .PP .B stars -- (gnuchessn only) add stars (*) to black pieces. .PP .B save -- saves a game to disk. The program will prompt the user for a file name. .PP .B switch -- causes the program to switch places with the opponent and begin searching. .PP .B test -- performs some speed tests for MoveList and CaptureList generation, and ScorePosition position scoring for the current board. .PP .B time otim -- .B time set computers time remaining, intended for synchronizing clocks among multiple players. -- .B otim set opponents time remaining, intended for synchronizing clocks among multiple players. .PP .B undo -- undoes the last move whether it was the computer's or the human's. You may also type "remove". This is equivalent to two "undo's" (e.g. retract one move for each side). .PP .B white -- causes the computer to take the white pieces. If the computer is to move first the .B go command must be given. .PP .B xget -- read an .I xboard position file. .PP .B xwndw -- change X window. The window around alpha/beta used to determine whether the position should be scored or just estimated. .SH BUGS .PP .fi .SH SEE ALSO .nf chesstool(6) xboard(6) .fi gnuchess-4.0.pl70/doc/README.font100644 21542 13 23275 5163133722 15420 0ustar cracraftuserPostScript Chess Font -- "README" file. ========== ===== ==== == ======== ===== Copyright (c) 1991 A. N. Walker. All rights reserved. Restrictions on Use: ------------ -- ---- You must keep the copyright notice on this file and on the accompanying "Font" file. If you change anything, you must clearly mark your changes. Otherwise, you may use these files as you please for private, educational or research purposes. You may also use them freely for commercial purposes as long as you do not make any changes to the shapes of the pieces without my approval. I do not, and am in no position to, make any claim as to suitability of these files for any specific purpose. They work for me, and if they work for you too I shall be pleased. If they do not work for you, well, you have what you paid for. If you are pleased with the results, please let me [and your readers, if any!] know. If you manage to make money out of them, please let me know how! I'd quite like to see [real or PostScript] copies of what you manage to do, if you have the necessary time, inclination and resources. If you don't like the results, please let me know why. Indeed, if you have any comments, please e- or snail- mail them to me. What you have to do: ---- --- ---- -- --- You should have three files, called "Font", "Demo" and "Table". If you have a way of viewing PostScript, shovel "Font" and "Demo" or "Font" and "Table" at it; for example, I use the commands lpr -Plwriter Font Demo lpr -Plwriter Font Table to see the results on "my" LaserWriter. If you have no way of viewing PostScript, then I'm sorry, but I can't help you. What you should see is an assorted collection of boards and figurines in various sizes and rotations ("Demo") or a neat table showing all the symbols in the font ("Table"). If anything else happens, you will have to consult someone who knows what they're doing -- *not* me! I can promise you that the files as shipped print nicely on a bog-standard Apple LW+. They take several minutes each to print on our LW+; this is largely because they make almost pessimal use of the font caching mechanism -- lots of big characters are printed once each in different sizes and orientations. Conventional pages with lots of figurines or ordinary text and only a few diagrams print acceptably quickly (especially, of course, if you have a faster or more recent LW). If you are happy with the demos, you can then install the "Font" file as a font in your system. **************************************** * I cannot help you with this process! * **************************************** I can't even do it for our own computer, which has a much-hacked (from its PDP-11 days) version of Troff; I leave it to our guru. Neither he nor I know what magic you have to utter for an unhacked Troff, or for TEX, or for Macs or PCs or whatever weird and wonderful software or hardware you possess. When you install the font, you may also find it useful to grab some of the PostScript code from "Demo", especially if you want to draw (for example) labelled diagrams. What there is in the Font: ---- ----- -- -- --- ----- There are really two fonts wrapped up into one. The more conventional sub-font is the so-called "text mode", and is what you get when you first select the font. This mode itself has two major components. The upper case letters are the figurines, for use in text. For example, "Q" draws a queen figurine. Lower case letters and other symbols are (most of) the Informant symbols (omitting only symbols like "?" and "ch" that you can reasonably expect to find in boring old Times Roman, but including "+" and "-"). I've been as mnemonic as I could, but there are just too many symbols. The other sub-font is "diagram mode". In this, upper case letters draw white pieces, and lower case letters draw black pieces. For example, "Knk" draws a white king adjacent to a black knight and a black king. The pieces include a selection of fairy pieces and other related symbols -- everything I've seen or had reported to me on chess diagrams in the last few years. The other symbols in this sub-font consist of board-drawing components and motions to facilitate the construction of diagrams. You switch between text and diagram modes using the prime symbol, "'". For example, the famous Reti study can be diagrammed by the PostScript: ('#[7K;8;k1P;7p;8;8;8;8]') show where "#" draws the board, and the stuff between "[...]" is the conventional Forsythe notation for the position. Obviously, for practical use, you will need a chess pre-processor (which I have *not* written!). Most of the capabilities of the font are illustrated on the demo page, which also includes some possibly-useful PostScript procedures for various of the effects. Warning: the dual-mode font treads on very thin ice in some places! In particular, the caching mechanisms of PostScript are very easy to fool with a dynamic font of this type. For example, finding the width of a string is fraught with danger; do it only with strings that include matched pairs of primes. The font design: --- ---- ------- There are surprisingly many different chess fonts in use in printed books. I have tried to copy the simplest -- for example, the rooks have no brickwork, and the kings are quite plain. Note that the pieces do not scale well. Large pieces (inches high) for posters, etc., will have to be specially designed (and are usually based on "real" Staunton pieces). Tiny pieces suffer from the lack of resolution on 300 dpi (or coarser) printers. On a 300 dpi printer, 7-point is really too small, anything less is hopeless (see the demo). I usually use 15-point, which is comparable with most books. The hardest piece to get right is the knight. The book designs are hopeless at 300 dpi resolution, as there are too many fine lines around the mouth and chin. Any attempts to copy them just look like a caricature. So I've made it a bit chunkier. Most readers don't notice. Note that most of the pieces (as opposed to the figurines) cannot be cached. This is because they include both write-white and write-black components (partly, but not entirely, because they have to work on black squares); this makes drawing a whole page of black kings (or whatever) rather slooow. Fortunately, you don't often need such a thing. The figurines *are* cached, so are the Informant symbols, and so are the commonest pieces (the black squares, and the pawns of both colours). Foreign usage: ------- ------ Foreign users may want to re-assign the letters used for the various pieces. This can easily be done in the Font file. Lines such as dup 8#113 /WK put % 'K' (not too far down the file) signify that ASCII character 113 (octal), or "K", is to draw the White King. If you want some other character to draw the WK, alter the 113 to match. You will have to change the BK and Kfig by the same amount, and you will also have to reassign whatever symbol your chosen character already draws, if any. Another minor problem is that some of the fairy pieces are defined explicitly in terms of the existing pieces -- eg, if you decide to use "F" to draw White queens, then the procedure for Grasshoppers (look for "WG" in Font) must be changed to draw upside-down "F" instead of upside-down "Q". I hope the necessary edits are obvious even to non-PostScript users. I suggest that after any change you try the Table and Demo files again. Unusual chess pieces: ------- ----- ------- I've included a fair number of pieces that may not be familiar to all chess players. These include: F for fou, French version of bishop. There are several designs of fou in print, I have selected the easiest to implement. If you want one of the others, you'll have to write it yourself. D,X for draughts pieces. Note that these are not cached (except as figurines); if you are writing a book on draughts with lots of diagrams, you might find it worthwhile to re-write them in a cachable way. This is easier if you want to use them on the white squares (you don't need the "halo" effect), but the books I have seen are about equally split on this. C,I,T for chameleon, imitator, rose. Various fairy pieces. E,G,L,M,O,S,U,V,Z for various rotated standard pieces, used in fairy chess. Note that the "Demo" file includes a more general way to rotate a piece. I have used S for nightrider, oppositely to the problemists convention which uses S for knight and N for nightrider; there is no way that the average player is going to change his habits! If you are a problemist, feel free to interchange S and N (and then M and Z). .,@,|,_ for various other marks useful in annotating diagrams. See the "Demo" file for examples of their use. A,H,J,W,Y are unused. Feel free to use them to add new pieces. Go pieces: -- ------- Sorry, despite several requests, I haven't put these in. I can't save the whole world in one easy lesson. The pieces themselves and the board are easy in PostScript; the annotations and the necessary pre-processor are another kettle of fish. The Go stones could also be used for Reversi (Othello). Bridge symbols: ------ -------- No-one has actually asked for these, but just to forestall you, note that they are already provided in many places -- symbol fonts, dingbats fonts, Hershey fonts, .... Final comments: ----- --------- Suggestions for improvements, especially in the PostScript, will be welcomed. Especially if they improve portability (which I can't check locally!). Especially if you've tried them yourself, and can vouch that they work. Suggestions for extra symbols (other than Go or Bridge) also welcomed, especially if accompanied by PostScript or other descriptions of their shape. -- Andy Walker, Maths Dept., Nott'm Univ., UK. anw@maths.nott.ac.uk gnuchess-4.0.pl70/doc/README.output100644 21542 13 7171 5276455260 16000 0ustar cracraftuserEnter #moves #minutes: 0 0 Operator time(hundredths)= 0 White 0:00 Black 0:00 R N B Q K B N R P P P P P P P P - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - p p p p p p p p r n b q k b n r Book used 4649 of 5500 entries Playing without hashfile There are 4649 unique position/move pairs in the book There is room for a maximum of 5499 entries but it should not be brought above 5400 because of the way they are stored. The hashfile gnuchess.hash was not found or was not writable. Your move is? get Enter file name: TEST/test1 White 0:00 Black 0:00 - - - - - - - - - - - - - - - - - - P P - - - K - - - - - - - - - p - p - - - k - - - - - - - - - - - - - - - - - - - - - - - - Your move is? white Your move is? post Your move is? level Enter #moves #minutes: 40 5 Operator time(hundredths)= 0 Your move is? go Move# 1 Target= 0 Clock: 3600000 2. -289 0 172 e4d4 h2g3 a4a5 3& -304 0 380 e4d4 h2g3 a4a5 g3b8 3. -304 0 595 e4d4 h2g3 a4a5 g3b8 4& -340 0 975 e4d4 h2g3 a4a5 g3f2 d4d3 h5h4 4& -281 0 1571 a4a5 h2g3 a5a6 g3b8 e4d4 4. -281 0 2074 a4a5 h2g3 a5a6 g3b8 e4d4 5& -297 1 3902 a4a5 h2g3 a5a6 g3b8 e4d4 b8a7 d4e5 5. -297 1 4403 a4a5 h2g3 a5a6 g3b8 e4d4 b8a7 d4e5 6& -297 3 8783 a4a5 h2g3 a5a6 g3b8 e4d4 b8a7 d4e5 6. -297 3 11386 a4a5 h2g3 a5a6 g3b8 e4d4 b8a7 d4e5 7& -326 6 25289 a4a5 h2g3 a5a6 g3b8 e4d4 h5h4 d4e4 h4h3 7. -326 7 28806 a4a5 h2g3 a5a6 g3b8 e4d4 h5h4 d4e4 h4h3 8& -326 15 69887 a4a5 h2g3 a5a6 g3b8 e4d4 h5h4 d4e4 h4h3 8. -326 17 84289 a4a5 h2g3 a5a6 g3b8 e4d4 h5h4 d4e4 h4h3 9& -438 47 254540 a4a5 h2g3 a5a6 g3b8 e4d4 h5h4 d4e4 h4h3 e4f3 h3h2 f3g2 9& -415 76 407415 e4d4 h2g3 d4e4 g3e1 e4f5 h5h4 f5g4 d1e2 a4a5 e1a5 g4h4 9& -328 89 479370 d5d6 e7d6 e4d3 h2g3 a4a5 9. -328 90 482591 d5d6 e7d6 e4d3 h2g3 a4a5 10+ -211 111 596164 d5d6 d4d3 d6e7 h2g1 e7e8 10& -117 122 650950 d5d6 e7d6 e4d3 h5h4 g3h4 h2e5 a4a5 d6d5 a5a6 e5b8 d3d4 10. -117 128 685069 d5d6 e7d6 e4d3 h5h4 g3h4 h2e5 a4a5 d6d5 1. ... d5d6 Gen 12148020 Node 3197376 Tree 424 Eval 706611 Rate 5689 EC 164077/542535 RS hi 0 lo 2 Hin/Hout/Tcol/Coll/Fin/Fout = 99838/401419/0/0/0/0 My move is: d5d6 where: . = Final result of this level & = Intermediate best move inside window + = best move greater than beta in window - = best move less than alpha in window If best move is outside window it will cause a re-search high or low if it persists at end of level, + always causes a re-search. These are only printed above level 2. Gen = Number of moves generated during this search Nodes = Number of moves examined Tree = Maximum entries in the search tree at any one time Eval = Number of static position evaluations done Rate = Search rate in positions/sec EC = Static Evaluations cached/retrieved from cache RS = Re-searches high and low forced by the window Hin = Number of entries created in in-core transposition table Hout = Number of entries found in in-core transposition table Tcoll = Number of overwrites in transposition table Coll = Number of collisions in in-core transposition table Fin = Number of entries created in external transposition table Fout = Number of entries found in external transposition table gnuchess-4.0.pl70/doc/ChangeLog100644 21542 13 62024 5563713426 15351 0ustar cracraftuserSat May 10 Patchlevel 69 Mike McGann (mwm@ascom.ch) * Fixes for search problems from Chua Kong Sian and Dr Michael J. White and Dmitry Dakhnovsky. * fixes for HP compile from Richard Lloyd. Sat Mar 19 Patchlevel 69 Mike McGann (mwm@ascom.ch) * New transition table code from Dan Oetting (oetting@gldfs.cr.usgs.gov) separating the tt code into a separate module * Fixes for the draw problems from Chua Kong Sian and Mike McGann * better use of the transition table + size reduction * lots of small bug fixes * post command split to post/unpost for easier use in scripts * fix for DEEPNULL bug from Chua Kong Sian (nsrccks@leonis.nus.sg) Sat Feb 12 Patchlevel 68 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * Patches by Chua Kong Sian and Mike McGann. Fri Feb 4 Patchlevel 67 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * New version by Mike McGann. Sun Jan 23 Patchlevel 66 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * ensure computer thinking on opponent's time when easy mode * loading game not searching book bug fixed. * both by Chua Kong Sian (nsrccks@leonis.nus.sg) Wed Jan 19 Patchlevel 65 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * chesstool compatibility (asun@mmvideo.mt.att.com) * speed/time bugfixes in search.c+eval.c (nsrccks@leonis.nus.sg) Mon Jan 10 Patchlevel 64 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * makefile ("make realclean") * basic data type-checking updates in util.c/eval.c * announced patch in gnuchess.h Fri Jul 25 Patchlevel 63 Mike McGann (mwm@hssler.ascom.ch) * Change all char to signed char for SGI * Change trans logic to not store if quiescent search has been used * Update Book Fri Jun 25 Patchlevel 62 Mike McGann (mwm@hssler.ascom.ch) * German language support from Richard Mathar * better research logic from kongsian@nsrc.nus.sg (Kong Sian) * Redo NULLMOVE logic to eliminate hung pieces * Redo search/eval/hashtable logic for speed and to optimize gnutest results. * Redo and simplify book install stuff * Use more estimates down to leafs to speed up search. * fix illegal castle move bug and ^C breakout of search slowness Fri Jan 8 Patchlevel 61 Mike McGann (mwm@hasler.ascom.ch) * fix bug in en-passant restoring on unmake of move * fix to search timing function bug that caused it to increase time on takebacks or occasionally take a long time for a move * new next ply estimate function * allow increased time to complete a partial ply MAXTCCOUNTX * allow more time per move in necessary MAXTCCOUNT * gnuan now skips processing process book moves from Chua Kong Sian (ccecks@nuscc.nus.sg) * new KP1K endgame routine from R. Stephan (ralf@ark.abg.sub.org) * fix to ElapsedTime nchar declared wrong from T. Mann(mann@src.dec.com) * updates for Dec Alpha from T. Mann (mann@src.dec.com) Fri Oct 30 Patchlevel 60 Mike McGann (mwm@hasler.ascom.ch) * null move heuristic from Benno Tietz (tietz@eos.informatik.uni-bonn.de) intalled * fixes for ProbeTTTable from Benno Tietz * fixes for xget from Tim Mann(mann@src.dec.com) * change hash table collision avoidance algorithms * two new book formats GDBM (Gnu dbm based) and GDX (hash file based). * add MSDOS fixes from ccecks@nuscc.nus.sg (Chua Kong Sian (Mr)) and msdso makefile Tue Oct 20 Patchlevel 59 Mike McGann (mwm@hasler.ascom.ch) * binbookfile is now the main form of book. * add rudimentary fischer clock * add caching for static evaluations * add aging for in core transposition table * changes to history killer from tietz@eos.informatik.uni-bonn.de (Benno Tietz) * bugfix from ccecks@nuscc.nus.sg (Chua Kong Sian (Mr)) for history declaration error. * Allow full notation for book moves * prevent caching of partially evalusted positions. * add game time control * add capability to feed back the clock for ICS play * gnuan fix en-passant problem * gnuchess make book nameable in command line * change move output to generate o-o form of castling moves to satisfy ICS * Speedup evaluation functions * fixes to killt from tietz@eos.informatik.uni-bonn.de (Benno Tietz) * add moves generated to post output * fixes to genmoves from Dan Oetting * change over to gettimeofday for more accuracy * clean up search logic and time control * fix transposition search bug Mon Aug 24 Patchlevel 58 Mike McGann (mwm@hasler.ascom.ch) * add Mwpawn, Mbpawn, Mw..., Mb... , p and debug commands to gnuchessr. * Fix bug in evaluation logic for hung pieces. * Fix time control calculation to add time at time control Fri Aug 14 Patchlevel 57 Ben Hurwitz (bug fixes) Thierry Leconte (book) * Both/force interaction improved. * Bug fix to possibles declaration and OR of move with BADMOVE * Work better with GM John Nunn book (take care of order of lines, don't null the book for at least 3 moves after taken out of book, no random opening) * Removed exit of program when drawn game detected. * Fixed bug that caused program to make 1-move blunders. (transposition table caused return 0 when position seen before to detect draw which then gets a depth bonus since search is inexact so it ends up looking better to make a repetition than making a winning 1-mover!) Sun Jul 2 Patchlevel 56 Henrik Schmiediche * Fix test command (patch to dspcom.c). The results were off by a factor of 100. * Delete lint from Makefile. * Better CFLAGS for HP machine. Mon Jun 29 Patchlevel 55 Stuart Cracraft * Apply Mann's FIONREAD-clarification patches * Change BOOKFAIL in gnuchess.h so that the program always consults the opening book first. * Up BOOKBITS to 10 to account for larger book: "As currently set up with BOOKBITS equal 8 there is a table of 256 pointers into the BOOK hashtable. With 20,000 entries and 256 buckets it would do a linear search of approx 78 entries per lookup. Increasing BOOKBITS to 9 would mean a search of 34 entries etc. and would add 256 pointers to the data area. So we probably should make it 10 then." McGann Fri Jun 26 Patchlevel 54 Mike McGann * This version compiles into a version identical with 3.1+ (and so is much stronger than the previous 4.0). But, it has beaten 3.1+ in a short match. Also, it has bug fixes, timing control improvements and other fixes contained in this list. Tue Jun 23 Patchlevel 53 Stuart Cracraft / Tim Mann * Use a[u]+1 in ataks.c instead of ++a[u]. * Don't use space bonus tables. Tue Jun 23 Patchlevel 52 Tom Truscott * GNUchess will now compile on the IBM RS/6000 (AIX). * Makefile changes needed for older AIX compilers lacking support for "cc -c foo.c -o bar.o" (strange but true). * The other changes are to appease the picky type checking that is enabled by some of the compiler options. Sat Jun 21 Patchlevel 51 Tim Mann * Fixed problem with "help" command by removing "fflush(stdin)". * "Undo" command now does not add moves to a 1-move time control. * Added back feature from 3.1 that lets the user set a maximum search time per move instead of using time controls, and changed the command line syntax for this feature to be compatible with 3.1, removing the ability to set max search depth from the command line. * Fixed the "maximum minutes per move" feature in gnuan. * Updated and corrected the man page. Thu Jun 18 Patchlevel 50 Tim Mann * Special #ifdefs to not do post for xboard are unnecessary and were removed. Wed Jun 17 Patchlevel 49 Mike McGann, Urban Koisten * Fix book code to calloc (Urban) * Fixed other code (Mike) Sun Jun 7 Patchlevel 48 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * Fix gnuan.c output to be more uniform. And tested that it works. Sat Jun 6 Patchlevel 47 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * Fix Makefile to correctly define BINBOOK so that parsed opening book gets used (if available.) Sat Jun 6 Patchlevel 46 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * Various patches from various people to mostly robustify the code (exit values to exit, etc.) * New book.c handling code and gnuchess.h from Urban to handle mega book now under discussion. * New Xboard. Wed Jun 3 Patchlevel 45 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * Encapsulate Xboard with GNU Chess distribution Sun May 31 Patchlevel 44 Bart Massey (bart@cs.uoregon.edu) * Rename structure element move to bmove in book.c since curses.h defines a move macro. * Get rid of superfluous returns in dspcom.c and checkbook.c * Be sure beep message has an arg in uxdsp.c * Add exit status to exit() call in checkbook.c Sat May 30 Patchlevel 43 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * Fix checkmate/draw handling. * Add current module copyrights and COPYING. * Ifdef forced-mate announcements as too buggy. Fri May 29 Patchlevel 42 Stuart Cracraft (cracraft@rice-chex.ai.mit.edu) * HUNGP/HUNGX in eval.c updated to values used by Slate/Atkin of Chess 4.x. This fixes a problem with Reinfeld's #281 and poor play in Alapin's opening. General play against me has been much better. Mon May 11 Patchlevel 41 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * genmove update to look at less possible promotion moves * fix bugs in move ordering logic * remove operator time as a default Thur Apr 30 Patchlevel 40 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * Book updates from Tim Mann (mann@src.dec.com) * Search updates to look more at possible promotion moves * Transposition table update from U. Koistinen (md85-epi@nada.kth.se) to allow for estimated scores. Mon Apr 27 Patchlevel 38 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * book updates for Cochrane from Tim Mann (mann@src.dec.com) * added limit for infinite checks in endgame to tree search to limit time spent in any branch Wed Apr 25 Patchlevel 38 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * fix slowdown caused by previous changes. Wed Apr 22 Patchlevel 37 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * fix sizes of ttable (malloc) and hashfile (-c option) to allow for rehashing * eliminate pick replace with qsort * adjust lookahead limits Thur Apr 15 Patchlevel 35 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * fix bugs in search logic Mon Apr 13 Patchlevel 34 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * Fix bugs in game win/draw logic. Fri Apr 8 Patchlevel 34 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * rewrite time control moving it up a level * replace sorts with qsort * fix material command to all multiple N's and B's * and make it an ifdef on NOMATERIAL Fri Mar 30 Patchlevel 32 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * make MINDEPTH a define * eliminate #ifdef's for hashbd/hashkey it is always required * up MINDEPTH to 2 to always get a hint * add some dynamics to eval/estimate decision * more dynamic time allocation Fri Mar 27 Patchlevel 30 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * fix hashfile code again * fix startup for no book present * fix race condition in search * allow parameters on commands Wed Mar 25 Patchlevel 28 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * fix bug in hashfile debug code * add material check for draw and material command * fix QUIETBACKGROUND code Tue Mar 24 Patchlevel 27 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * fix book move reject to not select a ? move * add check to HASHFILE option to check for ilegal move * document debug options Mon Mar 23 Patchlevel 26 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * Add multiple time controls * apply fixes from R.K.Lloyd@compsci.liverpool.ac.uk for screen update problems in visual mode Sun Mar 22 Patchlevel 25 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * Update man pages * fix false mate problem with transposition table * add history killers option but don't use it. * fix handling of input parameters so the doc and the program agree * allow time to be specified in seconds (machines are faster now) * add QUIETBACKGROUND option from md85-epi@nada.kth.se. * put in book patch from md85-epi@nada.kth.se. Sun Mar 15 Patchlevel 22 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * Add options for SpaceBonus table levels * Switch to new book * Add polling code for keyboard Tue Mar 10 Patchlevel 21 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * correct depth test in PutInTTtable * patch from Urban Koistinen (md85-epi@nada.kth.se) correcting bug in repetition Mon Mar 9 Patchlevel 20 * correct defaults for MEMSET Sat Mar 7 Patchlevel 19 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * add speedups by using memset for ZeroRPT * rewrite ScoreSpace * rewrite pick Thur Mar 5 Patchlevel 18 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * fix bug in timing that led to negative times * change time allocation to be more flexible * based on score and depth * eliminate a bad opening from the book Sat Feb 15 Patchlevel 17 Urban Koistinen (md85-epi@nada.kth.se) * Added option -T n to set transposition table size 2^n. * -r n set rehash to n. * Changed repetition to make it work harder. * ScoreSpace changed to value central squares higher. * Made go change colors so white&black work as they should. Fri Dec 30 08:34:00 1991 Patchlevel 16 * Fix to eval.c for mis-transcribed sign in ScoreKBNK. * Fix to malloc call in init.c. * ScorePosition updated with addition of ScoreSpace to add in points for threats in a position. from Urban Koistinen (md85-epi@nada.kth.se) * Various tuning of parameters Fri Nov 30 08:34:00 1991 Patchlevel 15 * from nv-90-mho@nada.kth.se patch to make listfile name meaningful instead of a random number * from Urban Koistinen (md85-epi@nada.kth.se) move generation speedup for non-pawn moves and move selection improvements. * from Mike McGann (mwm@hslrswi.hasler.ascom.ch) added language file to allow multiple languages to be supported. Fix broken search on opponents time, fix bad moves in book. Mon Oct 19 08:34:00 1991 Urban Koistinen (md85-epi@nada.kth.se) * patchlevel 14 * fix checks in castling logic to only allow kings to do it. * fix repetition logic "all pieces are the same" bug. Thur Oct 10 13:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * patchlevel 14 * expand the timing logic to allow more time in unstable positions * Update man pages * Fix printout bug in Checkbook Tue Oct 8 13:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * patchlevel 13 * General cleanup, Fix screens, prompts, rate calculation Sun Oct 5 13:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * patchlevel 12 * Change eval.c/KingValue to ignore Mking if the otherside has only pawns on the board. Tuning parameter is KINGPOSLIMIT. * Fix time print in gnuchess and gnuchessx. * Use ShowMessage for all error messages. * Fix post option to print time in seconds. Sun Oct 5 08:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * patchlevel 11 * speedups in search. Eliminate unused computation. * change eval.c/KingValue to ignore Mking if there are only pawns on the board. Tuning Parameter is KINGPOSLIMIT. * make DITHER a tuning parameter. Tue Oct 1 08:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * patchlevel 10 * fix eval bug in ScorePosition. Evaluated pawn structute incorrectly. Introduced when gnuchess was split up. * Change default for SCORETIME to -9000 it plays better * correct promotion logic for CHESSTOOL and XBOARD only queens are generated now. * correct handling of TOflag for bothsides mode. Mon Sept 27 08:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * fix more enpassant bugs in checkgame/checkbook * misc speedups by inlining code. move SqAtakd to ataks.h and inline it. * Modify checkbook to also read xboard game files and check them for illegal moves. * fix bug in game.c introduced by patch 8 Mon Sept 26 08:34:00 1991 Urban Koistinen (md85-epi@nada.kth.se) * Correct the making and unmaking of enpassant moves and numerous incorrect usages of ? throughout the program. Mon Sept 24 08:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * force search re-init if PV chavges due to a timeout * add patchlevel to the -v option to keep version straight. * Change search and timing logic. Search now backs up to previous level on a timeout. Search adds time to the search if the last top level PV is different from the current and this level is not finished. Seems to play much stronger. Mon Sept 16 08:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * Opening book now handles transitions. It continues looking at the book until 2 (tunable) successive turns fail to find a move there. * GetOpenings now checks for errors on input. The current book was full of illegal moves. They were filtered out since at game time the book move is matched against the legal move list. But it makes for bad opening play. EnPassant moves are not allowed in openings(a limitation?) Checks made are the there is a piece on the from square belonging to the right side and there is no piece or a piece belonging to the other side on the to square. There is no check that the piece is moving legally. * ListGame now makes up the name chess.lst.random#. So if you are using xboard to play a match (two machine mode) they won't overwrite. * Added patch from Randy Ray (rray@SPECLAB.CR.USGS.GOV) to correctly format chess.lst Wed Sept 4 08:34:00 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) * Renamed gnuchess3.1+ to gnuchess to reflect the split in gnuchess development. There now seems to be 3 threads. Gnuchess, gnuchess for windows (3.21), and the gnuchess4 project if it still exists. * Fix chesstool version to handle white as well as black. * Split program into modules for easier maintinance and development. * Fixed Illegal move bug in VerifyMove for promotion moves. * Replaced ResponseTime calculations with simpler version that stays within the time limits and seems to do as well or better in play. * General cleanup of the search algorithm * Fixed gnuan input processing and termination code. * Fixes to work with xboard match mode * Added TEST directory with 16 problems from Levy's Computer Chess book. Tue Aug 6 18:10:47 1991 Philippe Schnoebelen (phs@lifia.imag.fr) * Modify handling of Book in Undo (previously, when you backtracked after quitting the book, the program was not able to use it again) * Modify handling of Book in EditBoard and other routines so that the Book is not used if you don't start from the regular initial board. Mon Aug 5 17:26:59 1991 Philippe Schnoebelen (phs@lifia.imag.fr) * Modify parse in gnuchess.c so that a move can be followed by '?' indicating that the program should not play it itself. Such a move is stored with the highest bit raised. Modify OpeningBook in gnuchess.c so that moves with highest bit set are recognized but not played by the program. * Modify the declaration of array PieceList in gnuchess.[ch] to allow for up to 64 men of the same side. Such artificial situations can be built with edit and the program must be able to deal with them. Mon Aug 1 10:20 1991 Mike McGann (mwm@hslrswi.hasler.ascom.ch) Split chesstool and xboard versions. Xboard is now gnuchessx and chesstool is gnuchessc. Mon Apr 15 10:20 1991 Mike McGann {mwm@hslrswi.hasler.ascom.ch) Changed transposition table to cache positions found in transposition file Fix Undo's incorrect handling of promotions. Fix win and draw determination bugs. Fix bug in algbr that prevented correct display of promotion moves. Fix Undo to correctly display side to move. Add path to command line for save file and load file. Make save file human readable Thu May 24 13:42:24 1990 Hans Eric Sandstr|m (hes at baloo) * Fixed a bug reported by Brian Wong (wong@cs.UAlberta.CA) in ScoreKPK Sat May 5 15:58:31 1990 Hans Eric Sandstr|m (hes at baloo) * extensive tests on MSDOS for 2 weeks and lots of changes: Moved all flags to a special flag structure. Added my own TODO file to the DOCUMENTATION. Moved GetOpenings and parse from the *dsp.c files. Made the transposition table enabled by default. Some cleanup in the *dsp.c code. Changed UpdateHashbd to a macro. Wed Apr 18 16:38:30 1990 Hans-Erik Sandstr|m (hes at tiamat) * Removed unnessesary global variables: (wking, bking, Enemyking, INCscore, slk, InChk, HasPawn, Zwmtl, Zbmtl, lpost, KBNKsq) this should make the program more readable. * Added a mini transposition table to detect repetitions, this means that repetition is called more seldom and should save some time. The idea for this came from Benno Tietz (tietz@eos.informatik.uni-bonn.de) Thu Mar 29 02:49:00 1990 Thorsten Ohl at (td12@ddagsi3.bitnet) * nuxdsp.c has been given an ANSI interface (tailored after uxdsp.c as of Version 3.00 and a homegrown ANSI interface created in January for Version 1.55). * uxdsp.c now understands ^C interrupts. * both nuxdsp.c and uxdsp.c support the graphic characters of the IBM PC (can be disabled with -DSEVENBIT). It's of course a matter of taste, but I think it looks much better. * I have added prototypes and a makefile for a **IX compatible MS-DOS make (neither Turbo C or Microsoft C will understand this!). * some formal parameters are not referenced. This is due to the different display interfaces and no problem at all. Just for aesthetic reasons I have shut up the compiler by incrementing the unreferenced variables. * some longs are assigned to shorts and some shorts to unsigned chars. I have introduced a cast in each case, all are o.k. (as far as I can tell). Thu Mar 8 09:11:28 1990 Hans-Erik Sandstr|m (hes at orsa1) * The persistent hash table seems to work now. There are still some problems using it on a heterogenous network. Sun Mar 4 14:44:44 1990 Hans Eric Sandstr|m (hes at orsa) * I am working on a persistent hash table. Currenly a 10Mb file with 262144 entrys. Stuart just asked me to spilt the posdata array to make gnuchess work better on a PC, so I did that. I have also tried to properly fix the bug that caused gnuchess to report mate prematurely. This, I hope, will also improve the search. Tue Feb 27 18:27:23 1990 Hans Eric Sandstr|m (hes at davidson.log-sv.se) * used protoize to make a function prototyped version of gnuchess. this means that I have to use unprotoize before 'make distribution' to make a more portable K&R version. removed a ZeroTTable so now the hashtable is kept between moves. Sat Feb 24 13:14:14 1990 Hans Eric Sandstr|m (hes at orsa) * Added a test to detect hash table collisions, define HASHTEST. I also removed the times calls since there is no sense in measuring cpu time when wallclock time is all that counts when playing chess. Fri Feb 23 17:25:37 1990 Hans Eric Sandstr|m (hes at orsa) * Compiled gnuchess with gcc1.37 -Wall and got lots of implicit decaration warnings. Solved most of these by adding external declarations in gnuchess.h. Wed Feb 21 17:41:28 1990 Jouko Holopainen (jhol@tolsun.oulu.fi) * Contributed his code for ECO move entry (again!) and a file ansidsp.c (A msdos port of uxdsp.c). I(hes) started a merge of ansidsp.c and uxdsp.c. February 8, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Changed the transpositon table to allow 65536 positions per player. This means a 1.3 Mbyte hash table. Introduced simple rehashing. And also made setting ttable 0 exclude all transposition code from gnuchess (for machines with very little memory). February 3, 1990 -- Tom Vijlbrief (tnosoes!tom@nluug.n) Contributed code to fix undo of promotions. And a bugfix RMBLTY was to small. Januari 27, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Fixed nuxdsp.c to work with my changes (Saved games format) Januari 26, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Verified that the underpromotion routines works. Found and fixed the bug that caused gnuchess to report mate and draw prematurely. Januari 25, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Received the underpromotion additions from jhol@tolsun.oulu.fi Made some optimizations in trapped and KingScan. Added more comments on how to improve the search. Added info on usage of the array Tree in post mode. Changed the index in the transposition table to unsigned short to allow a hash table of size 65536. Januari 11, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Formatted gnuchess according to GNU standards with indent. Januari 9, 1990 -- Hans Eric Sandstrom (hes@log-sv.se) Inserted a missing comma in KTHRT. Removed mvstr1[5],mvstr2[5] from gnuchess.c, they are only used in the user-interface routines uxdsp.c nondsp.c anyway. Rewrote algbr to generate move strings for underpromotion. (ph8k or h7h8k) Some optimizations in CaptureList. Changed row, column and locn to macros. Made memset default and introduced a switch NOMEMSET for computers without memset or where memset is a speed penality. I tested this on: Sparc - no change DECstation - no change Sun3/60 - 4% speed improvment. Changed + to | in some bit-field manipulations. Fixed the castle-with-moved-rook-bug, removed kingmoved and introduced an array Mvboard to keep track on how many times we have moved from a particular square. Fixed the check for zero division in Time controls. Added BINDIR and LIBDIR in the Makefile to set where gnuchess and gnuchess.book gets installed. All I have to do now is to test if all this works (-: gnuchess-4.0.pl70/doc/gnuan.hlp100644 21542 13 1347 5163133724 15366 0ustar cracraftuser Gnuan is a program which takes as input a file contianing all of the moves of a chess game in algebraic notation in the following way: e2e4 c7c5 g1f3 d7d6 d2d4 c5d4 etc... Run gnuan and it will ask you for the path to the source file, the maximum depth it should analyse a move to and a maximum time per move. The output will go to standard out, but you can always redirect it to a file. The depth that you specify is in plys or half moves. The time is in minutes. The file gnuan.c is based on nondsp.c which came with gnuchess. The modifications for gnuan.c were made by: Truman Collins July 1990 CIS 71121,3343 tcollins@pdx.mentor.com If anyone makes any improvements to this, I would appreciate hearing about them. gnuchess-4.0.pl70/doc/postprint.6100644 21542 13 2105 5163065232 15671 0ustar cracraftuser.TH POSTPRINT GNUCHESS .SH NAME postprint .SH SYNOPSIS .B postprint filename .SH DESCRIPTION .I postprint creates a board by board postscript output file on stdout of the contents of the .I gnuchess persistent hashfile. The hashfile contains information from previous games saved by .I gnuchess. For each position it prints the board, the best move for that position and the search depth that generated the move as well as several flags indicating information about the position. Flags show whether the score is a true score, or an upper or lower bound on the score and whether or not kingside or queenside castling was legal. When combined with .I ChessFont file and sent to a postscript printer it will show all boards in the range specified. For each board the move and the current score are also printed. .B ChessFont is courtesy of Andy Walker, Maths Dept., Nott'm Univ., UK. (anw@maths.nott.ac.uk) and is copyrighted by him. To use: .B postprint >tmp .B cat ChessFont tmp | lpr .SH "FUNCTION LETTERS" .TP .SH BUGS .PP .fi .SH SEE ALSO .nf gnuchess(6) chesstool(6) xboard(6) .fi gnuchess-4.0.pl70/doc/checkgame.6100644 21542 13 1076 5163055667 15557 0ustar cracraftuser.TH CHECKGAME GNUCHESS .SH NAME checkgame .SH SYNOPSIS .B checkgame filename .SH DESCRIPTION .I Checkgame is a program to check the output of .I gnuchess for illegal moves. .PP .I checkgame accepts a 'chess.lst' file containing chess moves in algebraic notation and checks the file for illegal moves. Castling and en-passant moves are allowed. But in castling moves no check is made whether the pieces have moved before or whether a intervening square is under attack. .SH "FUNCTION LETTERS" .TP .SH BUGS .PP .fi .SH SEE ALSO .nf gnuchess(6) chesstool(6) xboard(6) .fi gnuchess-4.0.pl70/doc/gnuchess.txt100644 21542 13 32155 5412277314 16153 0ustar cracraftuser gnuchess(6) GAMES AND DEMOS gnuchess(6) NAME gnuchess - Chess SYNOPSIS gnuchess [ [[-]a] [-b bookfile] [-B binbookfile] [[-]h ] [-L language] [-r length] [-s pathname] [-l pathname] [-S bin- booksize] [-t] [-c size] [-T size] [-v] [-x] arg1 arg2 ] DESCRIPTION _G_n_u_c_h_e_s_s plays a game of chess against the user or it plays against itself. _G_n_u_c_h_e_s_s is an updated version of the GNU chess playing pro- gram. It has a simple alpha-numeric board display, an IBM PC compatible interface, or it can be compiled for use with the chesstool program on a SUN workstation or with the xboard program under X-windows. To invoke the program type: gnuchess - simple curses based version gnuchessn - fancy version using curses and inverse video on UNIX, or IBM PC cursor controls and characters on MSDOS gnuchessr - ASCII based version gnuchessc - chesstool compatible version gnuchessx - xboard compatible version TIME CONTROLS If one argument is given, it is the search time per move in [minutes:]seconds. So gnuchess 30 will generate one move every 30 seconds, while gnuchess 5:00 will generate one move every 5 minutes. If two or more arguments are given, they will be used to set tournament time controls with the first argument of each pair being the number of moves and the second being the total clock time in minutes[:seconds]. Thus, entering gnu- chess 60 5 will set the clocks for 5 minutes (300 seconds) for the first 60 moves, and gnuchess 30 3:30 will allow 3 minutes and 30 seconds for 30 moves. gnuchess 30 5 1 :30 will allow 5 minutes for the first 30 moves and 30 seconds for each move after that. Up to 4 pairs of controls may be specified. Sun Release 4.1 Last change: 1 gnuchess(6) GAMES AND DEMOS gnuchess(6) If no argument is given the program will prompt the user for level of play. For use with chesstool or xboard, see the documentation on those programs. BOOK At startup _G_n_u_c_h_e_s_s reads the _b_i_n_b_o_o_k file if it is present. It then looks for a _b_o_o_k file. If it is present it adds its contents to the _b_i_n_b_o_o_k data. If the _b_i_n_b_o_o_k file is writ- able a new combined _b_i_n_b_o_o_k file is written. The book _g_n_u_c_h_e_s_s._b_o_o_k consists of a sequence of openings. An opening begins with a line starting with a ! , the rest of the line is comments. Following this is a series of moves in algebraic notation alternating white and black separated by white space. A move may have a ? after it indi- cating this move should never be made in this position. Moves are stored as position:move so transpositions between openings can take place. HASHFILE The hashfile if created should be on the order of 4 mega- bytes or gnuchess -c 22. This file contains positions and moves learned from previous games. If a hashfile is used the computer makes use of the experience it gained in past games. Tests run so far show that it plays no worse with the hashfile than without, but it is not clear yet whether it provides a real advantage. LEGAL MOVES Note: Piece letters and legal castling notation is deter- mined by the language file. What is specified here is the default English. Once _g_n_u_c_h_e_s_s is invoked, the program will display the board and prompt the user for a move. To enter a move, use the notation e2e4 where the first letter-number pair indicates the origination square and the second letter-number pair indicates the destination square. An alternative is to use the notation nf3 where the first letter indicates the piece type (p,n,b,r,q,k). To castle, type the origin and destina- tion squares of the king just as you would do for a regular move, or type o-o or 0-0 for kingside castling and o-o-o or 0-0-0 for queenside. To promote a pawn append the type of the new piece to the move, as in e7e8q or c7c8r. FUNCTION LETTERS -L lang Use language _l_a_n_g _f_r_o_m _t_h_e _f_i_l_e gnuchess.lang. If -L is not specified it defaults to the language used in the first line in the file. gnuchessr -L ger will use the Sun Release 4.1 Last change: 2 gnuchess(6) GAMES AND DEMOS gnuchess(6) german language. -a Do not search on opponents time. a Do search on opponents time. -b bookfile Use bookfile for opening book. -B binbookfile Use binbookfile for binary opening book. -S size Size of binbookfile for memory based and GDX books. For creating a binbookfile. -P plylevels Number of plys to include in the binbookfile. For gen- erating a binbookfile. -c size Create a new HASHFILE. File size is 2^size entries of approximately 65 bytes. -h Do not use hashfile. h Do use hashfile. -l pathname Pathname of the loadfile use with the get or xget. -r length Rehash length times in searching entries for position in transposition table. -s pathname Pathname of the save file to use with the save command. -t Show statistics for HASHFILE -T size Set the transposition table size to size entries. (minimum is MINTTABLE) -v Show version and patchlevel. -x value Use value as the evaluation window xwndw. COMMANDS In addition to legal moves, the following commands are available as responses. Note: command names are determined Sun Release 4.1 Last change: 3 gnuchess(6) GAMES AND DEMOS gnuchess(6) by the _l_a_n_g_u_a_g_e file and may vary with the implementation. This is default English. alg -- allow algebraic input (not implemented) Awindow -- change Alpha window (default score + 90) Bwindow -- change Beta window (default score - 90) beep -- causes the program to beep after each move. bd -- updates the current board position on the display. book -- turns off use of the opening library. both -- causes the computer to play both sides of a chess game. black -- causes the computer to take the black pieces. If the computer is to move first the go command must be given. coords -- show coordinates on the display (visual only) contempt -- allows the value of _c_o_n_t_e_m_p_t to be modified. debug -- asks for a piece as color piece, as wb or bn, and shows its calculated value on each square. debuglevel -- sets level of debugging output if compiled with debug options. depth -- allows the user to change the search depth of the program. The maximum depth is 29 ply. Normally the depth is set to 29 and the computer terminates its search based on elapsed time rather than depth. If depth is set to (say) 4 ply, the program will search until all moves have been exam- ined to a depth of 4 ply (with extensions up to 11 addi- tional ply for sequences of checks and captures). If you set a maximum time per move and also use the depth command, the search will stop at the specified time or the specified depth, whichever comes first. easy -- toggles easy mode (thinking on opponents time) on and off. The default is easy mode ON. If easy mode is dis- abled, the keyboard is polled for input every so often and when input is seen the search is terminated. It may also be terminated with a _s_i_g_i_n_t. edit -- allows the user to set up a board position. # - command will clear the board. Sun Release 4.1 Last change: 4 gnuchess(6) GAMES AND DEMOS gnuchess(6) c - toggle piece color. . - command will exit setup mode. pb3 - place a pawn on b3 Pieces are entered by typing a letter (p,n,b,r,q,k) for the piece followed by the coordinate. The usual warning about the _l_a_n_g_u_a_g_e _f_i_l_e applies. exit -- exits gnuchess. first -- tells the computer to move first. Computer begins searching for a move. (same as "go"). force -- allows the user to enter moves for both sides. To get the program to play after a sequence of moves has been entered use the 'white' or 'black' command followed by 'go'. gamein -- toggles game mode time control. Assumes the time specified for time control is the time for a complete game. Input with the level command should be the game time and the expected number of moves in a game. get -- retrieves a game from disk. The program will prompt the user for a file name. hash -- use/don't use hashfile. hashdepth -- allows the user to change the minimum depth for using the hashfile and the number of moves from the begining of the game to use it. help -- displays a short description of the commands and the current status of options. go -- tells the computer to move first. Computer begins searching for a move. (same as "first"). hint -- causes the program to supply the user with its predicted move. level -- allows the user to set time controls such as 60 moves in 5 minutes etc. In tournament mode, the program will vary the time it takes for each move depending on the situation. If easy mode is disabled (using the 'easy' com- mand), the program will often respond with its move immedi- ately, saving time on its clock for use later on. list -- writes the game moves and some statistics on search depth, nodes, and time to the file 'chess.lst'. Sun Release 4.1 Last change: 5 gnuchess(6) GAMES AND DEMOS gnuchess(6) material -- toggle material flag - draws on no pawns and both sides < rook Mwpawn, Mbpawn, Mwknight, Mbknight, Mwbishop, Mbbishop -- print out static position evaluation table new -- starts a new game. p -- evaluates the board and shows the point score for each piece. The total score for a position is the sum of these individual piece scores. post -- causes the program to display the principle varia- tion and the score during the search. A score of 100 is equivalent to a 1 pawn advantage for the computer. quit -- exits the game. random -- causes the program to randomize its move selection slightly. rcptr -- set recapture mode. remove -- backout the last level for both sides. Equal to 2 _u_n_d_o'_s. reverse -- causes the board display to be reversed. That is, the white pieces will now appear at the top of the board. rv -- reverse board display. setup -- Compatibility with Unix chess and the nchesstool. Set up a board position. Eight lines of eight characters are used to setup the board. a8-h8 is the first line. Black pieces are represented by uppercase characters. stars -- (gnuchessn only) add stars (*) to black pieces. save -- saves a game to disk. The program will prompt the user for a file name. switch -- causes the program to switch places with the opponent and begin searching. test -- performs some speed tests for MoveList and CaptureL- ist generation, and ScorePosition position scoring for the current board. time otim -- time set computers time remaining, intended for synchronizing clocks among multiple players. -- otim set opponents time remaining, intended for synchronizing clocks Sun Release 4.1 Last change: 6 gnuchess(6) GAMES AND DEMOS gnuchess(6) among multiple players. undo -- undoes the last move whether it was the computer's or the human's. You may also type "remove". This is equivalent to two "undo's" (e.g. retract one move for each side). white -- causes the computer to take the white pieces. If the computer is to move first the go command must be given. xget -- read an _x_b_o_a_r_d position file. xwndw -- change X window. The window around alpha/beta used to determine whether the position should be scored or just estimated. BUGS SEE ALSO chesstool(6) xboard(6) Sun Release 4.1 Last change: 7 gnuchess-4.0.pl70/doc/bincheckr.6100644 21542 13 650 5270754225 15550 0ustar cracraftuser.TH BINCHECKR GNUCHESS .SH NAME bincheckr .SH SYNOPSIS .B bincheckr filename .SH DESCRIPTION .I Bincheckr is a program to check the opening book of .I gnuchess for eficiency. .PP .I bincheckr accepts a binary book file containing chess moves and checks the file for run length. It prints statistics for the binary book file. .SH "FUNCTION LETTERS" .SH BUGS .PP .fi .SH SEE ALSO .nf gnuchess(6) chesstool(6) xboard(6) .fi gnuchess-4.0.pl70/misc/ 40755 21542 13 0 5554020520 13626 5ustar cracraftusergnuchess-4.0.pl70/misc/match100755 21542 13 1535 5203675764 14772 0ustar cracraftuser#!/bin/sh # # match -- play a series of games using xboard as a referee # case $# in 8) COUNT=0; PGM1=$2 ; PGM2=$4 ; LENGTH=$6 ; MODE=$8 ;; *) echo "Usage: match -pgm1 pgm -pgm2 pgm -length \ games -mode (Init | Position | Opening)" ; exit esac while (:) do if (test $COUNT -eq $LENGTH) then break else COUNT=`echo $COUNT | awk '{print $0 + 1}'` MODULO=`echo $COUNT | awk '{print $0 % 2}'` if (test $MODULO -eq 0) then xboard -fcp $PGM1 -scp $PGM2 \ -matchMode $MODE -saveGameFile match.game.$COUNT \ -savePositionFile match.position.$COUNT -iconic else xboard -fcp $PGM2 -scp $PGM1 \ -matchMode $MODE -saveGameFile match.game.$COUNT \ -savePositionFile match.position.$COUNT -iconic fi fi done gnuchess-4.0.pl70/misc/ChessFont100644 21542 13 66636 5074360657 15622 0ustar cracraftuser%!PS-Adobe-1.0 %% This is my font for chess and similar pieces. It is supplied "as is". %% It works for me, I have no idea whether it will work for you; you gets %% what you pays for. Before using it, you should read the Copyright %% notice below and the "README" file which should accompany this file. %% -- ANW, March 1991. /Cfont 9 dict dup begin /FontMatrix [ 0.001 0 0 0.001 0 0 ] readonly def /FontType 3 def /FontBBox [ 0 0 0 0 ] readonly def /Encoding 256 array def /FontInfo 3 dict dup begin /Notice ( Copyright (c) 1991 A. N. Walker. All rights reserved. This notice must be preserved in all versions of this file, and any alterations which you make must be clearly marked as such. For further information, see the "README" file which should accompany this, or contact me at Dept of Mathematics, Nottingham Univ., UK, anw@maths.nott.ac.uk. ) readonly def /FullName (ChessFont) readonly def /version (2.0) readonly def end def /UniqueID 472474 def Encoding 0 1 255 { 2 copy /.notdef put pop } for dup 8#040 /Wsquare put % ' ' dup 8#042 /flap put % '"' dup 8#043 /board put % '#' dup 8#047 /flip put % '''' dup 8#052 /Bsquare put % '*' dup 8#055 /edge put % '-' dup 8#056 /blobfig put % '.' dup 8#057 /corner put % '/' dup 8#060 /m0 put % '0' dup 8#061 /Wsquare put % '1' dup 8#062 /m2 put % '2' dup 8#063 /m3 put % '3' dup 8#064 /m4 put % '4' dup 8#065 /m5 put % '5' dup 8#066 /m6 put % '6' dup 8#067 /m7 put % '7' dup 8#070 /m8 put % '8' dup 8#071 /m9 put % '9' dup 8#073 /nextline put % ';' dup 8#074 /m-1 put % '<' dup 8#076 /Wsquare put % '>' dup 8#100 /wblock put % '@' dup 8#102 /WB put % 'B' dup 8#103 /WC put % 'C' dup 8#104 /WD put % 'D' dup 8#105 /WE put % 'E' dup 8#106 /WF put % 'F' dup 8#107 /WG put % 'G' dup 8#111 /blob put % 'I' dup 8#113 /WK put % 'K' dup 8#114 /WL put % 'L' dup 8#115 /WM put % 'M' dup 8#116 /WN put % 'N' dup 8#117 /BO put % 'O' dup 8#120 /WP put % 'P' dup 8#121 /WQ put % 'Q' dup 8#122 /WR put % 'R' dup 8#123 /WS put % 'S' dup 8#124 /WT put % 'T' dup 8#125 /WU put % 'U' dup 8#126 /WV put % 'V' dup 8#130 /WX put % 'X' dup 8#132 /WZ put % 'Z' dup 8#133 /posstart put % '[' dup 8#135 /posfinish put % ']' dup 8#137 /underbar put % '_' dup 8#142 /BB put % 'b' dup 8#143 /BC put % 'c' dup 8#144 /BD put % 'd' dup 8#145 /BE put % 'e' dup 8#146 /BF put % 'f' dup 8#147 /BG put % 'g' dup 8#151 /blob put % 'i' dup 8#153 /BK put % 'k' dup 8#154 /BL put % 'l' dup 8#155 /BM put % 'm' dup 8#156 /BN put % 'n' dup 8#157 /BO put % 'o' dup 8#160 /BP put % 'p' dup 8#161 /BQ put % 'q' dup 8#162 /BR put % 'r' dup 8#163 /BS put % 's' dup 8#164 /BT put % 't' dup 8#165 /BU put % 'u' dup 8#166 /BV put % 'v' dup 8#170 /BX put % 'x' dup 8#172 /BZ put % 'z' dup 8#174 /sidebar put % '|' dup 8#240 /Wsquare put % ' '+ dup 8#241 /without put % '!'+ dup 8#242 /flap put % '"'+ dup 8#243 /board put % '#'+ dup 8#245 /infinityequals put % '%'+ dup 8#247 /flip put % ''''+ dup 8#252 /circledot put % '*'+ dup 8#253 /plus put % '+'+ dup 8#255 /minus put % '-'+ dup 8#272 /doubled put % ':'+ dup 8#273 /nextline put % ';'+ dup 8#274 /equalsplus put % '<'+ dup 8#275 /equal put % '='+ dup 8#276 /plusequals put % '>'+ dup 8#277 /infinity put % '?'+ dup 8#300 /circarrow put % '@'+ dup 8#302 /Bfig put % 'B'+ dup 8#303 /Cfig put % 'C'+ dup 8#304 /Dfig put % 'D'+ dup 8#305 /Efig put % 'E'+ dup 8#306 /Ffig put % 'F'+ dup 8#307 /Gfig put % 'G'+ dup 8#311 /blobfig put % 'I'+ dup 8#313 /Kfig put % 'K'+ dup 8#314 /Lfig put % 'L'+ dup 8#315 /Mfig put % 'M'+ dup 8#316 /Nfig put % 'N'+ dup 8#317 /Ofig put % 'O'+ dup 8#320 /Pfig put % 'P'+ dup 8#321 /Qfig put % 'Q'+ dup 8#322 /Rfig put % 'R'+ dup 8#323 /Sfig put % 'S'+ dup 8#324 /Tfig put % 'T'+ dup 8#325 /Ufig put % 'U'+ dup 8#326 /Vfig put % 'V'+ dup 8#330 /Xfig put % 'X'+ dup 8#332 /Zfig put % 'Z'+ dup 8#333 /minusorplus put % '['+ dup 8#335 /plusorminus put % ']'+ dup 8#336 /uparrow put % '^'+ dup 8#341 /rightarrow put % 'a'+ dup 8#342 /semicircle put % 'b'+ dup 8#343 /centre put % 'c'+ dup 8#344 /diags put % 'd'+ dup 8#345 /etc put % 'e'+ dup 8#346 /Phalo put % 'f'+ dup 8#347 /samebs put % 'g'+ dup 8#350 /edgefig put % 'h'+ dup 8#351 /triangle put % 'i'+ dup 8#352 /Bsquarefig put % 'j'+ dup 8#353 /kside put % 'k'+ dup 8#354 /line put % 'l'+ dup 8#355 /hash put % 'm'+ dup 8#356 /cornerfig put % 'n'+ dup 8#357 /square put % 'o'+ dup 8#360 /ending put % 'p'+ dup 8#361 /qside put % 'q'+ dup 8#362 /Pfill put % 'r'+ dup 8#363 /separated put % 's'+ dup 8#364 /tempo put % 't'+ dup 8#365 /united put % 'u'+ dup 8#366 /oppbs put % 'v'+ dup 8#367 /with put % 'w'+ dup 8#370 /weakpt put % 'x'+ dup 8#371 /bpair put % 'y'+ dup 8#372 /circlebolddot put % 'z'+ 8#374 /botharrow put % '|'+ /CharProcs 200 dict dup begin % Miscellaneous: /.notdef { } bind def /Arcto { arcto 4 { pop } repeat } bind def /Ddn3c { dup dup neg 3 copy } bind def /Round { dtransform round exch round exch idtransform } bind def /Rlineto { Round rlineto } bind def /Rmoveto { Round rmoveto } bind def /diamond { moveto dup neg 0 rmoveto dup dup neg rlineto dup dup rlineto dup neg exch rlineto closepath } bind def /dohalo { gsave 100 setlinewidth setW stroke grestore } bind def /dofill { gsave fill grestore } bind def /motion { 1000 mul exch 1000 mul exch setcharwidth } bind def /setW { 1 setgray } bind def /setB { 0 setgray } bind def /drawingB { 0 currentgray eq } bind def /setfig { 1000 0 0 -200 1000 800 setcachedevice 500 300 translate } bind def /setpce { 1000 0 setcharwidth 500 dup translate 0.95 dup scale } bind def /MiscStr (a) def /tofig { 0 get 8#200 add MiscStr exch 0 exch put MiscStr } bind def /Tofig { 1 0.95 div dup scale tofig } bind def /intext true def /flip { 0 0 setcharwidth /intext intext not def } bind def /flap { 0 0 setcharwidth /intext true def } bind def /Setfont { /ChessFont findfont 1000 scalefont setfont } bind def /Show { rotate -500 dup moveto Setfont show } bind def /Showfig { rotate -500 -300 moveto Setfont show } bind def /LocStr (a) def /SetChar { dup 8#047 eq { pop flip stop } if dup 8#200 lt { intext { 8#200 add LocStr exch 0 exch put Setfont LocStr dup stringwidth setcharwidth 0 0 moveto show stop } if } if } bind def /DoChar { Encoding exch get cvx exec } bind def % Kings /WK { setpce Kout dohalo setW dofill setB stroke Kin } bind def /BK { setpce Kout dohalo dofill stroke setW Kin } bind def /Kfig { setfig Kout stroke Kin } bind def /Kout { 2 setmiterlimit 325 -100 moveto 600 100 350 400 125 250 curveto 0 250 rlineto -250 0 rlineto 0 -250 rlineto -350 400 -600 100 -325 -100 curveto 0 -250 rlineto -100 -500 100 -500 325 -350 curveto closepath 30 setlinewidth } bind def /Kin { drawingB { 325 } { 275 } ifelse Ddn3c -350 moveto 0 -300 3 -1 roll -350 800 Arcto -350 lineto -100 moveto 0 -50 3 -1 roll -100 800 Arcto -100 lineto 15 0 -185 diamond 15 -250 -210 diamond 15 250 -210 diamond drawingB { 125 } { 75 } ifelse Ddn3c dup dup 4 { 0 375 moveto rlineto } repeat drawingB { 0 -45 moveto 125 250 lineto -250 0 rlineto closepath } { 15 0 180 diamond 265 -95 moveto 480 150 280 380 50 -50 curveto -265 -95 moveto -480 150 -280 380 -50 -50 curveto } ifelse stroke } bind def % Queens /WQ { setpce Qout dohalo setW dofill setB stroke Qin } bind def /BQ { setpce Qout dohalo dofill stroke setW Qin } bind def /Qfig { setfig Qout stroke Qin } bind def /Qout { 2 setmiterlimit 0 75 moveto -150 440 50 -80 280 arc -250 25 lineto -440 200 50 -60 300 arc -325 -100 lineto 0 -250 rlineto -100 -500 100 -500 325 -350 curveto 0 250 rlineto 440 200 50 -120 240 arc 250 25 lineto 150 440 50 -100 260 arc closepath 30 setlinewidth } bind def /Qin { drawingB { 325 } { 275 } ifelse Ddn3c -350 moveto 0 -300 3 -1 roll -350 800 Arcto -350 lineto -100 moveto 0 -50 3 -1 roll -100 800 Arcto -100 lineto 15 0 -185 diamond 15 -250 -210 diamond 15 250 -210 diamond stroke } bind def % Rooks /WR { setpce Rout dohalo setW dofill setB stroke Rin } bind def /BR { setpce Rout dohalo dofill stroke setW Rin } bind def /Rfig { setfig Rout stroke Rin } bind def /Rout { -325 -450 moveto 650 0 rlineto 0 50 rlineto -100 175 rlineto 0 400 rlineto 50 75 rlineto 0 150 rlineto -86 0 rlineto -30 -100 rlineto -86 0 rlineto -30 100 rlineto -86 0 rlineto -30 -100 rlineto -86 0 rlineto -30 100 rlineto -86 0 rlineto 0 -150 rlineto 50 -75 rlineto 0 -400 rlineto -100 -175 rlineto closepath 30 setlinewidth } bind def /Rin { drawingB { -225 } { -195 } ifelse dup -225 moveto dup -2 mul 0 rlineto dup 175 moveto -2 mul 0 rlineto stroke } bind def % Bishops /WB { Bsetpce Bout setW dofill setB stroke Bin } bind def /BB { Bsetpce Bout dofill stroke setW Bin } bind def /Bfig { Bsetfig Bout stroke Bin } bind def /Bsetpce { /Binpce true def setpce } bind def /Bsetfig { /Binpce false def setfig } bind def /Bout { 2 setmiterlimit -400 -500 moveto 100 100 300 0 400 100 rcurveto 100 -100 300 0 400 -100 rcurveto 0 100 rlineto -100 100 -300 0 -400 100 rcurveto -100 -100 -300 0 -400 -100 rcurveto closepath 200 -350 moveto 0 200 rlineto 200 0 150 215 0 325 curveto -75 420 40 -90 270 arc -340 100 -340 100 -200 -150 curveto 0 -200 rlineto 200 50 rlineto closepath 30 setlinewidth gsave 0 325 moveto 150 215 200 0 200 -150 curveto 340 100 340 100 75 380 curveto 75 420 40 -90 270 arc closepath Binpce { dohalo setW dofill setB } if stroke grestore } bind def /Bin { 15 0 -225 diamond drawingB { 200 } { 150 } ifelse Ddn3c -350 moveto 20 rlineto -20 rlineto -150 moveto 30 rlineto -30 rlineto stroke } bind def % Knights /WN { setpce Nout dohalo setW dofill setB stroke Nin } bind def /BN { setpce Nout dohalo dofill stroke setW Nin } bind def /Nfig { setfig Nout stroke Nin } bind def /Nout { 2 setmiterlimit 450 -450 moveto 450 200 150 350 -50 400 curveto -25 100 rlineto -75 -200 rlineto -75 150 rlineto 0 -150 rlineto -125 -125 -325 -400 -275 -450 rcurveto 75 -75 rlineto 100 130 rlineto 0 -200 rlineto 50 -25 150 100 100 150 rcurveto 50 -50 150 75 125 150 rcurveto 125 -300 -250 -250 -250 -450 curveto closepath 30 setlinewidth } bind def /Nin { 15 -200 150 diamond stroke drawingB { [ 100 100 ] 0 setdash 410 -450 moveto 410 200 130 330 -60 380 curveto 50 setlinewidth stroke } { 430 -430 moveto 430 200 150 350 -30 370 curveto 150 250 390 200 390 -430 curveto fill } ifelse } bind def % Pawns % Pawns are the only symbols which occur "frequently" in a chess % diagram, so we make a special effort to optimise their caching % behaviour. Also, they are the only symbols for which this is % easy! /WP { setpce Setfont setW 0 0 moveto (f) tofig show setB (P) tofig -500 -300 rmoveto show } bind def /BP { setpce Setfont setW 0 0 moveto (f) tofig show setB (r) tofig show } bind def /Pfig { setfig Pout stroke Pin } bind def /Pout { 300 -450 moveto 200 -300 200 -300 75 -250 curveto 125 -50 125 -50 75 150 curveto 125 150 100 0 90 arc 0 300 100 -30 210 arc -125 150 100 90 180 arc 150 0 rlineto -125 -50 -125 -50 -75 -250 curveto -200 -300 -200 -300 -300 -450 curveto closepath 50 setlinewidth } bind def /Pin { -75 150 moveto 150 0 rlineto stroke } bind def /Phalo { 0 0 -350 -500 350 450 setcachedevice Pout gsave 100 setlinewidth stroke grestore fill } bind def /Pfill { 0 0 -325 -475 375 425 setcachedevice Pout gsave stroke grestore fill } bind def % Fous % There seem to be several styles of Fou (French Bishop) -- I have % selected the easiest to implement. Anyone who *really* wants % this piece can do some work for themselves! /WF { setpce Fout dohalo setW dofill setB stroke Fin } bind def /BF { setpce Fout dohalo dofill stroke setW Fin } bind def /Ffig { setfig Fout stroke Fin } bind def /Fout { 2 setlinejoin -300 -400 moveto 150 300 rlineto -250 500 rlineto 250 -125 rlineto 150 175 rlineto 150 -175 rlineto 250 125 rlineto -250 -500 rlineto 150 -300 rlineto closepath 30 setlinewidth } bind def /Fin { 0 -400 150 dup mul 675 dup mul add sqrt drawingB { 600 300 } { 30 sub 600 270 } ifelse atan dup 180 sub neg arc 400 drawingB not { 15 5 sqrt mul add } if dup neg 400 moveto dup dup -2 mul rlineto dup 2 mul rlineto 30 -100 150 diamond 30 100 150 diamond 0 175 moveto 0 -200 rlineto currentpoint stroke 75 210 330 arc stroke } bind def % Miscellaneous Fairy pieces % Grasshopper /WG { setpce (Q) 180 Show } bind def /BG { setpce (q) 180 Show } bind def /Gfig { setfig (Q) tofig 180 Showfig } bind def % Nightrider. Real problemists use S for Knight and N for Nightrider; % the weight of tradition forces N for Knight, hence S here. /WS { setpce (N) 180 Show } bind def /BS { setpce (n) 180 Show } bind def /Sfig { setfig (N) tofig 180 Showfig } bind def % Zebra /WZ { setpce (N) -90 Show } bind def /BZ { setpce (n) -90 Show } bind def /Zfig { setfig (N) tofig -90 Showfig } bind def % Mao. Also Camel, but C is for Chameleon. /WM { setpce (N) 90 Show } bind def /BM { setpce (n) 90 Show } bind def /Mfig { setfig (N) tofig 90 Showfig } bind def % Vao /WV { setpce (B) 90 Show } bind def /BV { setpce (b) 90 Show } bind def /Vfig { setfig (B) tofig 90 Showfig } bind def % Equihopper /WE { setpce (Q) -90 Show } bind def /BE { setpce (q) -90 Show } bind def /Efig { setfig (Q) tofig -90 Showfig } bind def % Leo. Also Locust, Lion, Edgehog /WL { setpce (Q) 90 Show } bind def /BL { setpce (q) 90 Show } bind def /Lfig { setfig (Q) tofig 90 Showfig } bind def % Pao. Also Empress. Sorry, all Uther mnemonics seemed to be used Up. /WU { setpce (R) 90 Show } bind def /BU { setpce (r) 90 Show } bind def /Ufig { setfig (R) tofig 90 Showfig } bind def % Orphan -- NB, all Orphans are black! /BO { setpce (p) 90 Show } bind def /Ofig { setfig 90 rotate Pout dofill stroke } bind def % Rose. Gardeners will know why T is mnemonic for this. /WT { setpce Tout dohalo setW dofill setB stroke Tin } bind def /BT { setpce Tout dohalo dofill stroke setW Tin } bind def /Tfig { setfig Tout stroke Tin } bind def /Tout { 300 2 sqrt 1 sub mul 8 { dup 300 exch dup -90 135 arc 45 rotate } repeat pop 50 setlinewidth } bind def /Tin { drawingB { 270 } { 300 } ifelse 8 { dup 0 0 moveto 0 lineto 45 rotate } repeat pop stroke } bind def % Chameleon /WC { setpce Cout dohalo setW dofill setB stroke } bind def /BC { setpce Cout dohalo dofill stroke } bind def /Cfig { setfig Cout stroke } bind def /Cout { 2 setmiterlimit 50 setlinewidth -250 -350 moveto 500 0 rlineto -500 700 rlineto 500 0 rlineto closepath } bind def % Blob [for marking squares], also for Imitator /blob { setpce 0 0 250 0 360 arc dohalo dofill } bind def /blobfig { setfig 0 200 250 0 360 arc dofill } bind def % Draughts/Dame/Checkers pieces % Man /WD { setpce Dout dohalo setW dofill setB stroke Din } bind def /BD { setpce Dout dohalo dofill stroke setW Din } bind def /Dfig { setfig Dout stroke Din } bind def /Dout { 1 0.5 scale 0 0 350 0 180 arc 0 -400 350 180 0 arc closepath 50 setlinewidth } bind def /Din { 0 0 350 drawingB { 180 0 } { 210 -30 20 setlinewidth } ifelse arc stroke 20 setlinewidth 0 0 220 0 360 arc stroke 0 0 80 0 360 arc stroke } bind def % King. The mnemonic for this is unknown. /WX { setpce Xout dohalo setW dofill setB stroke Xin } bind def /BX { setpce Xout dohalo dofill stroke setW Xin } bind def /Xfig { setfig Xout stroke Xin } bind def /Xout { 1 0.5 scale 0 400 350 0 180 arc 0 -400 350 180 0 arc closepath 50 setlinewidth } bind def /Xin { 0 400 350 drawingB { 180 0 } { 210 -30 20 setlinewidth } ifelse arc stroke 0 0 350 drawingB { 180 0 } { 210 -30 } ifelse arc stroke 20 setlinewidth 0 400 220 0 360 arc stroke 0 400 80 0 360 arc stroke } bind def % Board symbols /Wsquare { 1 0 motion } bind def /Bsquare { setpce (j) Tofig 90 Show } bind def /Bsquarefig { 1000 0 0 0 1000 1000 setcachedevice /xpix 62.5 dup dtransform /ypix exch def def /xpabs xpix abs def /ypabs ypix abs def xpabs ypabs lt { ypabs ceiling dup 4 lt { pop 4 } if dup ypix div xpix mul exch } { xpabs ceiling dup 4 lt { pop 4 } if dup xpix div ypix mul } ifelse idtransform pop abs dup 3 div setlinewidth dup 2 mul 2000 { dup 1000 lt { dup 0 moveto 0 exch lineto } { 1000 sub dup 1000 moveto 1000 exch lineto } ifelse } for stroke } bind def /board { 10000 0 800 0 9200 8400 setcachedevice % Setfont intext /intext dup true def 1000 8200 moveto % 4 { (hhhhhhhhn) show currentpoint translate -90 rotate } repeat % -90 rotate 0 7000 moveto % The above was the intention, but the borders sometimes fail to match % up by a pixel or two. Hence the following! However, the borders % work perfectly well for special purposes. Setfont intext /intext dup true def 20 setlinewidth 940 140 moveto 8120 0 Rlineto 0 8120 Rlineto -8120 0 Rlineto closepath stroke 80 setlinewidth 840 40 moveto 8320 0 Rlineto 0 8320 Rlineto -8320 0 Rlineto closepath stroke 2000 200 moveto 90 rotate 4 { (j j j j ; j j j j;) show } repeat exch def } bind def /nextline { -8 -1 motion } bind def /edge { setpce (h) Tofig 0 Show } bind def /edgefig { 1000 0 0 0 1000 200 setcachedevice 20 setlinewidth 0 60 moveto 1000 0 rlineto stroke 80 setlinewidth 0 160 moveto 1000 0 rlineto stroke } bind def /corner { setpce (n) Tofig 0 Show } bind def /cornerfig { 0 0 0 0 200 200 setcachedevice 20 setlinewidth 0 60 moveto 60 0 rlineto 0 -60 rlineto stroke 80 setlinewidth 0 160 moveto 160 0 rlineto 0 -160 rlineto stroke } bind def /posstart { -9 7.2 motion } bind def /posfinish { 1 -0.2 motion } bind def /m0 { 0.5 dup motion } bind def /m2 { 2 0 motion } bind def /m3 { 3 0 motion } bind def /m4 { 4 0 motion } bind def /m5 { 5 0 motion } bind def /m6 { 6 0 motion } bind def /m7 { 7 0 motion } bind def /m8 { 8 0 motion } bind def /m9 { 0 1 motion } bind def /m-1 { -1 0 motion } bind def /underbar { 1000 0 -40 -40 1040 40 setcachedevice 80 setlinewidth 1 setlinecap 0 0 moveto 1000 0 lineto stroke } bind def /sidebar { 0 0 setcharwidth 80 setlinewidth 1 setlinecap 0 0 moveto 0 1000 lineto stroke } bind def /wblock { 0 0 setcharwidth setW 200 200 moveto 600 0 rlineto 0 600 rlineto -600 0 rlineto fill } bind def % Informant symbols /plusequals { 1000 0 100 0 900 800 setcachedevice 20 setlinewidth 100 10 moveto 800 0 rlineto 0 140 Rmoveto -800 0 rlineto 0 300 Rmoveto 800 0 rlineto 500 150 moveto 0 650 rlineto stroke } bind def /equalsplus { 1000 0 100 0 900 800 setcachedevice 20 setlinewidth 100 790 moveto 800 0 rlineto 0 -140 Rmoveto -800 0 rlineto 0 -300 Rmoveto 800 0 rlineto 500 0 moveto 0 650 rlineto stroke } bind def /plusorminus { 1000 0 100 0 900 800 setcachedevice 30 setlinewidth 100 15 moveto 800 0 rlineto 0 385 Rmoveto -800 0 rlineto 500 0 moveto 0 800 rlineto stroke } bind def /minusorplus { 1000 0 100 0 900 800 setcachedevice 30 setlinewidth 100 785 moveto 800 0 rlineto 0 -385 Rmoveto -800 0 rlineto 500 0 moveto 0 800 rlineto stroke } bind def /plus { 1000 0 100 0 900 800 setcachedevice 30 setlinewidth 100 400 moveto 800 0 rlineto 500 0 moveto 0 800 rlineto stroke } bind def /minus { 1000 0 100 385 900 415 setcachedevice 30 setlinewidth 100 400 moveto 800 0 rlineto stroke } bind def /equal { 1000 0 100 300 800 180 Round 320 add exch 100 add exch setcachedevice 20 setlinewidth 100 310 moveto 800 0 rlineto 0 180 Rmoveto -800 0 rlineto stroke } bind def /infinity { 1000 0 95 60 905 540 setcachedevice 40 setlinewidth 275 300 160 0 360 arc 660 300 225 -180 180 arc stroke } bind def /infinityequals { 1000 0 95 10 905 750 setcachedevice 30 setlinewidth 275 250 160 0 360 arc 660 250 225 -180 180 arc 100 565 moveto 800 0 rlineto 0 180 Rmoveto -800 0 rlineto stroke } bind def /circarrow {1000 0 100 0 900 800 setcachedevice 30 setlinewidth 500 400 385 0 30 arcn -200 0 rmoveto 200 0 rlineto 0 200 rlineto stroke } bind def /circledot { 900 0 100 0 800 700 setcachedevice 20 setlinewidth 450 350 20 0 360 arc fill 450 350 340 0 360 arc stroke } bind def /rightarrow { 1200 0 100 185 1115 615 setcachedevice 30 setlinewidth 100 400 moveto 1000 0 rlineto -200 -200 rmoveto 200 200 rlineto -200 200 rlineto stroke } bind def /uparrow { 500 0 35 0 465 915 setcachedevice 30 setlinewidth 250 0 moveto 0 900 rlineto -200 -200 rmoveto 200 200 rlineto 200 -200 rlineto stroke } bind def /botharrow { 1200 0 100 70 1100 730 setcachedevice 20 setlinewidth 100 280 moveto 990 0 rlineto -200 -200 rmoveto 200 200 rlineto -200 200 rlineto 1100 520 moveto -990 0 rlineto 200 -200 rmoveto -200 200 rlineto 200 200 rlineto stroke } bind def /circlebolddot { 1000 0 100 0 900 800 setcachedevice 20 setlinewidth 500 400 50 0 360 arc fill 500 400 390 0 360 arc stroke } bind def /hash { 1000 0 100 0 900 800 setcachedevice 30 setlinewidth 100 280 moveto 800 0 rlineto 0 240 Rmoveto -800 0 rlineto 380 0 moveto 0 800 rlineto 240 0 Rmoveto 0 -800 rlineto stroke } bind def /triangle { 900 0 100 0 800 750 setcachedevice 30 setlinewidth 100 15 moveto 350 735 rlineto 350 -735 rlineto closepath stroke } bind def /square { 900 0 100 0 680 680 Round 20 add exch 120 add exch setcachedevice 20 setlinewidth 110 10 moveto 680 0 Rlineto 0 680 Rlineto -680 0 Rlineto closepath stroke } bind def /semicircle { 1000 0 50 0 950 465 setcachedevice 30 setlinewidth 500 15 435 0 180 arc closepath stroke } bind def /line { 1000 0 100 190 900 610 setcachedevice 20 setlinewidth 220 300 moveto 560 0 rlineto 0 200 Rmoveto -560 0 rlineto 310 200 moveto -200 200 rlineto 200 200 rlineto 690 200 moveto 200 200 rlineto -200 200 rlineto stroke } bind def /diags { 1000 0 100 0 900 800 setcachedevice 20 setlinewidth 110 120 moveto 670 dup rlineto 110 -110 Rmoveto -670 dup rlineto 640 790 moveto 250 0 rlineto 0 -250 rlineto stroke } bind def /centre { 1000 0 100 0 780 780 Round 20 add exch 120 add exch setcachedevice 20 setlinewidth 110 10 moveto 780 0 Rlineto 0 780 Rlineto -780 0 Rlineto closepath 110 400 moveto 780 0 rlineto 500 10 moveto 0 780 Rlineto stroke } bind def /kside { 700 0 100 0 600 800 setcachedevice 20 setlinewidth 110 10 moveto 300 390 rlineto -300 390 rlineto 180 0 Rmoveto 300 -390 rlineto -300 -390 rlineto stroke } bind def /qside { 700 0 100 0 600 800 setcachedevice 20 setlinewidth 590 10 moveto -300 390 rlineto 300 390 rlineto -180 0 Rmoveto -300 -390 rlineto 300 -390 rlineto stroke } bind def /weakpt { 700 0 100 0 600 500 setcachedevice 30 setlinewidth 110 10 moveto 480 480 rlineto 590 10 moveto -480 480 rlineto stroke } bind def /ending { 1000 0 100 0 900 800 setcachedevice 30 setlinewidth 100 15 moveto 800 0 rlineto 500 0 moveto 0 800 rlineto stroke } bind def /bpair { 1200 0 100 0 980 580 Round 20 add exch 120 add exch setcachedevice 20 setlinewidth 110 10 moveto 570 0 Rlineto 0 370 Rlineto -570 0 Rlineto closepath 110 10 moveto 980 580 Rmoveto -570 0 Rlineto 0 -370 Rlineto 570 0 Rlineto closepath stroke } bind def /oppbs { 1200 0 100 0 1100 600 setcachedevice 20 setlinewidth 110 10 moveto 570 0 Rlineto 0 370 Rlineto -570 0 Rlineto closepath stroke 1100 600 moveto -590 0 rlineto 0 -390 rlineto 590 0 rlineto fill } bind def /samebs { 1200 0 100 0 1100 600 setcachedevice 100 0 moveto 590 0 rlineto 0 390 rlineto -590 0 rlineto closepath 1100 600 moveto -590 0 rlineto 0 -390 rlineto 590 0 rlineto fill } bind def /united { 1210 0 50 0 1160 530 setcachedevice 30 setlinewidth 315 265 250 0 360 arc stroke 895 265 250 0 360 arc stroke } bind def /separated { 1550 0 50 0 1500 530 setcachedevice 30 setlinewidth 315 265 250 0 360 arc stroke 1235 265 250 0 360 arc stroke 665 30 60 0 360 arc fill 885 30 60 0 360 arc fill } bind def /doubled { 730 0 100 0 630 1160 setcachedevice 30 setlinewidth 365 265 250 0 360 arc stroke 365 895 250 0 360 arc stroke } bind def /tempo { 1000 0 100 0 900 800 setcachedevice 20 setlinewidth 110 400 moveto 500 400 390 0 360 arc 500 10 moveto 0 790 rlineto stroke } bind def /with { 1000 0 100 0 900 800 setcachedevice 30 setlinewidth 100 800 moveto 0 -785 rlineto 785 0 rlineto stroke } bind def /without { 1000 0 100 0 900 800 setcachedevice 30 setlinewidth 100 15 moveto 785 0 rlineto 0 785 rlineto stroke } bind def /etc { 500 0 100 0 270 800 Round exch 130 add exch setcachedevice 30 setlinewidth 115 0 moveto 0 800 rlineto 270 0 Rmoveto 0 -800 rlineto stroke } bind def end def /BuildChar { exch begin CharProcs begin { SetChar } stopped not { DoChar } if end end } bind def end def /ChessFont Cfont definefont pop % Demo file to be appended to the Chess Font file & sent to your LaserWriter % (or whatever else you do with PostScript!). % Miscellaneous useful procedures: % show string centred on the current point /cshow { dup stringwidth -2 div exch -2 div exch rmoveto show } bind def % Draw rank and file labels round a standard diagram % On entry, the ChessFont must be currently selected, % and the (properly scaled) font desired for the labels % must be top of stack. Uses "cshow", defined above /dolabels { ('[<0) show % position of top-left label (0) stringwidth -1.5 div % 1/3-square offset 0 exch rmoveto exch % restore labelfont to top of stack [(8)(7)(6)(5)(4)(3)(2)(1)] % rank labels { gsave exch % stack == offset, label, labelfont dup setfont exch cshow grestore (8;) show % move down a rank } forall [(a)(b)(c)(d)(e)(f)(g)(h)] % file labels { (>) show % move along a file gsave exch % as before dup setfont exch cshow grestore } forall pop % zap the labelfont (0]') show % move to RHS of board 1.5 div 0 exch rmoveto % undo previous offset } bind def % Rotate a piece. The piece [eg "(Q)"] and the desired rotation % (in degrees, anticlockwise) should be on the stack /twirl { gsave % keep graphics state (0) show % go to centre of square rotate % no of degrees was on stack (07;) show % back to bottom left of rotated square -- % "0" takes us from centre to top right, "7" % advances 7 squares, ";" goes down one and % back 8 show % string was on stack grestore % restore graphics state ( ) show % advance to next square } bind def % Draw a neutral piece (for Fairy chess). Expects two strings % [eg. "(R) (r)"] on the stack; the first will be drawn in % the left half of the square, the second in the right half. /neutral { 2 dict begin % small dictionary for xinc, yinc gsave % keep graphics state (0) stringwidth % distance to centre of square /yinc exch 2 mul def /xinc exch def currentpoint xinc 0 rlineto % draw clipping rectangle round 0 yinc rlineto % left half of square xinc neg 0 rlineto clip moveto show % show left half-piece grestore gsave % cancel clip currentpoint xinc 0 rmoveto xinc 0 rlineto % clip right half of square 0 yinc rlineto xinc neg 0 rlineto clip moveto show % show right half-piece grestore % restore graphics state ( ) show % advance to next square end % close small dictionary } bind def % End of generally useful procedures. % Quick hack definitions for this file: % Miscellaneous definitions: /ps 10.5 def % point size /vs 12.5 def % vertical spacing /V 11 72 mul def % top margin /L 40 def % left margin /N { L V vs sub dup /V exch def moveto } bind def % newline /T { currentpoint exch L sub 6 add 36 div ceiling 36 mul L add exch moveto } bind def % tab % Switch into Chess/Times/Courier/Bold /C { /ChessFont findfont ps scalefont setfont } bind def /R { /Times-Roman findfont ps scalefont setfont } bind def /H { /Courier findfont ps scalefont setfont } bind def /B { /Times-Bold findfont ps 1.25 mul scalefont setfont } bind def 12345 % pseudo-random item on stack, as check gnuchess-4.0.pl70/misc/shellit100644 21542 13 16134 5217645261 15352 0ustar cracraftuser#! /bin/sh # This is a shell archive, meaning: # 1. Remove everything above the #! /bin/sh line. # 2. Save the resulting text in a file. # 3. Execute the file with /bin/sh (not csh) to create the files: # gnuchess.lang # This archive created: Wed Jun 17 11:37:21 1992 export PATH; PATH=/bin:$PATH if test -f 'gnuchess.lang' then echo shar: will not over-write existing file "'gnuchess.lang'" else cat << \SHAR_EOF > 'gnuchess.lang' 001:eng:{ pnbrqk} 002:eng:{ PNBRQK} 003:eng:{abcdefgh} 004:eng:{12345678} 005:eng:{o-o} 006:eng:{o-o-o} 007:eng:{0-0} 008:eng:{0-0-0} 009:eng:{wWbB} 010:eng:{ score depth nodes time } 011:eng:{ score depth nodes time\n} 012:eng:{ } 013:eng:{ } 014:eng:{ %s\n} 015:eng:{ a b c d e f g h} 016:eng:{ h g f e d c b a} 017:eng:{ -} 018:eng:{ 1. 60 moves in 5 minutes} 019:eng:{ 2. 60 moves in 15 minutes} 020:eng:{ 3. 60 moves in 30 minutes} 021:eng:{ 4. 40 moves in 30 minutes} 022:eng:{ 5. 40 moves in 60 minutes} 023:eng:{ 6. 40 moves in 120 minutes} 024:eng:{ 7. 40 moves in 240 minutes} 025:eng:{ 8. 1 move in 15 minutes} 026:eng:{ 9. 1 move in 60 minutes} 027:eng:{10. 1 move in 600 minutes} 028:eng:{# Clear board\n} 029:eng:{. Exit to main\n} 030:eng:{/usr/games/lib/gnuchess.book} 031:eng:{Abort? } 032:eng:{Ambiguous Move!} 033:eng:{Awindow} 034:eng:{BAwindow= } 035:eng:{BBwindow= } 036:eng:{Beep: %-12s Transposition file: %s\n} 037:eng:{Black %s White %s %d\n} 038:eng:{Bwindow: } 039:eng:{Bwindow} 040:eng:{CHESS command summary\n} 041:eng:{CHESS} 042:eng:{Castled White %s Black %s\n} 043:eng:{Chess\n} 044:eng:{Computer mates!} 045:eng:{Computer will soon mate!} 046:eng:{Computer: %-12s Opponent: %s\n} 047:eng:{Computer: %s} 048:eng:{Could not open file} 049:eng:{Counting transposition file entries, wait!\n} 050:eng:{Create failed for %s\n} 051:eng:{Depth: %-12d Response time: %d sec\n} 052:eng:{Depth: %d} 053:eng:{Depth= %d%c } 054:eng:{Draw %s\n} 055:eng:{DrawPiece: color[sq] err} 056:eng:{Drawn game! %s} 057:eng:{Drawn game!\n} 058:eng:{Drawn game!} 059:eng:{Easy mode: %s} 060:eng:{Editing: %s} 061:eng:{Enter #moves #minutes: } 062:eng:{Enter Level: } 063:eng:{Enter file name: } 064:eng:{Enter piece & location: } 065:eng:{Enter piece: } 066:eng:{Filling transposition file, wait!\n} 067:eng:{GNU Chess display (MS-DOS, Mar 90)} 068:eng:{GNU Chess display (Nov 89)} 069:eng:{GNU Chess} 070:eng:{Game saved} 071:eng:{Hin/Hout/Tcol/Coll/Fin/Fout = %ld/%ld/%ld/%ld/%ld/%ld\n} 072:eng:{Hint: %s\n} 073:eng:{Hit to return: } 074:eng:{Human} 075:eng:{Illegal move (no matching move)%s\n} 076:eng:{Illegal move (no matching move)} 077:eng:{Illegal move..(in check)} 078:eng:{Illegal move\n} 079:eng:{Level: %ld} 080:eng:{Max Moves} 081:eng:{Max Tree= %5d} 082:eng:{MoveLimit= } 083:eng:{My move is: %s\n} 084:eng:{My move is: %s} 085:eng:{Testing Eval Speed} 086:eng:{Nf3 move knight to f3 beep turn %s\n} 087:eng:{No moves} 088:eng:{No pieces} 089:eng:{Nodes %ld Tree %d Eval %ld Rate %ld RS hi %ld lo %ld \n} 090:eng:{Nodes= %8ld, Nodes/Sec= %5ld} 091:eng:{Nodes= %ld Nodes/sec= %ld\n} 092:eng:{OFF} 093:eng:{ON} 094:eng:{Operator time(hundredths)= } 095:eng:{Opponent mates!} 096:eng:{Opponent will soon mate!} 097:eng:{Opponent: %s} 098:eng:{Playing without hashfile} 099:eng:{Random: %-12s Easy mode: %s\n} 100:eng:{Random: %s} 101:eng:{Repetition} 102:eng:{Gnuchess version %s patchlevel %s\n} 103:eng:{S%d m%d ps%d m%d ps%d} 104:eng:{Score= %d} 105:eng:{Score} 106:eng:{Setup successful\n} 107:eng:{Testing CaptureList Speed} 108:eng:{Testing MoveList Speed} 109:eng:{The file contains %d entries out of max %d\n} 110:eng:{Time Control %s %d moves %d sec %d opr %d depth\n} 111:eng:{TimeControl %d Operator Time %d\n} 112:eng:{Transposition table: %s} 113:eng:{Usage: Gnuchess [-a] [-t] [-c size] [-s savefile][-l listfile] [-x xwndw]\n} 114:eng:{WAwindow= } 115:eng:{WBwindow= } 116:eng:{White %d:%02d Black %d:%02d\n} 117:eng:{White Clock %ld Moves %ld\nBlack Clock %d Moves %d\n\n} 118:eng:{White} 119:eng:{Black} 120:eng:{Wwindow: } 121:eng:{Your move is? } 122:eng:{\n } 123:eng:{\nMove# %d Target= %ld Clock: %ld\n} 124:eng:{\nYour move is? } 125:eng:{\n\n} 126:eng:{\nmove score depth nodes time flags capture color\n} 127:eng:{\n} 128:eng:{a7a8q promote pawn to queen material turn %s\n} 129:eng:{alg} 130:eng:{bd redraw board reverse board display\n} 131:eng:{bd} 132:eng:{beep} 133:eng:{black} 134:eng:{book} 135:eng:{both} 136:eng:{c Change sides\n} 137:eng:{chess.000} 138:eng:{chess.lst.%d} 139:eng:{computer mates!\n} 140:eng:{computer will soon mate!\n} 141:eng:{computer} 142:eng:{contempt= } 143:eng:{contempt} 144:eng:{coords show coords rv reverse video\n} 145:eng:{coords} 146:eng:{debuglevel= } 147:eng:{debuglevel} 148:eng:{debug} 149:eng:{depth set search depth clock set time control\n} 150:eng:{depth= } 151:eng:{depth} 152:eng:{easy} 153:eng:{edit edit board force enter game moves\n} 154:eng:{edit} 155:eng:{enter piece & location: \n} 156:eng:{first} 157:eng:{force} 158:eng:{g1f3 move from g1 to f3 quit Exit Chess\n} 159:eng:{game file= } 160:eng:{get} 161:eng:{gnuchess 4p%s game\n} 162:eng:{go} 163:eng:{hashdepth= } 164:eng:{hashdepth} 165:eng:{hash} 166:eng:{help} 167:eng:{hint suggest a move post turn %s principle variation\n} 168:eng:{hint} 169:eng:{level} 170:eng:{list game to chess.lst book turn %s used %d of %d\n} 171:eng:{list} 172:eng:{new} 173:eng:{o-o castle king side easy turn %s\n} 174:eng:{o-o-o castle queen side hash turn %s\n} 175:eng:{opponent mates!\n} 176:eng:{opponent will soon mate!\n} 177:eng:{post principle variation hint suggest a move\n} 178:eng:{post} 179:eng:{p} 180:eng:{quit} 181:eng:{random randomize play new start new game\n} 182:eng:{random} 183:eng:{rcptr} 184:eng:{remove} 185:eng:{reverse} 186:eng:{rv} 187:eng:{r} 188:eng:{save game to file get game from file\n} 189:eng:{save} 190:eng:{setup} 191:eng:{set} 192:eng:{shade toggle shade black stars toggle stars\n} 193:eng:{stars} 194:eng:{switch sides with computer both computer match\n} 195:eng:{switch} 196:eng:{test} 197:eng:{time} 198:eng:{try } 199:eng:{ttable collision detected} 200:eng:{undo undo last ply remove take back a move\n} 201:eng:{undo} 202:eng:{white computer plays white black computer plays black\n} 203:eng:{white} 204:eng:{w} 205:eng:{xboard.position.read} 206:eng:{xboard} 207:eng:{xget} 208:eng:{xwndw= } 209:eng:{xwndw} 210:eng:{yes} 211:eng:{Illegal move in book %d %s %s} 212:eng:{Warning can't find book.} 213:eng:{Book used %d of %d entries.} 214:eng:{true} 215:eng:{false} 216:eng:{exit} 217:eng:{clock} 218:eng:{Computer} 219:eng:{Open failure for file: %s} 220:eng:{Time Control Error} 221:eng:{material} 222:eng:{time %d %d} 223:eng:{I have no idea} 224:eng:{Not Enough Material} SHAR_EOF fi # end of overwriting check # End of shell archive exit 0 gnuchess-4.0.pl70/misc/gnuchess.lang100644 21542 13 50424 5542006054 16435 0ustar cracraftuser001:eng:{ pnbrqk} 001:ger:{ bsltdk} 001:swe:{ bsltdk} 002:eng:{ PNBRQK} 002:ger:{ BSLTDK} 002:swe:{ BSLTDK} 003:eng:{abcdefgh} 003:ger:{abcdefgh} 003:swe:{abcdefgh} 004:eng:{12345678} 004:ger:{12345678} 004:swe:{12345678} 005:eng:{o-o} 005:ger:{o-o} 005:swe:{o-o} 006:eng:{o-o-o} 006:ger:{o-o-o} 006:swe:{o-o-o} 007:eng:{0-0} 007:ger:{0-0} 007:swe:{0-0} 008:eng:{0-0-0} 008:ger:{0-0-0} 008:swe:{0-0-0} 009:eng:{wWbB} 009:ger:{wWsS} 009:swe:{vVsS} 010:eng:{ score depth nodes time } 010:ger:{ Bewert Tiefe Posit Zeit } 010:swe:{ eval djup noder tid } 011:eng:{ score depth nodes time\n} 011:ger:{ Bewert Tiefe Posit Zeit\n} 011:swe:{ eval djup noder tid\n} 012:eng:{ } 012:ger:{ } 012:swe:{ } 013:eng:{ } 013:ger:{ } 013:swe:{ } 014:eng:{ %s\n} 014:ger:{ %s\n} 014:swe:{ %s\n} 015:eng:{ a b c d e f g h} 015:ger:{ a b c d e f g h} 015:swe:{ a b c d e f g h} 016:eng:{ h g f e d c b a} 016:ger:{ h g f e d c b a} 016:swe:{ h g f e d c b a} 017:eng:{ -} 017:ger:{ -} 017:swe:{ -} 018:eng:{cache} 018:ger:{cache} 018:swe:{ } 019:eng:{nopost} 019:ger:{nohaupt} 019:swe:{novariant} 020:eng:{ } 020:ger:{ } 020:swe:{ } 021:eng:{ } 021:ger:{ } 021:swe:{ } 022:eng:{ } 022:ger:{ } 022:swe:{ } 023:eng:{ } 023:ger:{ } 023:swe:{ } 024:eng:{ } 024:ger:{ } 024:swe:{ } 025:eng:{ } 025:ger:{ } 025:swe:{ } 026:eng:{ } 026:ger:{ } 026:swe:{ } 027:eng:{ } 027:ger:{ } 027:swe:{ } 028:eng:{# Clear board\n} 028:ger:{# Loesche Brett\n} 028:swe:{# Rensa braedet\n} 029:eng:{. Exit to main\n} 029:ger:{. Zurueck ins Spiel\n} 029:swe:{. Tillbaka till spelet\n} 030:eng:{/usr/games/lib/gnuchess.book} 030:ger:{/usr/games/lib/gnuchess.book} 030:swe:{/usr/games/lib/gnuchess.book} 031:eng:{Abort? } 031:ger:{Abbruch? } 031:swe:{Avbryta? } 032:eng:{Ambiguous Move!} 032:ger:{Zug nicht eindeutig!} 032:swe:{Tvetydigt drag!} 033:eng:{Awindow} 033:ger:{Awindow} 033:swe:{Awindow} 034:eng:{BAwindow= } 034:ger:{BAwindow= } 034:swe:{BAwindow= } 035:eng:{BBwindow= } 035:ger:{BBwindow= } 035:swe:{BBwindow= } 036:eng:{Beep: %-12s Transposition file: %s\n} 036:ger:{Beep: %-12s Transposition file: %s\n} 036:swe:{Beep: %-12s Transposition file: %s\n} 037:eng:{Black %s White %s %d eps %d\n} 037:ger:{Schwarz %s Weiss %s %d eps %d\n} 037:swe:{Svart %s Vit %s %d\n} 038:eng:{Bwindow: } 038:ger:{Bwindow: } 038:swe:{Bwindow: } 039:eng:{Bwindow} 039:ger:{Bwindow} 039:swe:{Bwindow} 040:eng:{CHESS command summary\n} 040:ger:{CHESS Befehlsuebersicht\n} 040:swe:{CHESS kommandon\n} 041:eng:{CHESS} 041:ger:{CHESS} 041:swe:{CHESS} 042:eng:{Castled White %s Black %s\n} 042:ger:{Rochade Weiss %s Schwarz %s\n} 042:swe:{Vit Rockad %s Svart %s\n} 043:eng:{Chess\n} 043:ger:{Schach\n} 043:swe:{Schack\n} 044:eng:{Computer mates!} 044:ger:{Computer setzt matt!} 044:swe:{Datorn mattar!} 045:eng:{Computer will soon mate!} 045:ger:{Computer setzt bald matt!} 045:swe:{Datorn mattar snart!} 046:eng:{Computer: %-12s Opponent: %s\n} 046:ger:{Computer: %-12s Gegner: %s\n} 046:swe:{Datorn: %-12s Motstaandare: %s\n} 047:eng:{Computer: %s} 047:ger:{Computer: %s} 047:swe:{Datorn: %s} 048:eng:{Could not open file} 048:ger:{Konnte File nicht oeffnen} 048:swe:{Kunde inte oeppna filen} 049:eng:{Counting transposition file entries, wait!\n} 049:ger:{Zaehle transposition File Eintraege, warten!\n} 049:swe:{Raeknar posterna i transpositionsfilen, vaenta!\n} 050:eng:{Create failed for %s\n} 050:ger:{Erzeugung misslang wegen %s\n} 050:swe:{Skapa misslickades foer %s\n} 051:eng:{Depth: %-12d Response time: %d sec\n} 051:ger:{Tiefe: %-12d Antwortzeit: %d Sek\n} 051:swe:{Djup: %-12d Svarstid: %d sek\n} 052:eng:{Depth: %d} 052:ger:{Tiefe: %d} 052:swe:{Djup: %d} 053:eng:{Depth= %d%c } 053:ger:{Tiefe= %d%c } 053:swe:{Djup= %d%c } 054:eng:{Draw %s\n} 054:ger:{Zug %s\n} 054:swe:{Drag %s\n} 055:eng:{DrawPiece: color[sq] err} 055:ger:{DrawPiece: color[sq] err} 055:swe:{DrawPiece: color[sq] err} 056:eng:{Drawn game! %s} 056:ger:{Spiel unentschieden! %s} 056:swe:{Remi! %s} 057:eng:{Drawn game!\n} 057:ger:{Spiel unentschieden!\n} 057:swe:{Remi!\n} 058:eng:{Drawn game!} 058:ger:{Spiel unentschieden!} 058:swe:{Remi!} 059:eng:{Easy mode: %s} 059:ger:{Leichter Mode: %s} 059:swe:{Laett: %s} 060:eng:{Editing: %s} 060:ger:{Editieren: %s} 060:swe:{Editering: %s} 061:eng:{Enter [moves] minutes[:sec] [increment][+]: } 061:ger:{Eingabe [Zuege] Minuten[:Sek] [Inkrement][+]: } 061:swe:{Ange #drag #minuter: } 062:eng:{Enter Level: } 062:ger:{Eingabe Level: } 062:swe:{Ange Nivaa: } 063:eng:{Enter file name: } 063:ger:{Eingabe Filename: } 063:swe:{Ange Filnamn: } 064:eng:{Enter piece & location: } 064:ger:{Eingabe Figur & Ort: } 064:swe:{Ange pjaes & ruta: } 065:eng:{Enter piece: } 065:ger:{Eingabe Figur: } 065:swe:{Ange pjaes: } 066:eng:{Filling transposition file, wait!\n} 066:ger:{Erzeuge Transposition File, warten!\n} 066:swe:{Fyller transpositionsfilen, vaenta!\n} 067:eng:{GNU Chess display (MS-DOS, Mar 90)} 067:ger:{GNU Schach display (MS-DOS, Mar 90)} 067:swe:{GNU Schack display (MS-DOS, Mar 90)} 068:eng:{GNU Chess display (Nov 89)} 068:ger:{GNU Schach display (Nov 89)} 068:swe:{GNU Schack display (Nov 89)} 069:eng:{GNU Chess} 069:ger:{GNU Schach} 069:swe:{GNU Schack} 070:eng:{Game saved} 070:ger:{Spiel abgespeichert} 070:swe:{Partiet sparat} 071:eng:{Hin/Hout/Tcol/Coll/Fin/Fout = %ld/%ld/%ld/%ld/%ld/%ld\n} 071:ger:{Hin/Hout/Tcol/Coll/Fin/Fout = %ld/%ld/%ld/%ld/%ld/%ld\n} 071:swe:{Hin/Hout/Tcol/Coll/Fin/Fout = %ld/%ld/%ld/%ld/%ld/%ld\n} 072:eng:{Hint: %s\n} 072:ger:{Hinweis: %s\n} 072:swe:{Foerslag: %s\n} 073:eng:{Hit to return: } 073:ger:{Druecke fuer weiter: } 073:swe:{Tillbaks med : } 074:eng:{Human} 074:ger:{Mensch } 074:swe:{Maenniska } 075:eng:{Illegal move (no matching move)%s\n} 075:ger:{ungueltiger Zug (kein passender Zug)%s\n} 075:swe:{Felaktigt drag (inget matchande drag)%s\n} 076:eng:{Illegal move (no matching move)} 076:ger:{ungueltiger Zug (kein passender Zug)} 076:swe:{Felaktigt drag (inget matchande drag)} 077:eng:{Illegal move..(in check)} 077:ger:{ungueltiger Zug..(wird geprueft)} 077:swe:{Otillaatet drag..(i schack)} 078:eng:{Illegal move\n} 078:ger:{ungueltiger Zug\n} 078:swe:{Otillaatet drag\n} 079:eng:{Level: %ld} 079:ger:{Level: %ld} 079:swe:{Level: %ld} 080:eng:{Max Moves} 080:ger:{Max Zuege} 080:swe:{Max Drag} 081:eng:{Max Tree= %5d} 081:ger:{Max Verzw= %5d} 081:swe:{Max Traed= %5d} 082:eng:{MoveLimit= } 082:ger:{Zug Limit= } 082:swe:{Draggraens= } 083:eng:{My move is: %s\n} 083:ger:{Mein Zug ist: %s\n} 083:swe:{Mitt drag aer: %s\n} 084:eng:{My move is: %s} 084:ger:{Mein Zug ist: %s} 084:swe:{Mitt drag aer: %s} 085:eng:{Testing Eval Speed} 085:ger:{Teste Auswert.geschw.} 085:swe:{Testar Evalueringen} 086:eng:{Nf3 move knight to f3 cache turn %s\n} 086:ger:{Lf3 ziehe Laeufer nach f3 cache schalte %s\n} 086:swe:{Lf3 dra loeparen till f3 pip tur %s\n} 087:eng:{No moves} 087:ger:{keine Zuege} 087:swe:{Inga drag} 088:eng:{No pieces} 088:ger:{keine Figur} 088:swe:{Inga pjaeser} 089:eng:{Gen %ld Node %ld Tree %d Eval %ld Rate %ld EC %d/%d RS hi %ld lo %ld \n} 089:ger:{Zug %ld Posit %ld Verz %d Eval %ld Rate %ld EC %d/%d RS hi %ld lo %ld \n} 089:swe:{Drag %ld Nod %ld Traed %d Eval %ld Rate %ld EC %d/%d RS hi %ld lo %ld \n} 090:eng:{Nodes= %8ld, Nodes/Sec= %5ld} 090:ger:{Posit= %8ld, Posit/Sek= %5ld} 090:swe:{Noder= %8ld, Noder/Sek= %5ld} 091:eng:{Nodes= %ld Nodes/sec= %ld\n} 091:ger:{Posit= %ld Posit/Sek= %ld\n} 091:swe:{Noder= %ld Noder/Sek= %ld\n} 092:eng:{OFF} 092:ger:{AUS} 092:swe:{AV} 093:eng:{ON} 093:ger:{EIN} 093:swe:{PAA} 094:eng:{Operator time(hundredths)= } 094:ger:{Operator Zeit(hunderdstel)= } 094:swe:{Operatoertid(hundradelar)= } 095:eng:{Opponent mates!} 095:ger:{Gegner setzt matt!} 095:swe:{Motstaandaren mattar!} 096:eng:{Opponent will soon mate!} 096:ger:{Gegner setzt bald matt!} 096:swe:{Motstaandaren mattar snart!} 097:eng:{Opponent: %s} 097:ger:{Gegner: %s} 097:swe:{Motstaandare: %s} 098:eng:{Playing without hashfile} 098:ger:{Spiel ohne Hashfile} 098:swe:{Spelar utan hashfil} 099:eng:{Random: %-12s Easy mode: %s\n} 099:ger:{Random: %-12s Leichter Mode: %s\n} 099:swe:{Random: %-12s Laett Mode: %s\n} 100:eng:{Random: %s} 100:ger:{Random: %s} 100:swe:{Random: %s} 101:eng:{Repetition} 101:ger:{Wiederholung} 101:swe:{Upprepning} 102:eng:{Gnuchess version %s patchlevel %s\n} 102:ger:{Gnuchess Version %s Revision %s\n} 102:swe:{Gnuchess version %s revision %s\n} 103:eng:{S%d m%d ps%d m%d ps%d} 103:ger:{S%d m%d ps%d m%d ps%d} 103:swe:{S%d m%d ps%d m%d ps%d} 104:eng:{Score= %d} 104:ger:{Bewertung= %d} 104:swe:{Vaerdering= %d} 105:eng:{Score} 105:ger:{Bewertung} 105:swe:{Vaerdering} 106:eng:{Setup successful\n} 106:ger:{Aufstellung erfolgreich\n} 106:swe:{Upstaellning lyckad\n} 107:eng:{Testing CaptureList Speed} 107:ger:{Test Schlagliste Geschw} 107:swe:{Testar Slaglistans Hastighet} 108:eng:{Testing MoveList Speed} 108:ger:{Test Zugliste Geschw} 108:swe:{Testar Draglistans Hastighet} 109:eng:{The file contains %d entries out of max %d\n} 109:ger:{Das File enthaelt %d Eintraege von max. %d\n} 109:swe:{Filen innehaaller %d poster av max. %d\n} 110:eng:{Time Control %s %d moves in %d sec inc %d depth %d\n} 110:ger:{Zeitkontrolle %s %d Zuege in %d Sek Inc %d Tiefe %d\n} 110:swe:{Tidskontroll %s %d drag %d sek %d ink %d djup\n} 111:eng:{TimeControl %d Operator Time %d\n} 111:ger:{Zeitkontrolle %d Operator Zeit %d\n} 111:swe:{Tidskontroll %d Operatoerstid %d\n} 112:eng:{Transposition table: %s} 112:ger:{Transposition Tabelle: %s} 112:swe:{Transpositionstabell: %s} 113:eng:{Usage: Gnuchess [-a] [-t] [-c size] [-s savefile][-l listfile] [-x xwndw]\n} 113:ger:{Aufruf: Gnuchess [-a] [-t] [-c size] [-s savefile][-l listfile] [-x xwndw]\n} 113:swe:{Anvaend: Gnuchess\n [-L ]\n [<+,->a] Laett\n [-b ]\n [-B ]\n [<+,->h] Hashtabell\n [-s ]\n [-l ]\n [-S ]\n [-P ]\n [-r ]\n [-T ]\n [-t] testa hashfilen\n [-c skapa hashfilen x=1..23 betyder 2**x]\n [-x ] paaverkar evalueringen\n [-v] vilken version\n} 114:eng:{WAwindow= } 114:ger:{WAwindow= } 114:swe:{WAwindow= } 115:eng:{WBwindow= } 115:ger:{WBwindow= } 115:swe:{WBwindow= } 116:eng:{White %d:%02d Black %d:%02d\n} 116:ger:{Weiss %d:%02d Schwarz %d:%02d\n} 116:swe:{Vit %d:%02d Svart %d:%02d\n} 117:eng:{White Clock %ld Moves %ld\nBlack Clock %d Moves %d\n\n} 117:ger:{Weiss Uhr %ld Zuege %ld\nSchwarz Uhr %d Zuege %d\n\n} 117:swe:{Vit klocka %ld Drag %ld\nSvart klocka %d drag %d\n\n} 118:eng:{White} 118:ger:{Weiss} 118:swe:{Vit} 119:eng:{Black} 119:ger:{Schwarz} 119:swe:{Svart} 120:eng:{Wwindow: } 120:ger:{Wwindow: } 120:swe:{Wwindow: } 121:eng:{Your move is? } 121:ger:{Ihr Zug ist? } 121:swe:{Ditt drag? } 122:eng:{\n } 122:ger:{\n } 122:swe:{\n } 123:eng:{\nMove# %d Target= %ld Clock: %ld\n} 123:ger:{\nZug# %d Zeilzeit= %ld Uhr: %ld\n} 123:swe:{\nDrag# %d Maal= %ld Klocka: %ld\n} 124:eng:{\nYour move is? } 124:ger:{\nIhr Zug ist? } 124:swe:{\nDitt drag? } 125:eng:{\n\n} 125:ger:{\n\n} 125:swe:{\n\n} 126:eng:{\nmove score depth nodes time flags capture color\n} 126:ger:{\nZug BewertTiefe Posit Zeit flags capture Farbe\n} 126:swe:{\ndrag eval djup noder tid flags capture faerg\n} 127:eng:{\n} 127:ger:{\n} 127:swe:{\n} 128:eng:{a7a8q promote pawn to queen material turn %s\n} 128:ger:{a7a8d wandle Bauer in Dame material schalte %s\n} 128:swe:{a7a8d pronoverar till dam material tur %s\n} 129:eng:{alg} 129:ger:{alg} 129:swe:{alg} 130:eng:{bd redraw board reverse board display\n} 130:ger:{br zeichne Brett neu drehe drehe Brett\n} 130:swe:{br ritar om braedet invertera braedesvisning\n} 131:eng:{bd} 131:ger:{br} 131:swe:{br} 132:eng:{beep} 132:ger:{ton } 132:swe:{pip } 133:eng:{black} 133:ger:{schwarz} 133:swe:{svart} 134:eng:{book} 134:ger:{bibl} 134:swe:{bok} 135:eng:{both} 135:ger:{beide} 135:swe:{baada} 136:eng:{c Change sides\n} 136:ger:{c Wechsle Spieler\n} 136:swe:{c byt sida\n} 137:eng:{chess.000} 137:ger:{chess.000} 137:swe:{chess.000} 138:eng:{chess.lst.%d} 138:ger:{chess.lst.%d} 138:swe:{chess.lst.%d} 139:eng:{computer mates!\n} 139:ger:{Computer setzt matt!\n} 139:swe:{datorn saetter matt!\n} 140:eng:{computer will soon mate!\n} 140:ger:{Computer setzt bald matt!\n} 140:swe:{datorn saetter snart matt!\n} 141:eng:{computer} 141:ger:{Computer} 141:swe:{datorn} 142:eng:{contempt= } 142:ger:{contempt= } 142:swe:{contempt= } 143:eng:{contempt} 143:ger:{contempt} 143:swe:{contempt} 144:eng:{coords show coords rv reverse video\n} 144:ger:{Koord bezeichne Felder rv Farbumkehr\n} 144:swe:{koord visa koordinater rv negativ bild\n} 145:eng:{coords} 145:ger:{Koord} 145:swe:{koord} 146:eng:{debuglevel= } 146:ger:{debuglevel= } 146:swe:{debuglevel= } 147:eng:{debuglevel} 147:ger:{debuglevel} 147:swe:{debuglevel} 148:eng:{debug} 148:ger:{debug} 148:swe:{debug} 149:eng:{depth set search depth clock set time control\n} 149:ger:{tiefe setze Suchtiefe zeit setze Zeitkontrolle\n} 149:swe:{djup saett soekdjup tid saett tidskontroll\n} 150:eng:{depth= } 150:ger:{Tiefe= } 150:swe:{djup= } 151:eng:{depth} 151:ger:{tiefe} 151:swe:{djup} 152:eng:{easy} 152:ger:{leicht} 152:swe:{laett} 153:eng:{edit edit board force enter game moves\n} 153:ger:{edit editiere Brett selbst spiele .. beide Seiten\n} 153:swe:{edit editera braedet sjaelv spela baada sidorna\n} 154:eng:{edit} 154:ger:{edit} 154:swe:{edit} 155:eng:{enter piece & location: \n} 155:ger:{Eingabe Figur & Position: \n} 155:swe:{Ange pjaes & ruta: \n} 156:eng:{first} 156:ger:{first} 156:swe:{first} 157:eng:{force} 157:ger:{selbst} 157:swe:{sjaelv} 158:eng:{g1f3 move from g1 to f3 quit Exit Chess\n} 158:ger:{g1f3 ziehe von g1 nach f3 ende Verlasse Spiel\n} 158:swe:{g1f3 flytta g1 till f3 sluta Avsluta Chess\n} 159:eng:{game file= } 159:ger:{Spielfile= } 159:swe:{sparfil= } 160:eng:{get} 160:ger:{hole} 160:swe:{haemta} 161:eng:{gnuchess 4p%s game\n} 161:ger:{gnuchess 4p%s Spiel\n} 161:swe:{gnuchess 4p%s parti\n} 162:eng:{go} 162:ger:{ziehe} 162:swe:{dra} 163:eng:{hashdepth= } 163:ger:{Hashtiefe= } 163:swe:{hashdjup= } 164:eng:{hashdepth} 164:ger:{Hashtiefe} 164:swe:{hashdjup} 165:eng:{hash} 165:ger:{hash} 165:swe:{hash} 166:eng:{help} 166:ger:{hilfe} 166:swe:{hjaelp} 167:eng:{hint suggest a move post turn %s principle variation\n} 167:ger:{hinw schlage Zug vor haupt schalte Hauptvariante %s\n} 167:swe:{tips tipsa om drag variant visa huvudvariant %s\n} 168:eng:{hint} 168:ger:{hinw} 168:swe:{tips} 169:eng:{level} 169:ger:{Level} 169:swe:{level} 170:eng:{list game to chess.lst book turn %s used %d of %d\n} 170:ger:{doku mentiere in chess.lst bibl schalte %s benutzte %d von %d\n} 170:swe:{lista parti till chess.lst bok slaar %s anvaende %d av %d\n} 171:eng:{list} 171:ger:{doku} 171:swe:{lista} 172:eng:{new} 172:ger:{neu} 172:swe:{ny} 173:eng:{o-o castle king side easy turn %s\n} 173:ger:{o-o kurze Rochade leicht schalte %s\n} 173:swe:{o-o kort rockad laett saett %s\n} 174:eng:{o-o-o castle queen side hash turn %s\n} 174:ger:{o-o-o lange Rochade hash schalte %s\n} 174:swe:{o-o-o laang rockad hash slaar %s\n} 175:eng:{opponent mates!\n} 175:ger:{Gegner schlaegt Matt!\n} 175:swe:{Motstaandaren saetter matt!\n} 176:eng:{opponent will soon mate!\n} 176:ger:{Gegner schlaegt bald Matt!\n} 176:swe:{Motstaandaren mattar strax!\n} 177:eng:{post principle variation hint suggest a move\n} 177:ger:{haupt Hauptvariante hinw schlage Zug vor\n} 177:swe:{variant huvudvarianten hinw tipsa om ett drag\n} 178:eng:{post} 178:ger:{haupt} 178:swe:{variant} 179:eng:{p} 179:ger:{p} 179:swe:{p} 180:eng:{quit} 180:ger:{ende} 180:swe:{sluta} 181:eng:{random randomize play new start new game\n} 181:ger:{zufall variableres Spiel neu Starte neues Spiel\n} 181:swe:{slump varierar spelet ny startar nytt spel\n} 182:eng:{random} 182:ger:{zufall} 182:swe:{slump} 183:eng:{rcptr} 183:ger:{rcptr} 183:swe:{rcptr} 184:eng:{remove} 184:ger:{zur} 184:swe:{bort} 185:eng:{reverse} 185:ger:{drehe} 185:swe:{invertera} 186:eng:{rv} 186:ger:{rv} 186:swe:{rv} 187:eng:{r} 187:ger:{r} 187:swe:{r} 188:eng:{save game to file get game from file\n} 188:ger:{speich Spiel in File hole Spiel aus File\n} 188:swe:{spara parti i fil haemta parti fraan fil\n} 189:eng:{save} 189:ger:{speich} 189:swe:{spara} 190:eng:{setup} 190:ger:{setup} 190:swe:{setup} 191:eng:{set} 191:ger:{set} 191:swe:{set} 192:eng:{shade toggle shade black stars toggle stars\n} 192:ger:{Schatt aender Farbton schwarz stern Stern bei Schwarz\n} 192:swe:{skugga skuggning av svart asterisk Asterisker foer svart\n} 193:eng:{stars} 193:ger:{stern} 193:swe:{stern} 194:eng:{switch sides with computer both computer match\n} 194:ger:{wechs ele Seite mit computer beide Computer spielt ..\n} 194:swe:{byt sida med datorn baada datorn spelar sjaelv\n} 195:eng:{switch} 195:ger:{wechs} 195:swe:{byt} 196:eng:{test} 196:ger:{Test} 196:swe:{test} 197:eng:{time} 197:ger:{zeit} 197:swe:{tid} 198:eng:{try } 198:ger:{Versuch } 198:swe:{proeva } 199:eng:{ttable collision detected} 199:ger:{ttable collision detected} 199:swe:{ttable collision detected} 200:eng:{undo undo last ply remove take back a move\n} 200:ger:{hzur Halbzug zurueck zur nehme einen Zug zurueck\n} 200:swe:{aengra ta tillbaka halvdrag tillbaka ta tillbaka ett drag\n} 201:eng:{undo} 201:ger:{hzur} 201:swe:{hzur} 202:eng:{white computer plays white black computer plays black\n} 202:ger:{weiss Computer nimmt Weiss schwarz Computer nimmt Schwarz\n} 202:swe:{vit datorn spelar vit svart datorn spelar svart\n} 203:eng:{white} 203:ger:{weiss} 203:swe:{vit} 204:eng:{w} 204:ger:{w} 204:swe:{w} 205:eng:{xboard.position.read} 205:ger:{xboard.position.read} 205:swe:{xboard.position.read} 206:eng:{xboard} 206:ger:{xboard} 206:swe:{xboard} 207:eng:{xget} 207:ger:{xget} 207:swe:{xget} 208:eng:{xwndw= } 208:ger:{xwndw= } 208:swe:{xwndw= } 209:eng:{xwndw} 209:ger:{xwndw} 209:swe:{xwndw} 210:eng:{yes} 210:ger:{ja} 210:swe:{ja} 211:eng:{Illegal move in book %d %s %s} 211:ger:{Unerlaubter Zug in Bibl. %d %s %s} 211:swe:{Otillaatet drag i bok %d %s %s} 212:eng:{Warning can't find book.} 212:ger:{Warnung: kann Bibl. nicht finden.} 212:swe:{Varning, kan inte hitta boken.} 213:eng:{Book used %d of %d entries.} 213:ger:{Bibl. benutzte %d von %d Eintraegen.} 213:swe:{Boken anvaende %d av %d poster.} 214:eng:{true} 214:ger:{wahr} 214:swe:{sant} 215:eng:{false} 215:ger:{falsch} 215:swe:{falskt} 216:eng:{exit} 216:ger:{exit} 216:swe:{exit} 217:eng:{clock} 217:ger:{Uhr} 217:swe:{klocka} 218:eng:{Computer} 218:ger:{Computer} 218:swe:{Computer} 219:eng:{Open failure for file: %s} 219:ger:{Fehler beim Oeffnen des files: %s} 219:swe:{Fel vid filoeppning: %s} 220:eng:{Time Control Error} 220:ger:{Fehler Zeitkontrolle} 220:swe:{Tidskontrollsfel} 221:eng:{material} 221:ger:{material} 221:swe:{material} 222:eng:{time %d %d\n} 222:ger:{Zeit %d %d\n} 222:swe:{tid %d %d} 223:eng:{I have no idea\n} 223:ger:{Ich habe keine Ahnung\n} 223:swe:{Jag har inte en aning\n} 224:eng:{Not Enough Material} 224:ger:{Nicht genug Material} 224:swe:{Inte nog med material} 225:eng:{Illegal position} 225:ger:{Unerlaubter position} 225:swe:{otillaaten position} 226:eng:{beep} 226:ger:{beep} 226:swe:{beep} 227:eng:{gamein} 227:ger:{gamein} 227:swe:{gamein} 228:eng:{otim} 228:ger:{otim} 228:swe:{otim} 229:eng:{hard} 229:ger:{hart} 229:swe:{svaar} 230:eng:{Time Control %s Game in %d sec inc %d sec depth %d\n} 230:ger:{Zeitkontrolle %s Spiel in %d Sek Inc %d Sek Tiefe %d\n} 230:swe:{Time Control %s Game in %d sec inc %d sec depth %d\n} gnuchess-4.0.pl70/src/ 40755 21542 13 0 5567302444 13476 5ustar cracraftusergnuchess-4.0.pl70/src/README100644 21542 13 224 5522241272 14421 0ustar cracraftuser If you get an error message about FIONREAD it means that your cpp is not working right. If you are using gcc you must use -traditional-cpp option. gnuchess-4.0.pl70/src/Makefile100644 21542 13 37320 5563711625 15261 0ustar cracraftuser# # Makefile for GNU Chess # # Copyright (c) 1992 Free Software Foundation # # This file is part of GNU CHESS. # # GNU Chess is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # # GNU Chess is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with GNU Chess; see the file COPYING. If not, write to # the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. # # # gnuchess is a curses-based chess. # gnuchessn is a fancy-display-curses-based chess. # gnuchessr is a plain dumb-terminal chess (but with full variation output) # gnuchessc is suitable for chesstool use (mimics /usr/games/chess output) # gnuchessx is the xchess based chess. # # The version number of this GNU and Xboard release VERS= 4.0 # Relevant file areas. DIST= ../README ../README.lang ../doc ../misc ../src ../test # size of book to make # listed below are the book options and the size of the resulting book # # default is small # set BOOKTYPE to the book you want # #huge 1,450K #big 540K #med 240K #small 144K #tiny 78K BOOKTYPE=small # Distribution directory DISTDIR= ../.. # Programs being distributed PROGS=gnuchess-4.0/src gnuchess-4.0/misc gnuchess-4.0/doc LIBS = -lm #LIBS = -lm /usr/ucblib/libucb.a #Solaris 2.3 # Change these to something less transitory, like /usr/games, and then # compile. Ask your system admin / unix guru to put gnuchess.{hash,lang,book} # in $(LIBDIR). # Where the binaries live. #BINDIR= /usr/local/bin BINDIR= . # Where language description, our book, and the persistent hash live. #LIBDIR= /usr/local/lib LIBDIR= . # Display routines. LCURSES=-lcurses -ltermcap #compile options for gnuchess # -DBAREBONES compile for max speed no statistics etc kept # -DQUIETBACKGROUND don't print post information in background ( easy OFF) # -DNOMEMSET if your machine does not support memset # -DNOMATERIAL don't call it a draw when no pawns and both sides < rook # -DNODYNALPHA don't dynamically adjust alpha # -DHASHSTATS keep hash table statistics # -DMORESTATS print more hash table stats # -DHISTORY use history killer hueristic # -DKILLT use killt killer hueristic # -DHASGETTIMEOFDAY use gettimeofday for more accurate timing # -DOLDTIME use old ply time estimating function # -DCLIENT create client version for use with ICS # -DOLDXBOARD don't generate underpromote moves # -DGNU3 don't generate underpromote moves # -DLEGAL generate only legal moves instead of psuedo-legal # -DLONG64 if you have 64bit longs # -DSYSV if you are using SYSV # -DCACHE Cache static evaluations # -DE4OPENING always open e4 if white and respond to e4 with e5 if black # -DQUIETBOOKGEN Don't print errors while loading a book or generating a binbook # -DSEMIQUIETBOOKGEN Print less verbose errors while reading book or generating binbook # -DGDX use random file based book # -DNULLMOVE include null move heuristic # -DDEEPNULL include deepnull move heuristic # -DNODITHER no random element to evalustions # some debug options # -DDEBUG8 dump board,movelist,input move to /tmp/DEBUG if illegal move # -DDEBUG9 dump move list from test command # -DDEBUG10 dump board and move after search before !easy begins # -DDEBUG11 dump board when the move is output # -DDEBUG12 dump boards between moves # -DDEBUG13 dump search control information for each move to /tmp/DEBUG # -DDEBUG33 dump book moves as read from book # -DDEBUG40 include extra values of variables for debugging in game list # -DDEBUG41 dump post output to /tmp/DEBUG # the rest of the debug options are tied to the debuglevel command # -DDEBUG sets up code for debuglevel command # debuglevel # 1 always force evaluation in evaluate # 4 print move list after search # 8 print move list after book before search # 16 print move list after each ply of search # 32 print adds to transposition table # 64 print returns from transposition table lookups # 128 print evals # 256 print search tree as it is generated # 512 debug trace of search tree # 1024 interactive tree print # debug? p# where # is no. of plys to print # from top of tree (default all plys) # XXXX moves specifying branch of tree to print # (default all branches) # return terminates input # 2048 non-interactive trace print # gnufour ICS client # #OPT= -DUSEINT -DCACHE -DCLIENT -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DBAREBONES -DWAY4PL64 -DHISTORY -DAGING -DKILLT # normal OPT= -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT # The hashfile is a record of positions seen. It is used by # GNU Chess to avoid making the same mistakes, a form of learning. HASH= -DHASHFILE=\"$(LIBDIR)/gnuchess.hash\" # The "book" is a record of the first few moves, for playing good # moves easily and quickly, saving time, and irritating the human # opponent. BINBOOK = -DBINBOOK=\"$(LIBDIR)/gnuchess.data\" # The language file describes capabilities of the program. Perhaps # it is useful for non-English speaking countries and customizing # for their convenience and chess happiness. LANGF= -DLANGFILE=\"$(LIBDIR)/gnuchess.lang\" # The compiler used for compiling this software. # Use this for a plain C compiler #CC= cc $(OPT) # Use this for DEC's ANSI C compiler on Ultrix #CC= c89 $(OPT) # Use this if you are lucky enough to have GNU CC. CC= gcc -Wall $(OPT) #CC= cc $(OPT) # HPUX #CC= /contrib/system/bin/gcc -W $(OPT) # Miscellaneous CFLAGS. Uncomment the one you need and comment # the other. #CFLAGS= -O -g -Dinline="" -traditional-cpp #CFLAGS= -O4 -Qpath . # SunOS cc using unprotoize #CFLAGS= -O4 # Sun acc #CFLAGS= -O2 # DEC ANSI C (c89) on Ultrix. #CFLAGS= +O3 -Aa -D_HPUX_SOURCE -DSYSV # HPUX cc #CFLAGS= -O -finline-functions -fstrength-reduce -D__mips -D__LANGUAGE_C # gnu cc 1.40 on DS5000 #CFLAGS= -O -finline-functions -fstrength-reduce # gnu cc 1.40 on others #CFLAGS= -O2 -funroll-loops -D__mips -D__LANGUAGE_C # gnu cc 2.00 on DS5000 #CFLAGS= -O2 -D__alpha -D__LANGUAGE_C # gnu cc 2.00 on Flamingo #CFLAGS= -O2 -funroll-loops -traditional-cpp # gnu cc 2.00 on SunOS CFLAGS= -O2 -funroll-loops # gnu cc 2.00 on others #CFLAGS= -O2 -acpp -signed -Wp,-traditional # IRIX 5.1.*? #CFLAGS= -g -cckr -DNOMACROS -Dhuge="" #Correct flags for gnuchess 4.0 with IRIX cc. all : gnuchess gnuchessr gnuchessn gnuchessx gnuchessc postprint gnuan game gnuchess: mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomN.o uxdsp.o $(CC) $(CFLAGS) $(HASH) $(LANGF) -o gnuchess mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomN.o uxdsp.o $(LCURSES) $(LIBS) gnuan: mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o gnuan.o $(CC) $(CFLAGS) $(HASH) $(LANGF) -o gnuan mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o gnuan.o $(LIBS) gnuchessc: mainC.o bookC.o genmovesC.o ataks.o utilC.o evalC.o init.o searchC.o dspcomC.o nondspC.o $(CC) $(CFLAGS) $(HASH) $(LANGF) -o gnuchessc mainC.o bookC.o genmovesC.o ataks.o utilC.o evalC.o init.o searchC.o dspcomC.o nondspC.o $(LIBS) Dgnuchessr: mainDR.o bookN.o genmovesN.o ataks.o utilDR.o evalDR.o init.o searchDR.o dspcomDR.o nondspDR.o $(CC) -DDEBUG -DDEBUG4 $(CFLAGS) $(HASH) $(LANGF) -o gnuchessr mainDR.o bookN.o genmovesN.o ataks.o utilDR.o evalDR.o init.o searchDR.o dspcomDR.o nondspDR.o $(LIBS) $(LIBS) gnuchessx: mainX.o bookX.o genmovesX.o ataks.o utilX.o evalX.o init.o searchX.o dspcomX.o nondspX.o $(CC) $(CFLAGS) $(HASH) $(LANGF) -o gnuchessx mainX.o bookX.o genmovesX.o ataks.o utilX.o evalX.o init.o searchX.o dspcomX.o nondspX.o $(LIBS) gnuchessr: mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomR.o nondspR.o $(CC) $(CFLAGS) $(HASH) $(LANGF) -o gnuchessr mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomR.o nondspR.o $(LIBS) gnuchessn: mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomN.o nuxdsp.o $(CC) $(CFLAGS) $(HASH) $(LANGF) -o gnuchessn mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomN.o nuxdsp.o $(LCURSES) $(LIBS) game: game.c gnuchess.h $(CC) $(CFLAGS) -o game game.c postprint: postprint.o $(CC) $(CFLAGS) $(HASH) -o postprint postprint.o gnuan.o: gnuan.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) $(BINBOOK) -c gnuan.c mainN.o: main.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) $(BINBOOK) -c main.c mv main.o mainN.o mainC.o: main.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) $(BINBOOK) -DNONDSP -DCHESSTOOL \ -c main.c mv main.o mainC.o mainX.o: main.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) $(BINBOOK) -DXBOARD -c main.c mv main.o mainX.o mainDR.o: main.c gnuchess.h version.h ttable.h $(CC) -DDEBUG -DDEBUG4 $(CFLAGS) $(HASH) $(LANGF) $(BINBOOK) \ -c main.c mv main.o mainDR.o genmovesN.o: genmoves.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c genmoves.c mv genmoves.o genmovesN.o genmovesC.o: genmoves.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP -DCHESSTOOL \ -c genmoves.c mv genmoves.o genmovesC.o genmovesX.o: genmoves.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DXBOARD \ -c genmoves.c mv genmoves.o genmovesX.o bookN.o: book.c gnuchess.h version.h ataks.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) $(BINBOOK) -c book.c mv book.o bookN.o bookC.o: book.c gnuchess.h version.h ataks.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP -DCHESSTOOL \ $(BINBOOK) \ -c book.c mv book.o bookC.o bookX.o: book.c gnuchess.h version.h ataks.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DXBOARD $(BINBOOK) \ -c book.c mv book.o bookX.o ataks.o: ataks.h ataks.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c ataks.c utilN.o: util.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c util.c mv util.o utilN.o utilX.o: util.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) \ -c util.c mv util.o utilX.o utilC.o: util.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) \ -c util.c mv util.o utilC.o evalC.o: eval.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c eval.c mv eval.o evalC.o evalX.o: eval.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c eval.c mv eval.o evalX.o evalN.o: eval.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c eval.c mv eval.o evalN.o evalDR.o: eval.c gnuchess.h version.h ttable.h $(CC) -DDEBUG4 -DDEBUG $(CFLAGS) $(HASH) $(LANGF) \ -c eval.c mv eval.o evalDR.o utilDR.o: util.c gnuchess.h version.h $(CC) -DDEBUG4 -DDEBUG $(CFLAGS) $(HASH) $(LANGF) \ -c util.c mv util.o utilDR.o init.o: init.c gnuchess.h version.h ttable.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c init.c searchN.o: search.c gnuchess.h version.h debug512.h debug10.h debug13.h debug16.h debug256.h debug4.h debug40.h debug41.h debug64.h debug8.h ttable.h ttable.c $(CC) $(CFLAGS) $(HASH) $(LANGF) -c search.c mv search.o searchN.o searchC.o: search.c gnuchess.h version.h debug512.h debug10.h debug13.h debug16.h debug256.h debug4.h debug40.h debug41.h debug64.h debug8.h ttable.h ttable.c $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP -DCHESSTOOL \ -c search.c mv search.o searchC.o searchX.o: search.c gnuchess.h version.h debug512.h debug10.h debug13.h debug16.h debug256.h debug4.h debug40.h debug41.h debug64.h debug8.h ttable.h ttable.c $(CC) $(CFLAGS) $(HASH) $(LANGF) -DXBOARD \ -c search.c mv search.o searchX.o searchDR.o: search.c gnuchess.h version.h debug512.h debug10.h debug13.h debug16.h debug256.h debug4.h debug40.h debug41.h debug64.h debug8.h ttable.h ttable.c $(CC) -DDEBUG4 -DDEBUG $(CFLAGS) $(HASH) $(LANGF) \ -c search.c mv search.o searchDR.o uxdsp.o: uxdsp.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c uxdsp.c nuxdsp.o: nuxdsp.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c nuxdsp.c nondspC.o: nondsp.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP -DCHESSTOOL \ -c nondsp.c mv nondsp.o nondspC.o nondspX.o: nondsp.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP -DXBOARD \ -c nondsp.c mv nondsp.o nondspX.o nondspR.o: nondsp.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP \ -c nondsp.c mv nondsp.o nondspR.o nondspDR.o: nondsp.c gnuchess.h version.h $(CC) -DDEBUG4 -DDEBUG $(CFLAGS) $(HASH) $(LANGF) -DNONDSP \ -c nondsp.c mv nondsp.o nondspDR.o dspcomN.o: dspcom.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -c dspcom.c mv dspcom.o dspcomN.o dspcomC.o: dspcom.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP -DCHESSTOOL \ -c dspcom.c mv dspcom.o dspcomC.o dspcomX.o: dspcom.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP -DXBOARD \ -c dspcom.c mv dspcom.o dspcomX.o dspcomR.o: dspcom.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) $(LANGF) -DNONDSP \ -c dspcom.c mv dspcom.o dspcomR.o dspcomDR.o: dspcom.c gnuchess.h version.h $(CC) -DDEBUG -DDEBUG4 $(CFLAGS) $(HASH) $(LANGF) -DNONDSP \ -c dspcom.c mv dspcom.o dspcomDR.o postprint.o: postprint.c gnuchess.h version.h $(CC) $(CFLAGS) $(HASH) -c postprint.c distribution: -patchlevel=`cat $(DISTDIR)/gnuchess-$(VERS)/src/version.h|grep patchlevel|sed -e 's/[^0-9]//g'` ;\ echo "GNU patchlevel is $$patchlevel" ;\ cd $(DISTDIR) ;\ rm -f gnuchess.tar.$(VERS).Z* gnuchess.tar.$(VERS).Z.uu* ;\ tar cf - $(PROGS) | compress > $(DISTDIR)/gnuchess-$(VERS).pl$$patchlevel.tar.Z ;\ uuencode gnuchess-$(VERS).pl$$patchlevel.tar.Z gnuchess-$(VERS).pl$$patchlevel.tar.Z > gnuchess-$(VERS).pl$$patchlevel.tar.Z.uu ;\ rm -f x?? ;\ split -2500 gnuchess-$(VERS).pl$$patchlevel.tar.Z.uu ;\ for i in x??; do \ mv $$i $(DISTDIR)/GNU_Chess_$$i; \ done huge: -rm ./gnuchess.data echo 3 0 >test;echo quit >>test gzip -d -c ../book/gnuchess.bk1.z > /tmp/t cat test| ./gnuchessr -b /tmp/t -B ./gnuchess.data -S 188000 -P 26 rm test /tmp/t big: -rm ./gnuchess.data echo 3 0 >test;echo quit >>test gzip -d -c ../book/gnuchess.bk1.z > /tmp/t cat test| ./gnuchessr -b /tmp/t -B ./gnuchess.data -S 45000 -P 16 rm test /tmp/t med: -rm ./gnuchess.data echo 3 0 >test;echo quit >>test gzip -d -c ../book/gnuchess.bk1.z > /tmp/t cat test| ./gnuchessr -b /tmp/t -B ./gnuchess.data -S 20000 -P 12 rm test /tmp/t small: -rm ./gnuchess.data echo 3 0 >test;echo quit >>test gzip -d -c ../book/gnuchess.bk1.z > /tmp/t cat test| ./gnuchessr -b /tmp/t -B ./gnuchess.data -S 12000 -P 10 rm test /tmp/t tiny: -rm ./gnuchess.data echo 3 0 >test;echo quit >>test gzip -d -c ../book/gnuchess.bk1.z > /tmp/t cat test| ./gnuchessr -b /tmp/t -B ./gnuchess.data -S 9000 -P 8 rm test /tmp/t install: install1 $(BOOKTYPE) -cp ./gnuchess.data $(LIBDIR)/gnuchess.data install1: -cp gnuchessx $(BINDIR)/gnuchessx -cp gnuchessc $(BINDIR)/gnuchessc -cp gnuchessr $(BINDIR)/gnuchessr -cp gnuchessn $(BINDIR)/gnuchessn -cp postprint $(BINDIR)/postprint -cp gnuan $(BINDIR)/gnuan -cp gnuchess $(BINDIR)/gnuchess -cp ../misc/gnuchess.lang $(LIBDIR)/gnuchess.lang test: gnuchessr cat ../test/testall|gnuchessr > test.out 2>&1 clean: -rm -f gnuchessx gnuchessc gnuchess gnuchessr gnuchessn gnuchessd postprint gnuan game -echo $(DISTDIR) -find $(DISTDIR) \( -name '*.o' -o -name '*~' -o -name 'CL*' -o -name 'PATCH*' -o -name '#*#' -o -name '%*%' -o -name '*orig' \) -exec rm -f {} \; gnuchess-4.0.pl70/src/ataks.c100444 21542 13 3442 5563700643 15042 0ustar cracraftuser/* * ataks.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" void ataks (SHORT side, SHORT *a) /* * Fill array atak[][] with info about ataks to a square. Bits 8-15 are set * if the piece (king..pawn) ataks the square. Bits 0-7 contain a count of * total ataks to the square. */ { register SHORT u, c, sq; register UCHAR *ppos, *pdir; SHORT i, piece, *PL; memset ((UCHAR *) a, 0, 64 * sizeof (a[0])); PL = PieceList[side]; for (i = PieceCnt[side]; i >= 0; i--) { sq = PL[i]; piece = board[sq]; c = control[piece]; if (sweep[piece]) { ppos = nextpos[piece][sq]; pdir = nextdir[piece][sq]; u = ppos[sq]; do { a[u] = ((a[u]+1) | c); u = ((color[u] == neutral) ? ppos[u] : pdir[u]); } while (u != sq); } else { pdir = nextdir[ptype[side][piece]][sq]; u = pdir[sq]; /* follow captures thread for pawns */ do { a[u] = ((a[u]+1) | c); u = pdir[u]; } while (u != sq); } } } gnuchess-4.0.pl70/src/ataks.h100444 21542 13 4442 5563700643 15050 0ustar cracraftuser/* * ataks.h - Header source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ inline static int SqAtakd (register short sq, short side) /* * See if any piece with color 'side' ataks sq. First check pawns then * Queen, Bishop, Rook and King and last Knight. */ { register short u; register UCHAR *ppos, *pdir; short xside; xside = side ^ 1; pdir = nextdir[ptype[xside][pawn]][sq]; u = pdir[sq]; /* follow captures thread */ if (u != sq) { if (board[u] == pawn && color[u] == side) return (true); u = pdir[u]; if (u != sq && board[u] == pawn && color[u] == side) return (true); } /* king capture */ if (distance (sq, PieceList[side][0]) == 1) return (true); /* try a queen bishop capture */ ppos = nextpos[bishop][sq]; pdir = nextdir[bishop][sq]; u = ppos[sq]; do { if (color[u] == neutral) u = ppos[u]; else { if (color[u] == side && (board[u] == queen || board[u] == bishop)) return (true); u = pdir[u]; } } while (u != sq); /* try a queen rook capture */ ppos = nextpos[rook][sq]; pdir = nextdir[rook][sq]; u = ppos[sq]; do { if (color[u] == neutral) u = ppos[u]; else { if (color[u] == side && (board[u] == queen || board[u] == rook)) return (true); u = pdir[u]; } } while (u != sq); /* try a knight capture */ pdir = nextdir[knight][sq]; u = pdir[sq]; do { if (color[u] == side && board[u] == knight) return (true); u = pdir[u]; } while (u != sq); return (false); } gnuchess-4.0.pl70/src/Makefile.ddj100644 21542 13 31453 5545562012 16014 0ustar cracraftuser# # Makefile for GNU Chess # (Use this makefile when compiling under DOS using DJGPP) # # Copyright (c) 1992 Free Software Foundation # # This file is part of GNU CHESS. # # GNU Chess is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # # GNU Chess is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with GNU Chess; see the file COPYING. If not, write to # the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. # # # gnuchess is a curses-based chess. # gnuchessn is a fancy-display-curses-based chess. # gnuchessr is a plain dumb-terminal chess (but with full variation output) # gnuchessc is suitable for chesstool use (mimics /usr/games/chess output) # gnuchessx is the xchess based chess. # # The version number of this GNU and Xboard release VERS= 4.0 XVERS = 2.0 # Relevant file areas. DIST= ../README ../README.lang ../doc ../misc ../src ../test # size of book to make # listed below are the book options and the size of the resulting book # # default is small # set BOOKTYPE to the book you want # #huge.book.data 1,450k #big.book.data 540k #med.book.data 240k #small.book.data 144K #tiny.book.data 78K BOOKTYPE=huge.book.data # Distribution directory DISTDIR= . # Programs being distributed PROGS=gnuchess-$(VERS) xboard-$(XVERS) #PROGS=gnuchess-$(VERS) # For -DGDBM option LIBS = -lm # Change these to something less transitory, like /usr/games, and then # compile. Ask your system admin / unix guru to put gnuchess.{hash,lang,book} # in $(LIBDIR). # Where the binaries live. #BINDIR= /tmp_mnt/home/fsf/cracraft/Ch #BINDIR= /udir/mann/bin/alpha #BINDIR= /usr/local/bin BINDIR= /games/gnu40_62 BINDIR1 = \games\gnu40_62 # Where language description, our book, and the persistent hash live. #LIBDIR= /usr/local/lib #LIBDIR= /udir/mann/lib/alpha LIBDIR= . # Display routines. LCURSES=-lcurses -ltermcap #compile options for gnuchess # -DQUIETBACKGROUND don't print post information in background ( easy OFF) # -DNOMEMSET if your machine does not support memset # -DNOMATERIAL don't call it a draw when no pawns and both sides < rook # -DNODYNALPHA don't dynamically adjust alpha # -DHISTORY use history killer hueristic # -DKILLT use killt killer hueristic # -DHASGETTIMEOFDAY use gettimeofday for more accurate timing # -DOLDTIME use old ply time estimating function # -DCLIENT create client version for use with ICS # -DOLDXBOARD don't generate underpromote moves # -DGNU3 don't generate underpromote moves # -DLONG64 if you have 64bit longs # -DSYSV if you are using SYSV # -DCACHE Cache static evaluations # -DE4OPENING always open e4 if white and respond to e4 with e5 if black # -DQUIETBOOKGEN Don't print errors while loading a book or generating a binbook # -DSEMIQUIETBOOKGEN Print less verbose errors while reading book or generating binbook # -DGDX use random file based book # -DNULLMOVE include null move heuristic # some debug options # -DDEBUG8 dump board,movelist,input move to /tmp/DEBUG if illegal move # -DDEBUG9 dump move list from test command # -DDEBUG10 dump board and move after search before !easy begins # -DDEBUG11 dump board when the move is output # -DDEBUG12 dump boards between moves # -DDEBUG13 dump search control information for each move to /tmp/DEBUG # -DDEBUG33 dump book moves as read from book # -DDEBUG40 include extra values of variables for debugging in game list # -DDEBUG41 dump post output to /tmp/DEBUG # the rest of the debug options are tied to the debuglevel command # -DDEBUG -DDEBUG4 set up code for debuglevel command # debuglevel # 1 always force evaluation in evaluate # 4 print move list after search # 8 print move list after book before search # 16 print move list after each ply of search # 32 print adds to transposition table # 64 print returns from transposition table lookups # 256 print search tree as it is generated # 512 debug trace # 1024 interactive tree print # debug? p# where # is no. of plys to print from top of tree (default all plys) # XXXX moves specifying branch of tree to print (default all branches) # return terminates input # 2048 non-interactive trace print # gnufour ICS client #OPT= -DCACHE -DCLIENT -DGDX -DGNU3 -DHASGETTIMEOFDAY -DHISTORY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN # normal OPT= -DCACHE -DGDX -DHASGETTIMEOFDAY -DHISTORY -DNULLMOVE -DOLDTIME -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN # The hashfile is a record of positions seen. It is used by # GNU Chess to avoid making the same mistakes, a form of learning. HASH= -DHASHFILE=\"$(LIBDIR)/gnuchess.hash\" # The "book" is a record of the first few moves, for playing good # moves easily and quickly, saving time, and irritating the human # opponent. #BOOK= -DBOOK=\"$(LIBDIR)/gnuchess.book\" BOOK= BINBOOK = -DBINBOOK=\"$(LIBDIR)/gnuchess.dat\" # The language file describes capabilities of the program. Perhaps # it is useful for non-English speaking countries and customizing # for their convenience and chess happiness. LANG= -DLANGFILE=\"$(LIBDIR)/gnuchess.lang\" # The compiler used for compiling this software. # Use this for a plain C compiler #CC= cc $(OPT) # Use this for DEC's ANSI C compiler on Ultrix #CC= c89 $(OPT) # Use this if you are lucky enough to have GNU CC. CC= gcc -Wall $(OPT) #CC= cc $(OPT) # HPUX #CC= /contrib/system/bin/gcc -W $(OPT) # Miscellaneous CFLAGS. Uncomment the one you need and comment # the other. #CFLAGS= -O2 -p -Dinline="" -traditional-cpp #CFLAGS= -O4 -Qpath . # SunOS cc using unprotoize #CFLAGS= -O4 # Sun acc #CFLAGS= -g -traditional-cpp # debug #CFLAGS= -O2 # DEC ANSI C (c89) on Ultrix. #CFLAGS= +O3 -Aa -D_HPUX_SOURCE -DSYSV # HPUX cc #CFLAGS= -O -finline-functions -fstrength-reduce -D__mips -D__LANGUAGE_C # gnu cc 1.40 on DS5000 #CFLAGS= -O -finline-functions -fstrength-reduce # gnu cc 1.40 on others #CFLAGS= -O2 -funroll-loops -D__mips -D__LANGUAGE_C # gnu cc 2.00 on DS5000 #CFLAGS= -O2 -D__alpha -D__LANGUAGE_C # gnu cc 2.00 on Flamingo #CFLAGS= -O2 -funroll-loops -traditional-cpp # gnu cc 2.00 on SunOS CFLAGS= -O2 -funroll-loops # gnu cc 2.00 on others all : gnuchess.exe gnuchesr.exe gnuchesn.exe postprint.exe gnuan.exe game.exe bincheckr.exe checkgame.exe checkbook.exe gnuchess.exe: mainN.o bookN.o genmoveN.o ataks.o util.o evalN.o init.o searchN.o dspcomN.o uxdsp.o >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -o gnuchess mainN.o bookN.o genmoveN.o ataks.o util.o evalN.o init.o searchN.o dspcomN.o uxdsp.o $(LIBS) $(CC) @tmp strip gnuchess aout2exe gnuchess del gnuchess gnuan.exe: mainN.o bookN.o genmoveN.o ataks.o util.o evalN.o init.o searchN.o gnuan.o >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -o gnuan mainN.o bookN.o genmoveN.o ataks.o util.o evalN.o init.o searchN.o gnuan.o $(LIBS) $(CC) @tmp # strip gnuan aout2exe gnuan del gnuan gnuchesr.exe: mainN.o bookN.o genmoveN.o ataks.o util.o evalN.o init.o searchN.o dspcomR.o nondspR.o >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -o gnuchesr mainN.o bookN.o genmoveN.o ataks.o util.o evalN.o init.o searchN.o dspcomR.o nondspR.o $(LIBS) $(CC) @tmp strip gnuchesr aout2exe gnuchesr del gnuchesr gnuchesn.exe: mainN.o bookN.o genmoveN.o ataks.o util.o evalN.o init.o searchN.o dspcomN.o nuxdsp.o >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -o gnuchesn mainN.o bookN.o genmoveN.o ataks.o util.o evalN.o init.o searchN.o dspcomN.o nuxdsp.o $(LIBS) $(CC) @tmp strip gnuchesn aout2exe gnuchesn del gnuchesn game.exe: game.c gnuchess.h >tmp $(CFLAGS) -o game game.c $(CC) @tmp strip game aout2exe game del game postprint.exe: postprint.o >tmp $(CFLAGS) $(HASH) -o postprint postprint.o $(CC) @tmp strip postprint aout2exe postprint del postprint bincheckr.exe: bincheckr.o >tmp $(CFLAGS) -o bincheckr bincheckr.o $(CC) @tmp strip bincheckr aout2exe bincheckr del bincheckr checkgame.exe: checkgame.o >tmp $(CFLAGS) -o checkgame checkgame.o $(CC) @tmp strip checkgame aout2exe checkgame del checkgame checkbook.exe: checkbook.o >tmp $(CFLAGS) -o checkbook checkbook.o $(CC) @tmp strip checkbook aout2exe checkbook del checkbook gnuan.o: gnuan.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) $(BINBOOK) -c gnuan.c $(CC) @tmp mainN.o: main.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) $(BINBOOK) -c main.c $(CC) @tmp del mainN.o rename main.o mainN.o genmoveN.o: genmove.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c genmove.c $(CC) @tmp del genmoveN.o rename genmove.o genmoveN.o bookN.o: book.c gnuchess.h version.h ataks.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) $(BINBOOK) -c book.c $(CC) @tmp del bookN.o rename book.o bookN.o ataks.o: ataks.h ataks.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c ataks.c $(CC) @tmp util.o: util.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c util.c $(CC) @tmp evalN.o: eval.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c eval.c $(CC) @tmp del evalN.o rename eval.o evalN.o init.o: init.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c init.c $(CC) @tmp searchN.o: search.c gnuchess.h version.h debug512.h debug10.h debug13.h debug16.h debug256.h debug4.h debug40.h debug41.h debug64.h debug8.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c search.c $(CC) @tmp del searchN.o rename search.o searchN.o uxdsp.o: uxdsp.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c uxdsp.c $(CC) @tmp nuxdsp.o: nuxdsp.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c nuxdsp.c $(CC) @tmp nondspR.o: nondsp.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -DNONDSP -c nondsp.c $(CC) @tmp del nondspR.o rename nondsp.o nondspR.o dspcomN.o: dspcom.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c dspcom.c $(CC) @tmp del dspcomN.o rename dspcom.o dspcomN.o dspcomR.o: dspcom.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) $(LANG) $(BOOK) -DNONDSP -c dspcom.c $(CC) @tmp del dspcomR.o rename dspcom.o dspcomR.o postprint.o: postprint.c gnuchess.h version.h >tmp $(CFLAGS) $(HASH) -c postprint.c $(CC) @tmp huge.book.data: del .\gnuchess.dat gnuchesr -b .\gnuchess.bk1 -B ./gnuchess.dat -S 320000 -P 24 del \t big.book.data: del .\gnuchess.dat gnuchesr -b .\gnuchess.bk1 -B ./gnuchess.dat -S 45000 -P 16 del \t med.book.data: del .\gnuchess.dat gnuchesr -b .\gnuchess.bk1 -B ./gnuchess.dat -S 20000 -P 12 del \t small.book.data: del .\gnuchess.dat gnuchesr -b .\gnuchess.bk1 -B ./gnuchess.dat -S 12000 -P 10 del \t tiny.book.data: del .\gnuchess.dat gnuchesr -b .\gnuchess.bk1 -B ./gnuchess.dat -S 9000 -P 8 del \t distribution: -patchlevel=`cat $(DISTDIR)/gnuchess-$(VERS)/src/version.h|grep patchlevel|sed -e 's/[^0-9]//g'` ;\ echo "GNU patchlevel is $$patchlevel" ;\ xpatchlevel=`cat $(DISTDIR)/xboard-$(XVERS)/patchlevel.h|sed -e "s/#define PATCHLEVEL //"` ;\ cd $(DISTDIR) ;\ rm -f gnuchess.tar.$(VERS).Z* gnuchess.tar.$(VERS).Z.uu* ;\ tar cf - $(PROGS) | compress > $(DISTDIR)/gnuchess-$(VERS).pl$$patchlevel.tar.Z ;\ uuencode gnuchess-$(VERS).pl$$patchlevel.tar.Z gnuchess-$(VERS).pl$$patchlevel.tar.Z > gnuchess-$(VERS).pl$$patchlevel.tar.Z.uu ;\ rm -f x?? ;\ split -2500 gnuchess-$(VERS).pl$$patchlevel.tar.Z.uu ;\ for i in x??; do \ mv $$i $(DISTDIR)/GNU_Chess_$$i; \ done install: $(BOOKTYPE) -copy gnuchesr.exe $(BINDIR1)\gnuchesr.exe -copy gnuchesn.exe $(BINDIR1)\gnuchesn.exe -copy postprin.exe $(BINDIR1)\postprin.exe -copy gnuan.exe $(BINDIR1)\gnuan.exe -copy gnuchess.exe $(BINDIR1)\gnuchess.exe -copy bincheck.exe $(BINDIR1)\bincheck.exe -copy checkgam.exe $(BINDIR1)\checkgam.exe -copy checkboo.exe $(BINDIR1)\checkboo.exe -copy game.exe $(BINDIR1)\game.exe clean: -del *.o -del *.exe gnuchess-4.0.pl70/src/book.c100444 21542 13 103337 5563700643 14735 0ustar cracraftuser/* * book.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback Copyright (c) 1992 Free Software * Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify it under * the terms of the GNU General Public License as published by the Free * Software Foundation; either version 2, or (at your option) any later * version. * * GNU Chess is distributed in the hope that it will be useful, but WITHOUT ANY * WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS * FOR A PARTICULAR PURPOSE. See the GNU General Public License for more * details. * * You should have received a copy of the GNU General Public License along with * GNU Chess; see the file COPYING. If not, write to the Free Software * Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" #include "ttable.h" /* uses hashbd, hashkey */ #include "ataks.h" #if !defined(AMIGADOS) && !defined(Think_C) #include #endif #ifdef Think_C #include #endif /*#define GENIT *//* generate book text output file in standard format */ #ifdef GENIT FILE *GEN; int GENline = 0; CHAR gs0[12],gs1[12],gs2[12],gs3[12],GENITs[12]; #endif #ifdef MSDOS #include #endif #if !defined MSDOS && !defined(Think_C) #define O_BINARY 0 #endif #include unsigned long booksize = BOOKSIZE; unsigned long int BKTBLSIZE; unsigned long BOOKMASK; unsigned long bookcount = 0; unsigned bookpocket = BOOKPOCKET; static struct bookentry { unsigned long bookkey; unsigned long bookbd; utshort bmove; utshort hint; utshort count; utshort flags; } *OBEND; struct bookentry *OpenBook = NULL; static struct bookentry **BookTable; UTSHORT bookmaxply = BOOKMAXPLY; CHAR *bookfile = NULL; CHAR *binbookfile = BINBOOK; int GotBook = false; static CHAR bmvstr[5][6]; unsigned long bhashbd, bhashkey; void Balgbr (SHORT f, SHORT t, SHORT flag) /* * Generate move strings in different formats. */ { int m3p; bmvstr[0][0] = bmvstr[1][0] = bmvstr[2][0] = bmvstr[3][0] = bmvstr[4][0] = '\0'; if (f != t) { /* algebraic notation */ bmvstr[0][0] = cxx[column (f)]; bmvstr[0][1] = rxx[row (f)]; bmvstr[0][2] = cxx[column (t)]; bmvstr[0][3] = rxx[row (t)]; bmvstr[0][4] = bmvstr[3][0] = '\0'; if (((bmvstr[1][0] = pxx[board[f]]) == 'P') || (flag & promote)) { if (bmvstr[0][0] == bmvstr[0][2]) /* pawn did not eat */ { bmvstr[2][0] = bmvstr[1][0] = bmvstr[0][2]; /* to column */ bmvstr[2][1] = bmvstr[1][1] = bmvstr[0][3]; /* to row */ m3p = 2; } else /* pawn ate */ { bmvstr[2][0] = bmvstr[1][0] = bmvstr[0][0]; /* column */ bmvstr[2][1] = bmvstr[1][1] = bmvstr[0][2]; /* to column */ bmvstr[2][2] = bmvstr[0][3]; m3p = 3; /* to row */ } if (flag & promote) { bmvstr[0][4] = bmvstr[1][2] = bmvstr[2][m3p] = qxx[flag & pmask]; bmvstr[0][5] = bmvstr[1][3] = bmvstr[2][m3p + 1] = bmvstr[3][0] = '\0'; } else bmvstr[2][m3p] = bmvstr[1][2] = '\0'; } else /* not a pawn */ { bmvstr[2][0] = bmvstr[1][0]; bmvstr[2][1] = bmvstr[0][1]; bmvstr[2][2] = bmvstr[1][1] = bmvstr[0][2]; /* to column */ bmvstr[2][3] = bmvstr[1][2] = bmvstr[0][3]; /* to row */ bmvstr[2][4] = bmvstr[1][3] = '\0'; strcpy (bmvstr[3], bmvstr[2]); bmvstr[3][1] = bmvstr[0][0]; bmvstr[4][0] = bmvstr[1][0]; strcpy(&bmvstr[4][1],bmvstr[0]); if (flag & cstlmask) { if (t > f) { strcpy (bmvstr[1], bmvstr[0]); strcpy (bmvstr[0], CP[5]); strcpy (bmvstr[2], CP[7]); } else { strcpy (bmvstr[1], bmvstr[0]); strcpy (bmvstr[0], CP[6]); strcpy (bmvstr[2], CP[8]); } } } } else bmvstr[0][0] = bmvstr[1][0] = bmvstr[2][0] = bmvstr[3][0] = bmvstr[4][0] = '\0'; } #ifdef GENIT GENITchk(gs) CHAR *gs; { int gcnt,gpnt; struct leaf *node = NULL; gcnt = 0; gpnt = TrPnt[2]; while (gpnt < TrPnt[3]) { node = &Tree[gpnt++]; Balgbr (node->f, node->t, (SHORT) node->flags); if (strcmp (gs, bmvstr[0]) == 0 || strcmp (gs, bmvstr[1]) == 0 || strcmp (gs, bmvstr[2]) == 0 || strcmp (gs, bmvstr[3]) == 0 || strcmp(gs,bmvstr[4]) == 0) { gcnt++; } } return gcnt; } #endif #ifndef QUIETBOOKGEN void bkdisplay (s, cnt, moveno) CHAR *s; int cnt; int moveno; { static SHORT pnt; #ifndef SEMIQUIETBOOKGEN struct leaf *node; int r, c, l; #endif pnt = TrPnt[2]; printf ("matches = %d\n", cnt); printf ("inout move is :%s:move number %d side %s\n", s, moveno / 2 + 1, !(moveno & 1) ? "white" : "black"); #ifndef SEMIQUIETBOOKGEN printf ("legal moves are \n"); while (pnt < TrPnt[3]) { node = &Tree[pnt++]; Balgbr (node->f, node->t, (SHORT) node->flags); printf ("%s %s %s %s %s\n", bmvstr[0], bmvstr[1], bmvstr[2], bmvstr[3],bmvstr[4]); } printf ("\n current board is\n"); for (r = 7; r >= 0; r--) { for (c = 0; c <= 7; c++) { l = locn (r, c); if (color[l] == neutral) printf (" -"); else if (color[l] == white) printf (" %c", qxx[board[l]]); else printf (" %c", pxx[board[l]]); } printf ("\n"); } printf ("\n\n"); #endif } #endif int BVerifyMove (CHAR *s, UTSHORT *mv, int moveno) /* * Compare the string 's' to the list of legal moves available for the * opponent. If a match is found, make the move on the board. */ { static SHORT pnt, tempb, tempc, tempsf, tempst, cnt; static struct leaf xnode; struct leaf *node; *mv = 0; cnt = 0; VMoveList (opponent, 2); pnt = TrPnt[2]; while (pnt < TrPnt[3]) { node = &Tree[pnt++]; Balgbr (node->f, node->t, (SHORT) node->flags); if (strcmp (s, bmvstr[0]) == 0 || strcmp (s, bmvstr[1]) == 0 || strcmp (s, bmvstr[2]) == 0 || strcmp (s, bmvstr[3]) == 0 || strcmp (s, bmvstr[4]) == 0) { cnt++; xnode = *node; } } if (cnt == 1) { #ifdef GENIT Balgbr (xnode.f, xnode.t, (SHORT) xnode.flags); strcpy(gs0,bmvstr[0]); strcpy(gs1,bmvstr[1]); strcpy(gs2,bmvstr[2]); strcpy(gs3,bmvstr[3]); if(GENITchk(gs1) == 1)strcpy(GENITs,gs1); else if(GENITchk(gs2) == 1)strcpy(GENITs,gs2); else if(GENITchk(gs2) == 1)strcpy(GENITs,gs1); else strcpy(GENITs,gs0); if(strcmp("e8g8", GENITs) == 0 || strcmp("e1g1",GENITs) == 0)strcpy(GENITs,"o-o"); else if(strcmp("e8c8", GENITs) == 0 || strcmp("e1c1",GENITs) == 0)strcpy(GENITs,"o-o-o"); #endif MakeMove (opponent, &xnode, &tempb, &tempc, &tempsf, &tempst, &INCscore); if (SqAtakd (PieceList[opponent][0], computer)) { UnmakeMove (opponent, &xnode, &tempb, &tempc, &tempsf, &tempst); /* Illegal move in check */ #ifndef QUIETBOOKGEN printf (CP[77]); printf ("\n"); bkdisplay (s, cnt, moveno); #endif return (false); } else { *mv = (xnode.f << 8) | xnode.t; Balgbr (xnode.f, xnode.t, false); if (board[xnode.t] == pawn){ if (xnode.t - xnode.f == 16) epsquare = xnode.f + 8; else if (xnode.f - xnode.t == 16) epsquare = xnode.f - 8;} else epsquare = -1; return (true); } } /* Illegal move */ #ifndef QUIETBOOKGEN printf (CP[75], s); bkdisplay (s, cnt, moveno); #endif return (false); } void RESET (void) /* * Reset the board and other variables to start a new game. */ { SHORT l; flag.illegal = flag.mate = flag.post = flag.quit = flag.reverse = flag.bothsides = flag.onemove = flag.force = false; flag.material = flag.coords = flag.hash = flag.easy = flag.rcptr = true; flag.stars = flag.shade = flag.back = flag.musttimeout = false; #ifdef CHESSTOOL flag.beep=false; #else flag.beep=true; #endif #ifdef CLIENT flag.gamein = true; #else flag.gamein = false; #endif GenCnt = epsquare = 0; GameCnt = 0; Developed[white] = Developed[black] = false; castld[white] = castld[black] = false; PawnThreat[0] = CptrFlag[0] = false; opponent = white; computer = black; for (l = 0; l < 64; l++) { board[l] = Stboard[l]; color[l] = Stcolor[l]; Mvboard[l] = 0; } InitializeStats (); } int gnc (FILE * fd) { int c; c = getc (fd); if (c == '(') { do { c = getc (fd); if (c == ')') { c = getc (fd); break; } if (c == EOF) break; } while (true); } else if (c == '{') { do { c = getc (fd); if (c == '}') { c = getc (fd); break; } if (c == EOF) break; } while (true); } return c; } int Vparse (FILE * fd, UTSHORT *mv, SHORT side, CHAR *opening, int moveno) { register int c, i; CHAR s[128]; CHAR *p; while (true) { while ((c = gnc (fd)) == ' ' || c == '\n'); if (c == '\r') continue; i = 0; if (c == '#' || c == '[') { /* comment */ p = opening; do { *p++ = c; c = gnc (fd); if (c == '\r') continue; /* goes to end of line */ if (c == '\n') { /* does the comment continue */ if ((c = getc (fd)) == '[') continue; ungetc (c, fd); *p = '\0'; #ifdef GENIT GENline = 0; fprintf (GEN, "\n%s\n", opening); #endif return 0; } if (c == EOF) return -1; } while (true); } /* is it a move number or analysis ( in [ ] or in { } ) */ /* number cannot start with a 0 because of 0-0 */ else if (!isalpha (c) && c != '0') { int nl = false; int nonspace = false; while (true) { c = gnc (fd); if (nl) if (c == '#' || c == '[') { ungetc (c, fd); return 0; } if (c == '\r') continue; if (c == '\n') { nl = true; continue; } else nl = false; if (c == EOF) { return -1; } /* stop at first nonspace a ... is space */ /* must be nonspace because of 0-0 */ if (nonspace) { if (c != '.' && c != ' ') break; } if (c == '.') { nonspace = true; } /* stop if alpha must be move */ else if (isalpha (c)) break; } } s[0] = (CHAR) c; while ((c = gnc (fd)) != '\n' && c != ' ' && c != '\t' && c != EOF) { if (isupper (c)) { if (c != 'O') { ungetc (c, fd); c = ' '; break; } } if (c == '\r') continue; if (c == '?') break; if (c == '!') continue; if (c == '+') continue; if (c == '#') continue; if (c == '='){c = gnc(fd); c=tolower(c);} if (c != 'x') s[++i] = c; } s[++i] = '\0'; if (c == EOF) return (-1); if (s[0] == '!' || s[0] == ';') { while (c != '\n' && c != EOF) c = gnc (fd); if (c == EOF) return -1; else return (0); } if ((strcmp (s, "o-o-o") == 0) || (strcmp (s, "OOO") == 0) || (strcmp (s, "O-O-O") == 0) || (strcmp (s, "0-0-0") == 0)) { if (side == black) strcpy (s, "e8c8"); else strcpy (s, "e1c1"); } else if ((strcmp ("o-o", s) == 0) || (strcmp (s, "OO") == 0) || (strcmp (s, "O-O") == 0) || (strcmp (s, "0-0") == 0)) { if (side == black) strcpy (s, "e8g8"); else strcpy (s, "e1g1"); } else if (strcmp (s, "draw") == 0) continue; else if (strcmp (s, "1-0") == 0) continue; else if (strcmp (s, "0-1") == 0) continue; else if (strcmp (s, "2-1/2") == 0) continue; if (isupper (s[i - 1])) s[i - 1] = tolower (s[i - 1]); bhashkey = hashkey; bhashbd = hashbd; i = BVerifyMove (s, mv, moveno); if (c == '?') { /* Bad move, not for the program to play */ *mv |= BADMOVE; /* Flag it ! */ c = getc (fd); } else if (c == '+' || c == '\r') c = gnc (fd); if (!i) { printf ("%s \n", opening); /* flush to start of next */ while ((c = gnc (fd)) != '[' && c != EOF && c != '#'); if (c == EOF) return -1; else { ungetc (c, fd); return i; } } #ifdef GENIT if (GENline++ > 19) { GENline = 0; fprintf (GEN, "\n"); } if (c == '?') fprintf (GEN, "%s? ", GENITs); else fprintf (GEN, "%s ", GENITs); #endif return (i); } } #if defined GDX /*===================================== GDX =======================================*/ struct gdxadmin { unsigned long bookcount; unsigned long booksize; unsigned long maxoffset; } ADMIN, B; struct gdxdata { unsigned long hashbd; utshort hashkey; utshort bmove; utshort hint; utshort count; } DATA; #ifdef LONG64 #define lts(x) (utshort)(((x>>48)&0xfffe)|side) #else #define lts(x) (utshort)(((x>>16)&0xfffe)|side) #endif unsigned long currentoffset; int gfd; void GetOpenings (void) /* * If a text file of opening chess plays (the Opening Book) is available: * Read in the Opening Book file and parse the algebraic notation for a move * into an unsigned integer format indicating the from and to square. Create * or update a binary hash file with the recomended move/moves for each * position. * The binary hash file is opened with readonly access durring the game. */ { register SHORT i; CHAR opening[256]; CHAR msg[256]; int mustwrite = false; UTSHORT xside, doit, side; SHORT c; UTSHORT mv; UTSHORT ix; unsigned long x; unsigned long games = 0; FILE *fd; #ifdef GENIT if ((GEN = fopen ("GEN", "w")) == NULL) { printf("GEN FAIL\n");exit(1);} #endif if ((fd = fopen (bookfile, "r")) == NULL) fd = fopen ("gnuchess.book", "r"); if (fd != NULL) { /* yes add to book */ /* open book as writer */ gfd = open (binbookfile, O_RDONLY | O_BINARY); if (gfd >= 0) { if (sizeof(struct gdxadmin) == read (gfd, &ADMIN, sizeof (struct gdxadmin))) { B.bookcount = ADMIN.bookcount; B.booksize = ADMIN.booksize; B.maxoffset = ADMIN.maxoffset; if (B.booksize && !(B.maxoffset == ((unsigned long)(B.booksize - 1) * sizeof (struct gdxdata) + sizeof (struct gdxadmin)))) { printf ("bad format %s\n", binbookfile); exit (1); } } else { printf ("bad format %s\n", binbookfile); exit (1); } close (gfd); gfd = open (binbookfile, O_RDWR | O_BINARY); } else { #ifdef Think_C gfd = open (binbookfile, O_RDWR | O_CREAT | O_BINARY); #else gfd = open (binbookfile, O_RDWR | O_CREAT | O_BINARY, 0644); #endif ADMIN.bookcount = B.bookcount = 0; ADMIN.booksize = B.booksize = booksize; B.maxoffset = ADMIN.maxoffset = (unsigned long) (booksize - 1) * sizeof (struct gdxdata) + sizeof (struct gdxadmin); DATA.hashbd = 0; DATA.hashkey = 0; DATA.bmove = 0; DATA.hint = 0; DATA.count = 0; write (gfd, &ADMIN, sizeof (struct gdxadmin)); printf ("creating bookfile %s %ld %ld\n", binbookfile, B.maxoffset, B.booksize); for (x = 0; x < B.booksize; x++) { write (gfd, &DATA, sizeof (struct gdxdata)); } } if (gfd >= 0) { /* setvbuf(fd,buffr,_IOFBF,2048); */ side = white; xside = black; InitializeStats(); i = 0; while ((c = Vparse (fd, &mv, side, opening, i)) >= 0) { if (c == 1) { /* * if not first move of an opening and first * time we have seen it save next move as * hint */ i++; if (i < bookmaxply + 2) { if (i > 1) { DATA.hint = mv & 0x3f3f; } if (i < bookmaxply + 1) { doit = true; /* * see if this position and * move already exist from * some other opening */ /* * is this ethical, to offer * the bad move as a * hint????? */ ix = 0; if (mustwrite) { lseek (gfd, currentoffset, SEEK_SET); write (gfd, &DATA, sizeof (struct gdxdata)); mustwrite = false; } doit = true; currentoffset = (unsigned long) (bhashkey % B.booksize) * sizeof (struct gdxdata) + sizeof (struct gdxadmin); while (true) { lseek (gfd, currentoffset, SEEK_SET); if ((read (gfd, &DATA, sizeof (struct gdxdata)) == 0)) break; if (DATA.bmove == 0) break; if (DATA.hashkey == (utshort)(lts(bhashkey)) && DATA.hashbd == bhashbd) { if ((DATA.bmove & (~(LASTMOVE | BADMOVE))) == (mv & ~BADMOVE)) { DATA.count++; if(mv & BADMOVE) DATA.bmove |= BADMOVE; /* * yes so just bump count - count is * used to choose opening move in * proportion to its presence in the book */ doit = false; mustwrite = true; break; } else if(DATA.bmove & LASTMOVE){ DATA.bmove &= (~LASTMOVE); lseek (gfd, currentoffset, SEEK_SET); write (gfd, &DATA, sizeof (struct gdxdata)); } } currentoffset += sizeof (struct gdxdata); if (currentoffset > B.maxoffset) currentoffset = sizeof (struct gdxadmin); } /* * doesn`t exist so add it to * the book */ if (!mustwrite) { B.bookcount++; #if !defined CHESSTOOL && !defined XBOARD if (B.bookcount % 1000 == 0) printf ("%ld rec %ld openings processed\n", B.bookcount,games); #endif /* initialize a record */ DATA.hashbd = bhashbd; DATA.hashkey = (utshort)(lts(bhashkey)); DATA.bmove = mv | LASTMOVE; DATA.count = 1; DATA.hint = 0; mustwrite = true; } } } computer = opponent; opponent = computer ^ 1; xside = side; side = side ^ 1; } else if (i > 0) { /* reset for next opening */ games++; if (mustwrite) { lseek (gfd, currentoffset, SEEK_SET); write (gfd, &DATA, sizeof (struct gdxdata)); mustwrite = false; } RESET (); i = 0; side = white; xside = black; } } if (mustwrite) { lseek (gfd, currentoffset, SEEK_SET); write (gfd, &DATA, sizeof (struct gdxdata)); mustwrite = false; } fclose (fd); /* write admin rec with counts */ ADMIN.bookcount = B.bookcount; currentoffset = 0; lseek (gfd, currentoffset, SEEK_SET); write (gfd, &ADMIN, sizeof (struct gdxadmin)); close (gfd); } } if (binbookfile != NULL) { /* open book as reader */ gfd = open (binbookfile, O_RDONLY | O_BINARY); if (gfd >= 0) { read (gfd, &ADMIN, sizeof (struct gdxadmin)); B.bookcount = ADMIN.bookcount; B.booksize = ADMIN.booksize; B.maxoffset = ADMIN.maxoffset; if (B.booksize && !(B.maxoffset == ((unsigned long) (B.booksize - 1) * sizeof (struct gdxdata) + sizeof (struct gdxadmin)))) { printf ("bad format %s\n", binbookfile); exit (1); } } else { B.bookcount = 0; B.booksize = booksize; } #if !defined CHESSTOOL && !defined XBOARD sprintf (msg, CP[213], B.bookcount, B.booksize); ShowMessage (msg); #endif } /* set every thing back to start game */ Book = BOOKFAIL; RESET (); /* now get ready to play */ if (!B.bookcount) { #if !defined CHESSTOOL && !defined XBOARD ShowMessage (CP[212]); #endif Book = 0; } } int OpeningBook (SHORT *hint, SHORT side) /* * Go thru each of the opening lines of play and check for a match with the * current game listing. If a match occurs, generate a random number. If this * number is the largest generated so far then the next move in this line * becomes the current "candidate". After all lines are checked, the * candidate move is put at the top of the Tree[] array and will be played by * the program. Note that the program does not handle book transpositions. */ { UTSHORT r, m; int possibles = TrPnt[2] - TrPnt[1]; gsrand ((unsigned int) time ((long *) 0)); m = 0; /* * find all the moves for this position - count them and get their * total count */ { register UTSHORT i, x; register UTSHORT rec = 0; register UTSHORT summ = 0; register UTSHORT h = 0, b = 0; struct gdxdata OBB[128]; if (B.bookcount == 0) { Book--; return false; } currentoffset = (unsigned long) (hashkey % B.booksize) * sizeof (struct gdxdata) + sizeof (struct gdxadmin); x = 0; lseek (gfd, currentoffset, SEEK_SET); while (true) { if (read (gfd, &OBB[x], sizeof (struct gdxdata)) == 0) break; if (OBB[x].bmove == 0) break; if (OBB[x].hashkey == (utshort)(lts(hashkey)) && OBB[x].hashbd == hashbd) { x++;if(OBB[x-1].bmove & LASTMOVE) break; } currentoffset += sizeof (struct gdxdata); if (currentoffset > B.maxoffset){ lseek (gfd, sizeof (struct gdxadmin), SEEK_SET); currentoffset = sizeof (struct gdxadmin); } } if (x == 0) { Book--; return false; } #ifdef DEBUG33 { int loop = true; while(loop){ loop = false; for (i = 1; i < x; i++){ struct gdxdata tmp; if(OBB[i].count > OBB[i-1].count){loop = true;tmp = OBB[i-1]; OBB[i-1]=OBB[i]; OBB[i]=tmp;} } } } for (i = 0; i < x; i++) { Balgbr((OBB[i].bmove>>8) & 0x3f,(OBB[i].bmove ) & 0x3f,0); printf(" %s ",bmvstr[0],OBB[i].count); Balgbr((OBB[i].hint>>8) & 0x3f,(OBB[i].hint ) & 0x3f,0); printf("%s %c %d\n",bmvstr[0],(OBB[i].bmove & BADMOVE)?'*':' ',OBB[i].count); } #endif for (i = 0; i < x; i++) { if ((m = OBB[i].bmove) & BADMOVE) { m &= 0x3f3f; /* is the move is in the MoveList */ for (b = TrPnt[1]; b < (unsigned) TrPnt[2]; b++) { if (((Tree[b].f << 8) | Tree[b].t) == m) { if (--possibles) Tree[b].score = DONTUSE; pick (TrPnt[1], TrPnt[2] - 1); break; } } } else summ += OBB[i].count; } if (summ == 0) { Book--; return false; } r = (urand () % summ); #ifdef DEBUG33 printf("rand is %d, sum is %d\n",r,summ); #endif for (i = 0; i < x; i++) if (!(OBB[i].bmove & BADMOVE) ){ if( r < OBB[i].count) { rec = i; break; } else r -= OBB[i].count; #ifdef DEBUG33 printf("rand is %d, sum is %d\n",r,summ); #endif } h = ((OBB[rec].hint) & 0x3f3f); m = ((OBB[rec].bmove) & 0x3f3f); /* make sure the move is in the MoveList */ for (b = TrPnt[1]; b < (unsigned) TrPnt[2]; b++) { if (((Tree[b].f << 8) | Tree[b].t) == m) { Tree[b].flags |= book; Tree[b].score = 0; break; } } /* Make sure its the best */ pick (TrPnt[1], TrPnt[2] - 1); if (Tree[TrPnt[1]].score) { /* no! */ Book--; return false; } /* ok pick up the hint and go */ *hint = h; return true; } Book--; return false; } /*===================================== GDX =======================================*/ #else /*===================================== MEM =======================================*/ static void bkalloc (unsigned bksize) { register int i, f; /* allocate space for the book */ f = (bksize + bookpocket - 1) / bookpocket; bksize = booksize = f * bookpocket; #ifdef MSDOS OpenBook = (struct bookentry *) _halloc (bksize , sizeof (struct bookentry)); #else OpenBook = (struct bookentry *) malloc (bksize * sizeof (struct bookentry)); #endif if (OpenBook == NULL) { perror ("memory alloc"); exit (1); } for (BKTBLSIZE = 1, BOOKMASK = 1; BKTBLSIZE < f; BKTBLSIZE *= 2, BOOKMASK = (BOOKMASK << 1)); BOOKMASK -= 1; BookTable = (struct bookentry **) malloc (BKTBLSIZE * sizeof (struct bookentry *)); if (BookTable == NULL) { perror ("memory alloc"); exit (1); } for (i = 0; i < BKTBLSIZE; i++) { BookTable[i] = &OpenBook[bksize / BKTBLSIZE * i]; } OBEND = (OpenBook + ((bksize) * sizeof (struct bookentry))); } void GetOpenings (void) /* * Read in the Opening Book file and parse the algebraic notation for a move * into an unsigned integer format indicating the from and to square. Create * a linked list of opening lines of play, with entry->next pointing to the * next line and entry->move pointing to a chunk of memory containing the * moves. More Opening lines of up to 100 half moves may be added to * gnuchess.book. But now its a hashed table by position which yields a move * or moves for each position. It no longer knows about openings per say only * positions and recommended moves in those positions. */ { FILE *fd; register struct bookentry *OB = NULL; register struct bookentry *OC = NULL; register SHORT i; CHAR opening[80]; CHAR msg[80]; UTSHORT xside, doit, side; SHORT c; UTSHORT mv; if (binbookfile != NULL) { fd = fopen (binbookfile, "rb"); if (fd != NULL) { fscanf (fd, "%ld\n", &booksize); fscanf (fd, "%ld\n", &bookcount); fscanf (fd, "%d\n", &bookpocket); bkalloc (booksize); #if !defined CHESSTOOL && !defined XBOARD sprintf (msg, CP[213], bookcount, booksize); ShowMessage (msg); #endif if (0 > fread (OpenBook, sizeof (struct bookentry), booksize, fd)) { perror ("fread"); exit (1); } /* set every thing back to start game */ Book = BOOKFAIL; for (i = 0; i < 64; i++) { board[i] = Stboard[i]; color[i] = Stcolor[i]; } fclose (fd); } } if ((fd = fopen (bookfile, "r")) == NULL) fd = fopen ("gnuchess.book", "r"); if (fd != NULL) { if (OpenBook == NULL) { bkalloc (booksize); for (OB = OpenBook; OB < &OpenBook[booksize]; OB++) OB->count = 0; } OC = NULL; /* setvbuf(fd,buffr,_IOFBF,2048); */ side = white; xside = black; InitializeStats(); i = 0; while ((c = Vparse (fd, &mv, side, opening, i)) >= 0) { if (c == 1) { /* * if not first move of an opening and first * time we have seen it save next move as * hint */ i++; if (i < bookmaxply + 2) { if (i > 1 && OB->count == 1) OB->hint = mv & 0x3f3f; OC = OB; /* save for end marking */ if (i < bookmaxply + 1) { doit = true; /* * see if this position and * move already exist from * some other opening */ /* * is this ethical, to offer * the bad move as a * hint????? */ OB = BookTable[bhashkey & BOOKMASK]; while (OB->count) { if (OB->bookkey == bhashkey && OB->bookbd == bhashbd && (OB->flags & SIDEMASK) == side && (OB->bmove & ~BADMOVE) == (mv & ~BADMOVE)) { /* * yes so * just bump * count - * count is * used to * choose * opening * move in * proportion * to its * presence * in the * book */ doit = false; OB->count++; break; } /* * Book is hashed * into BKTBLSIZE * chunks based on * hashkey */ if (++OB == OBEND) OB = OpenBook; } /* * doesn`t exist so add it to * the book */ if (doit) { bookcount++; if (bookcount > (booksize - 2 * BKTBLSIZE)) { printf ("booksize exceeded\n"); exit (0); } #if !defined CHESSTOOL && !defined XBOARD if (bookcount % 1000 == 0) printf ("%ld processed\n", bookcount); #endif OB->bookkey = bhashkey; OB->bookbd = bhashbd; OB->bmove = mv; OB->hint = 0; OB->count = 1; OB->flags = side; } } } computer = opponent; opponent = computer ^ 1; xside = side; side = side ^ 1; } else if (i > 0) { /* reset for next opening */ RESET (); i = 0; side = white; xside = black; } } fclose (fd); if (binbookfile != NULL) { fd = fopen (binbookfile, "wb"); if (fd != NULL) { fprintf (fd, "%ld\n%ld\n%d\n", booksize, bookcount, bookpocket); if (0 > fwrite (OpenBook, sizeof (struct bookentry), booksize, fd)) perror ("fwrite"); fclose (fd); binbookfile = NULL; } } #if !defined CHESSTOOL && !defined XBOARD sprintf (msg, CP[213], bookcount, booksize); ShowMessage (msg); #endif /* set every thing back to start game */ Book = BOOKFAIL; RESET (); } else if (OpenBook == NULL) { #if !defined CHESSTOOL && !defined XBOARD if (!bookcount) ShowMessage (CP[212]); #endif Book = 0; } } int OpeningBook (SHORT *hint, SHORT side) /* * Go thru each of the opening lines of play and check for a match with the * current game listing. If a match occurs, generate a random number. If this * number is the largest generated so far then the next move in this line * becomes the current "candidate". After all lines are checked, the * candidate move is put at the top of the Tree[] array and will be played by * the program. Note that the program does not handle book transpositions. */ { SHORT pnt; UTSHORT m; unsigned r, cnt, tcnt, ccnt; register struct bookentry *OB, *OC; int possibles = TrPnt[2] - TrPnt[1]; #ifdef E4OPENING if ((computer == white && GameCnt == 0)) { /* double check */ int i; int go = true; for (i = 0; i < 64; i++) { if (!(board[i] == Stboard[i] && color[i] == Stcolor[i])) { go = false; break; } } if (go) { m = 0xc1c; /* make sure the move is in the MoveList */ for (pnt = TrPnt[1]; pnt < TrPnt[2]; pnt++) { if (((Tree[pnt].f << 8) | Tree[pnt].t) == (SHORT) m) { Tree[pnt].flags |= book; Tree[pnt].score = 0; break; } } /* Make sure its the best */ pick (TrPnt[1], TrPnt[2] - 1); if (!Tree[TrPnt[1]].score) { /* ok pick up the hint and go */ *hint = 0x3424; return true; } } } else if ((computer == black && GameCnt == 1)) { int go = true; int i; CHAR bd[64], cl[64]; for (i = 0; i < 64; i++) { bd[i] = Stboard[i]; cl[i] = Stcolor[i]; } bd[0x1c] = bd[0xc]; bd[0xc] = no_piece; cl[0x1c] = white; cl[0xc] = neutral; for (i = 0; i < 64; i++) { if (!(board[i] == bd[i] && color[i] == cl[i])) { go = false; break; } } if (go) { m = 0x3424; /* * make sure the move is in the MoveList */ for (pnt = TrPnt[1]; pnt < TrPnt[2]; pnt++) { if (((Tree[pnt].f << 8) | Tree[pnt].t) == (SHORT) m) { Tree[pnt].flags |= book; Tree[pnt].score = 0; break; } } /* Make sure its the best */ pick (TrPnt[1], TrPnt[2] - 1); if (!Tree[TrPnt[1]].score) { /* ok pick up the hint and go */ *hint = 0x0112; return true; } } } #endif gsrand ((unsigned int) time ((long *) 0)); m = 0; cnt = 0; tcnt = 0; ccnt = 0; OC = NULL; /* * find all the moves for this position - count them and get their * total count */ OB = BookTable[hashkey & BOOKMASK]; while (OB->count) { if (OB->bookkey == hashkey && OB->bookbd == hashbd && ((OB->flags) & SIDEMASK) == side) { if (OB->bmove & BADMOVE) { m = OB->bmove ^ BADMOVE; /* is the move is in the MoveList */ for (pnt = TrPnt[1]; pnt < TrPnt[2]; pnt++) { if (((Tree[pnt].f << 8) | Tree[pnt].t) == m) { if (--possibles) { Tree[pnt].score = DONTUSE; break; } } } } else { OC = OB; cnt++; tcnt += OB->count; } } if (++OB == OBEND) OB = OpenBook; } /* if only one just do it */ #ifdef DEBUG33 printf("count is %d\n",cnt); #endif if (cnt == 1) { m = OC->bmove; } else /* more than one must choose one at random */ if (cnt > 1) { /* pick a number */ r = urand () % 1000; OC = BookTable[hashkey & BOOKMASK]; #ifdef DEBUG33 printf("rand is %d tot-count is %d\n",r,tcnt); #endif while (OC->count) { if (OC == OBEND) OC = OpenBook; if (OC->bookkey == hashkey && OC->bookbd == hashbd && ((OC->flags) & SIDEMASK) == side && !(OC->bmove & BADMOVE)) { ccnt += OC->count; #ifdef DEBUG33 printf("rand is %ld tot-count is %d\n",((unsigned long) ccnt * BOOKRAND) / tcnt),r) #endif if ((((unsigned long) ccnt * BOOKRAND) / tcnt) >= r) { m = OC->bmove; break; } } if (++OC == OBEND) OC = OpenBook; } } else { /* none decrement count of no finds */ Book--; return false; } /* make sure the move is in the MoveList */ for (pnt = TrPnt[1]; pnt < TrPnt[2]; pnt++) { if (((Tree[pnt].f << 8) | Tree[pnt].t) == m) { Tree[pnt].flags |= book; Tree[pnt].score = 0; break; } } /* Make sure its the best */ pick (TrPnt[1], TrPnt[2] - 1); if (Tree[TrPnt[1]].score) { /* no! */ Book--; return false; } /* ok pick up the hint and go */ *hint = OC->hint; return true; } /*===================================== MEM =======================================*/ #endif gnuchess-4.0.pl70/src/debug10.h100444 21542 13 1671 5563700643 15175 0ustar cracraftuser#ifdef DEBUG10 else { FILE *D; int r, c, l; struct leaf *xnode; D = fopen ("/tmp/DEBUG", "w"); pnt = TrPnt[2]; fprintf (D, "hashfile failure\n"); algbr (PV >> 8, PV & 0x3f, 0); fprintf (D, "inout move is %s\n", mvstr); fprintf (D, "legal move are \n"); for (r = TrPnt[ply]; r < TrPnt[ply + 1]; r++) { xnode = &Tree[r]; algbr (xnode->f, xnode->t, (short) xnode->flags); fprintf (D, "%s %s %s %s\n", mvstr[0], mvstr[1], mvstr[2], mvstr[3]); } fprintf (D, "\n current board is\n"); for (r = 7; r >= 0; r--) { for (c = 0; c <= 7; c++) { l = locn (r, c); if (color[l] == neutral) fprintf (D, " -"); else if (color[l] == white) fprintf (D, " %c", qxx[board[l]]); else fprintf (D, " %c", pxx[board[l]]); } fprintf (D, "\n"); } fprintf (D, "\n"); fclose (D); } #endif gnuchess-4.0.pl70/src/debug13.h100444 21542 13 1274 5563700643 15177 0ustar cracraftuser#ifdef DEBUG13 if (flag.timeout && !background) { FILE *D; int r, c, l; struct leaf *xnode; D = fopen ("/tmp/DEBUG", "a+"); fprintf (D, " %d ply %d sco %d TC %d gl %d cnt %d\n", Sdepth, plyscore, score, TCcount, globalpnt, TrPnt[2] - TrPnt[1]); for (i = 1; tmp[i]; i++) { algbr (tmp[i] >> 8, tmp[i] & 0xff, 0); fprintf (D, "%s ", mvstr[0]); } fprintf (D, "\n"); for (i = 1; PrVar[i]; i++) { algbr (PrVar[i] >> 8, PrVar[i] & 0xff, 0); fprintf (D, "%s ", mvstr[0]); } fprintf (D, "\n"); algbr (root->f, root->t, root->flags); fprintf (D, "%s ", mvstr[0]); fprintf (D, "\n"); fclose (D); } #endif gnuchess-4.0.pl70/src/match100755 21542 13 1534 5522241344 14610 0ustar cracraftuser#!/bin/sh # # match -- play a series of games using xboard as a referee # case $# in 8) COUNT=0; PGM1=$2 ; PGM2=$4 ; LENGTH=$6 ; MODE=$8 ;; *) echo "Usage: match -pgm1 pgm -pgm2 pgm -length \ games -mode (Init | Position | Opening)" ; exit esac while (:) do if (test $COUNT -eq $LENGTH) then break else COUNT=`echo $COUNT | awk '{print $0 + 1}'` MODULO=`echo $COUNT | awk '{print $0 % 2}'` if (test $MODULO -eq 0) then xboard -fcp $PGM1 -scp $PGM2 \ -matchMode $MODE -saveGameFile match.game.$COUNT \ -savePositionFile match.position.$COUNT -iconic else xboard -fcp $PGM2 -scp $PGM1 \ -matchMode $MODE -saveGameFile match.game.$COUNT \ -savePositionFile match.position.$COUNT -iconic fi fi done gnuchess-4.0.pl70/src/debug16.h100444 21542 13 1013 5563700643 15171 0ustar cracraftuser#ifdef DEBUG if (debuglevel & 16) { int j;int i; for (i = TrPnt[1]; i < TrPnt[2]; i++) pick (i, TrPnt[2] - 1); printf ("Sdepth %d alpha %d beta %d stage %d\n", Sdepth, alpha, beta, stage); for (j = 1; j < 2; j++) { int idb; for (idb = TrPnt[j]; idb < TrPnt[j + 1]; idb++) { algbr (Tree[idb].f, Tree[idb].t, Tree[idb].flags); printf ("level 16 %d-->%d %s n->s%d n->w%d n->f%x\n", Sdepth, idb, mvstr[0], Tree[idb].score, Tree[idb].width, Tree[idb].flags); } } } #endif gnuchess-4.0.pl70/src/debug256.h100444 21542 13 645 5563700644 15252 0ustar cracraftuser#ifdef DEBUG traceflag = tracetmp; if (debuglevel & 256 || ((debuglevel & 1024) && traceflag && (!traceply || ply <= traceply))) { int i; algbr (node->f, node->t, node->flags); for (i = 1; i < ply; i++) printf (" "); printf ("%s S%d d%d p%d %d %x n->s%d s%d a%d b%d best%d x%d\n", mvstr[0], Sdepth, depth, ply, pnt,node->flags, node->score, score, alpha, beta, best, xxxtmp); } #endif gnuchess-4.0.pl70/src/debug4.h100444 21542 13 671 5563700644 15100 0ustar cracraftuser#ifdef DEBUG if (debuglevel & 4) { int j; printf ("Sdepth %d alpha %d beta %d stage %d\n", Sdepth, alpha, beta, stage); for (j = 1; j < 2; j++) { int idb; for (idb = TrPnt[j]; idb < TrPnt[j + 1]; idb++) { algbr (Tree[idb].f, Tree[idb].t, Tree[idb].flags); printf ("level 4 %d-->%d %s %d %d %x\n", j, idb, mvstr[0], Tree[idb].score, Tree[idb].width,Tree[idb].flags); } } } #endif gnuchess-4.0.pl70/src/debug40.h100444 21542 13 26 5563700644 15132 0ustar cracraftuser#ifdef DEBUG40 #endif gnuchess-4.0.pl70/src/debug41.h100444 21542 13 1137 5563700644 15177 0ustar cracraftuser#ifdef DEBUG41 void debug41 (short score, short unsigned int xxx[], CHAR ch) { register int i; FILE *D; int r, c, l; struct leaf *xnode; D = fopen ("/tmp/DEBUG", "a+"); if (D == NULL) { perror ("opening D"); } ElapsedTime (2); fprintf (D, "%2d%c %6d %4ld %8ld ", Sdepth, ch, score, et / 100, NodeCnt); for (i = 1; xxx[i]; i++) { if ((i > 1) && (i % 8 == 1)) fprintf (D, "\n "); algbr ((short) (xxx[i] >> 8), (short) (xxx[i] & 0xFF), false); fprintf (D, "%5s ", mvstr[0]); } fprintf (D, "\n"); fclose (D); } #endif gnuchess-4.0.pl70/src/debug512.h100444 21542 13 1630 5563700644 15260 0ustar cracraftuser#ifdef DEBUG /* types debug? enter: pxx trace plys > xx xxxx moves in alg. notation. 1 per line empty line terminates input trace is printed for all lines deeper than xx and beginning with the move sequence entered. */ if (debuglevel & 2560) { int j; if (debuglevel & 512 && (tracen > 0 && traceflag)) { traceline[0]='\0'; for (j=1;tracelog[j];j++){ algbr(tracelog[j]>>8,tracelog[j]&0xff,0); strcat(traceline," "); strcat(traceline,mvstr[0]); } printf("Ply %d alpha %d beta %d score %d %s\n", ply, alpha, beta, score,traceline); if(debuglevel & 2048){ for (j = ply; j < ply + 1; j++) { int idb; for (idb = TrPnt[j]; idb < TrPnt[j + 1]; idb++) { algbr(Tree[idb].f, Tree[idb].t, Tree[idb].flags); printf("level 512 %d-->%d %s %d %d %x\n", ply, idb, mvstr[0], Tree[idb].score, Tree[idb].width, Tree[idb].flags); } } } } } #endif gnuchess-4.0.pl70/src/debug64.h100444 21542 13 302 5563700644 15155 0ustar cracraftuser#ifdef DEBUG if (debuglevel & 64) { algbr (PV >> 8, PV & 0xff, 0); printf ("-get-> d=%d s=%d p=%d a=%d b=%d %s\n", depth, score, ply, alpha, beta, mvstr[0]); } #endif gnuchess-4.0.pl70/src/debug8.h100444 21542 13 522 5563700644 15077 0ustar cracraftuser#ifdef DEBUG if (debuglevel & 8) { int j; for (j = 1; j < 2; j++) { int idb; for (idb = TrPnt[j]; idb < TrPnt[j + 1]; idb++) { algbr (Tree[idb].f, Tree[idb].t, Tree[idb].flags); printf ("level 8 %d-->%d %s %d %d\n", j, idb, mvstr[0], Tree[idb].score, Tree[idb].width); } } } #endif gnuchess-4.0.pl70/src/dspcom.c100644 21542 13 111103 5567302416 15260 0ustar cracraftuser/* * dspcom.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #define DEBUG8 1 #include "gnuchess.h" #include "ataks.h" #include "ttable.h" /* calls ZeroTTable(), probably belongs in main.c*/ #ifdef HASGETTIMEOFDAY #include #endif CHAR mvstr[5][7]; #if defined(Think_C) && defined(Window_Events) #include "doevents.h" #endif extern SHORT Mwpawn[64], Mbpawn[64], Mknight[2][64], Mbishop[2][64]; extern CHAR *version, *patchlevel; CHAR *InPtr; #if defined(sun) && defined(sparc) && defined(svr4) #include #endif #include #include #if defined(MSDOS) #include /*#include */ #include #include #include #else #ifdef Think_C #include #include "doevents.h" #else /* Other */ #include #include #include #ifndef AMIGADOS #include #endif #endif /* Think_C */ #endif /* MSDOS */ void algbr (SHORT f, SHORT t, SHORT flag) /* * Generate move strings in different formats. */ { int m3p; if (f != t) { /* algebraic notation */ mvstr[0][0] = cxx[column (f)]; mvstr[0][1] = rxx[row (f)]; mvstr[0][2] = cxx[column (t)]; mvstr[0][3] = rxx[row (t)]; mvstr[4][0] = mvstr[0][4] = mvstr[3][0] = '\0'; if (((mvstr[1][0] = pxx[board[f]]) == CP[2][1]) || (flag & promote)) { if (mvstr[0][0] == mvstr[0][2]) /* pawn did not eat */ { mvstr[2][0] = mvstr[1][0] = mvstr[0][2]; /* to column */ mvstr[2][1] = mvstr[1][1] = mvstr[0][3]; /* to row */ m3p = 2; } else /* pawn ate */ { mvstr[2][0] = mvstr[1][0] = mvstr[0][0]; /* column */ mvstr[2][1] = mvstr[1][1] = mvstr[0][2]; /* to column */ mvstr[2][2] = mvstr[0][3]; m3p = 3; /* to row */ } if (flag & promote) { mvstr[0][4] = mvstr[1][2] = mvstr[2][m3p] = qxx[flag & pmask]; mvstr[0][5] = mvstr[1][3] = mvstr[2][m3p + 1] = mvstr[3][0] = '\0'; #ifdef CHESSTOOL mvstr[3][0] = mvstr[0][0]; /* Allow e7e8 for chesstool */ mvstr[3][1] = mvstr[0][1]; mvstr[3][2] = mvstr[0][2]; mvstr[3][3] = mvstr[0][3]; mvstr[3][4] = '\0'; #endif } else mvstr[2][m3p] = mvstr[1][2] = '\0'; } else /* not a pawn */ { mvstr[2][0] = mvstr[1][0]; mvstr[2][1] = mvstr[0][1]; mvstr[2][2] = mvstr[1][1] = mvstr[0][2]; /* to column */ mvstr[2][3] = mvstr[1][2] = mvstr[0][3]; /* to row */ mvstr[2][4] = mvstr[1][3] = '\0'; strcpy (mvstr[3], mvstr[2]); mvstr[3][1] = mvstr[0][0]; mvstr[4][0] = mvstr[1][0]; strcpy(&mvstr[4][1],mvstr[0]); if (flag & cstlmask) { if (t > f) { strcpy (mvstr[1], mvstr[0]); strcpy (mvstr[0], CP[5]); strcpy (mvstr[2], CP[7]); } else { strcpy (mvstr[1], mvstr[0]); strcpy (mvstr[0], CP[6]); strcpy (mvstr[2], CP[8]); } } } } else mvstr[0][0] = mvstr[1][0] = mvstr[2][0] = mvstr[3][0] = mvstr[4][0] = '\0'; } int VerifyMove (CHAR *s, SHORT iop, UTSHORT *mv) /* * Compare the string 's' to the list of legal moves available for the * opponent. If a match is found, make the move on the board. */ { static SHORT pnt, tempb, tempc, tempsf, tempst, cnt; static struct leaf xnode; struct leaf *node; *mv = 0; if (iop == 2) { UnmakeMove (opponent, &xnode, &tempb, &tempc, &tempsf, &tempst); return (false); } cnt = 0; VMoveList (opponent, 2); pnt = TrPnt[2]; while (pnt < TrPnt[3]) { node = &Tree[pnt++]; algbr (node->f, node->t, (SHORT) node->flags); if (strcmp (s, mvstr[0]) == 0 || strcmp (s, mvstr[1]) == 0 || strcmp (s, mvstr[2]) == 0 || strcmp (s, mvstr[3]) == 0 || strcmp (s, mvstr[4]) == 0) { cnt++; xnode = *node; } } if (cnt == 1) { MakeMove (opponent, &xnode, &tempb, &tempc, &tempsf, &tempst, &INCscore); if (SqAtakd (PieceList[opponent][0], computer)) { UnmakeMove (opponent, &xnode, &tempb, &tempc, &tempsf, &tempst); #if defined CHESSTOOL printz (CP[78]); #else #ifdef NONDSP /* Illegal move in check */ printz (CP[77]); printz ("\n"); #ifdef DEBUG8 if (1) { FILE *D; int r, c, l; extern UTSHORT PrVar[]; D = fopen ("/tmp/DEBUG", "a+"); pnt = TrPnt[2]; fprintf (D, "resp = %ld\n", ResponseTime); fprintf (D, "iop = %d\n", iop); fprintf (D, "matches = %d\n", cnt); algbr (hint >> 8, hint & 0xff, (SHORT) 0); fprintf (D, "hint %s\n", mvstr[0]); fprintf (D, "inout move is %s\n", s); for (r = 1; PrVar[r]; r++) { algbr (PrVar[r] >> 8, PrVar[r] & 0xff, (SHORT) 0); fprintf (D, " %s", mvstr[0]); } fprintf (D, "\n"); fprintf (D, "legal move are \n"); while (pnt < TrPnt[3]) { node = &Tree[pnt++]; algbr (node->f, node->t, (SHORT) node->flags); fprintf (D, "%s %s %s %s %s\n", mvstr[0], mvstr[1], mvstr[2], mvstr[3],mvstr[4]); } fprintf (D, "\n current board is\n"); for (r = 7; r >= 0; r--) { for (c = 0; c <= 7; c++) { l = locn (r, c); if (color[l] == neutral) fprintf (D, " -"); else if (color[l] == white) fprintf (D, " %c", qxx[board[l]]); else fprintf (D, " %c", pxx[board[l]]); } fprintf (D, "\n"); } fprintf (D, "\n"); fclose (D); } #endif #else /* Illegal move in check */ ShowMessage (CP[77]); #endif #endif /* CHESSTOOL */ return (false); } else { if (iop == 1) return (true); UpdateDisplay (xnode.f, xnode.t, 0, (SHORT) xnode.flags); if ((board[xnode.t] == pawn) || (xnode.flags & capture) || (xnode.flags & cstlmask)) { Game50 = GameCnt; ZeroRPT (); } GameList[GameCnt].depth = GameList[GameCnt].score = 0; GameList[GameCnt].nodes = 0; ElapsedTime (1); GameList[GameCnt].time = (SHORT) (et+50)/100; if (TCflag) { TimeControl.clock[opponent] -= (et-TCadd); timeopp[oppptr] = et; --TimeControl.moves[opponent]; } *mv = (xnode.f << 8) | xnode.t; algbr (xnode.f, xnode.t, false); return (true); } } #if defined CHESSTOOL printz (CP[78]); #else #ifdef NONDSP /* Illegal move */ printz (CP[75], s); #ifdef DEBUG8 if (1) { FILE *D; int r, c, l; extern UTSHORT PrVar[]; D = fopen ("/tmp/DEBUG", "a+"); pnt = TrPnt[2]; fprintf (D, "resp = %ld\n", ResponseTime); fprintf (D, "iop = %d\n", iop); fprintf (D, "matches = %d\n", cnt); algbr (hint >> 8, hint & 0xff, (SHORT) 0); fprintf (D, "hint %s\n", mvstr[0]); fprintf (D, "inout move is %s\n", s); for (r = 1; PrVar[r]; r++) { algbr (PrVar[r] >> 8, PrVar[r] & 0xff, (SHORT) 0); fprintf (D, " %s", mvstr[0]); } fprintf (D, "\n"); fprintf (D, "legal move are \n"); while (pnt < TrPnt[3]) { node = &Tree[pnt++]; algbr (node->f, node->t, (SHORT) node->flags); fprintf (D, "%s %s %s %s %s\n", mvstr[0], mvstr[1], mvstr[2], mvstr[3],mvstr[4]); } fprintf (D, "\n current board is\n"); for (r = 7; r >= 0; r--) { for (c = 0; c <= 7; c++) { l = locn (r, c); if (color[l] == neutral) fprintf (D, " -"); else if (color[l] == white) fprintf (D, " %c", qxx[board[l]]); else fprintf (D, " %c", pxx[board[l]]); } fprintf (D, "\n"); } fprintf (D, "\n"); fclose (D); } #endif #else /* Illegal move */ ShowMessage (CP[76]); #endif #endif /* CHESSTOOL */ #if !defined CHESSTOOL && !defined XBOARD if (cnt > 1) ShowMessage (CP[32]); #endif /* CHESSTOOL */ return (false); } int parser (CHAR *f, int side) { int c1, r1, c2, r2; if (f[4] == 'o') if (side == black) return 0x3C3A; else return 0x0402; else if (f[0] == 'o') if (side == black) return 0x3C3E; else return 0x0406; else { c1 = f[0] - 'a'; r1 = f[1] - '1'; c2 = f[2] - 'a'; r2 = f[3] - '1'; return (locn (r1, c1) << 8) | locn (r2, c2); } /*NOTREACHED*/ } void GetGame (void) { FILE *fd; CHAR fname[256], *p; int c, i, j; int eps = -1; SHORT sq; /* enter file name */ ShowMessage (CP[63]); scanz ("%s", fname); /* chess.000 */ if (fname[0] == '\0') strcpy (fname, CP[137]); if ((fd = fopen (fname, "r")) != NULL) { NewGame (); fgets (fname, 256, fd); computer = opponent = white; InPtr = fname; skip (); if (*InPtr == 'c') computer = black; else opponent = black; skip (); skip (); skip (); Game50 = atoi (InPtr); skip(); skip(); eps = atoi(InPtr); fgets (fname, 256, fd); InPtr = &fname[14]; castld[white] = ((*InPtr == CP[214][0]) ? true : false); skip (); skip (); castld[black] = ((*InPtr == CP[214][0]) ? true : false); fgets (fname, 256, fd); InPtr = &fname[11]; skipb (); TCflag = atoi (InPtr); skip (); InPtr += 14; skipb (); OperatorTime = atoi (InPtr); fgets (fname, 256, fd); InPtr = &fname[11]; skipb (); TimeControl.clock[white] = atol (InPtr); skip (); skip (); TimeControl.moves[white] = atoi (InPtr); fgets (fname, 256, fd); InPtr = &fname[11]; skipb (); TimeControl.clock[black] = atol (InPtr); skip (); skip (); TimeControl.moves[black] = atoi (InPtr); fgets (fname, 256, fd); for (i = 7; i > -1; i--) { fgets (fname, 256, fd); p = &fname[2]; InPtr = &fname[11]; skipb (); for (j = 0; j < 8; j++) { sq = i * 8 + j; if (*p == '.') { board[sq] = no_piece; color[sq] = neutral; } else { for (c = 0; c < 8; c++) { if (*p == pxx[c]) { board[sq] = c; color[sq] = black; } } for (c = 0; c < 8; c++) { if (*p == qxx[c]) { board[sq] = c; color[sq] = white; } } } p++; Mvboard[sq] = atoi (InPtr); skip (); } } GameCnt = 0; flag.regularstart = true; Book = BOOKFAIL; fgets (fname, 256, fd); fgets (fname, 256, fd); fgets (fname, 256, fd); while (fgets (fname, 256, fd)) { struct GameRec *g; int side = black; side = side ^ 1; ++GameCnt; InPtr = fname; skipb (); g = &GameList[GameCnt]; g->gmove = parser (InPtr, side); skip (); g->score = atoi (InPtr); skip (); g->depth = atoi (InPtr); skip (); g->nodes = atol (InPtr); skip (); g->time = atol (InPtr); skip (); g->flags = c = atoi (InPtr); skip (); g->hashkey = strtol (InPtr, (CHAR **) NULL, 16); skip (); g->hashbd = strtol (InPtr, (CHAR **) NULL, 16); skip (); g->epssq = atoi(InPtr); g->piece = no_piece; g->color = neutral; if (c & (capture | cstlmask)) { if (c & capture) { skip (); for (c = 0; c < 8; c++) if (pxx[c] == *InPtr) break; g->piece = c; } skip (); g->color = ((*InPtr == CP[119][0]) ? black : white); } } if (TimeControl.clock[white] > 0) TCflag = true; fclose (fd); } ZeroRPT (); InitializeStats (); epsquare = eps; UpdateDisplay (0, 0, 1, 0); Sdepth = 0; hint = 0; } void GetXGame (void) { FILE *fd; CHAR fname[256], *p; int c, i, j; SHORT sq; /* Enter file name */ ShowMessage (CP[63]); scanz ("%s", fname); if (fname[0] == '\0') /* xboard.position.read*/ strcpy (fname, CP[205]); if ((fd = fopen (fname, "r")) != NULL) { NewGame (); flag.regularstart = false; Book = false; fgets (fname, 256, fd); #ifdef notdef fname[6] = '\0'; if (strcmp (fname, CP[206])) return; #endif fgets (fname, 256, fd); fgets (fname, 256, fd); for (i = 7; i > -1; i--) { fgets (fname, 256, fd); p = fname; for (j = 0; j < 8; j++) { sq = i * 8 + j; if (*p == '.') { board[sq] = no_piece; color[sq] = neutral; } else { for (c = 0; c < 8; c++) { if (*p == qxx[c]) { board[sq] = c; color[sq] = black; } } for (c = 0; c < 8; c++) { if (*p == pxx[c]) { board[sq] = c; color[sq] = white; } } } p += 2; } } if (fgets(fname, 256, fd) != NULL && strncmp(fname, "black", 5) == 0) { computer = white; opponent = black; xwndw = BXWNDW; } fclose (fd); } ZeroRPT (); InitializeStats (); UpdateDisplay (0, 0, 1, 0); Sdepth = 0; hint = 0; } void SaveGame (void) { FILE *fd; CHAR fname[256]; SHORT sq, i, c, f, t; CHAR p; if (savefile[0]) strcpy (fname, savefile); else { /* Enter file name*/ ShowMessage (CP[63]); scanz ("%s", fname); } if (fname[0] == '\0') /* chess.000 */ strcpy (fname, CP[137]); if ((fd = fopen (fname, "w")) != NULL) { CHAR *b, *w; b = w = CP[74]; if (computer == black) b = CP[141]; if (computer == white) w = CP[141]; fprintf (fd, CP[37], b, w, Game50,epsquare); fprintf (fd, CP[42], castld[white] ? CP[214] : CP[215], castld[black] ? CP[214] : CP[215]); fprintf (fd, CP[111], TCflag, OperatorTime); fprintf (fd, CP[117], TimeControl.clock[white], TimeControl.moves[white], TimeControl.clock[black], TimeControl.moves[black]); for (i = 7; i > -1; i--) { fprintf (fd, "%1d ", i + 1); for (c = 0; c < 8; c++) { sq = i * 8 + c; switch (color[sq]) { case black: p = pxx[board[sq]]; break; case white: p = qxx[board[sq]]; break; default: p = '.'; } fprintf (fd, "%c", p); } for (f = i * 8; f < i * 8 + 8; f++) fprintf (fd, " %d", Mvboard[f]); fprintf (fd, "\n"); } fprintf (fd, " %s\n", cxx); fprintf (fd, CP[126]); for (i = 1; i <= GameCnt; i++) { struct GameRec *g = &GameList[i]; f = g->gmove >> 8; t = (g->gmove & 0xFF); algbr (f, t, g->flags); fprintf (fd, "%s %5d %5d %7ld %6ld %5d %#08lx %#08lx %d %c %s\n", mvstr[0], g->score, g->depth, g->nodes, g->time, g->flags, g->hashkey, g->hashbd,g->epssq, pxx[g->piece], (((int)(g->color) == 2) ? (CHAR *)" " : ColorStr[g->color])); } fclose (fd); /* Game saved */ ShowMessage (CP[70]); } else /*ShowMessage ("Could not open file");*/ ShowMessage (CP[48]); } void ListGame (void) { FILE *fd; SHORT i, f, t; #ifndef MSDOS time_t when; CHAR fname[256], dbuf[256]; #else CHAR fname[256]; #endif if (listfile[0]) strcpy (fname, listfile); else { #ifdef MSDOS sprintf (fname, "chess.lst"); #else time (&when); strncpy (dbuf, ctime (&when), 20); dbuf[7] = '\0'; dbuf[10] = '\0'; dbuf[13] = '\0'; dbuf[16] = '\0'; dbuf[19] = '\0'; /* use format "CLp16.Jan01-020304B" when patchlevel is 16, date is Jan 1 time is 02:03:04 program played black */ sprintf (fname, "CLp%s.%s%s-%s%s%s%c", patchlevel, dbuf + 4, dbuf + 8, dbuf + 11, dbuf + 14, dbuf + 17, ColorStr[computer][0]); /* replace space padding with 0 */ for (i = 0; fname[i] != '\0'; i++) if (fname[i] == ' ') fname[i] = '0'; #endif /* MSDOS */ } fd = fopen (fname, "w"); if (!fd) { printf (CP[219], fname); exit (1); } /*fprintf (fd, "gnuchess game %d\n", u);*/ fprintf (fd, CP[161], patchlevel); fprintf (fd, CP[10]); fprintf (fd, CP[11]); for (i = 1; i <= GameCnt; i++) { f = GameList[i].gmove >> 8; t = (GameList[i].gmove & 0xFF); algbr (f, t, GameList[i].flags); if(GameList[i].flags & book) fprintf (fd, "%6s %5d Book%7ld %5ld", mvstr[0], GameList[i].score, GameList[i].nodes, GameList[i].time); else fprintf (fd, "%6s %5d %2d %7ld %5ld", mvstr[0], GameList[i].score, GameList[i].depth, GameList[i].nodes, GameList[i].time); if ((i % 2) == 0) { #ifdef DEBUG40 if(computer == black){ int p; for(p=0;GameList[i-1].d1[p] && p < 7;p++){ algbr((GameList[i-1].d1[p]>>8) & 0xff,GameList[i-1].d1[p] & 0xff,0); fprintf(fd," %s",mvstr[0]); } fprintf(fd,"\n"); } else { int p; for(p=0;GameList[i].d1[p] && p < 7;p++){ algbr(GameList[i].d1[p]>>8 & 0xff,GameList[i].d1[p] & 0xff,0); fprintf(fd," %s",mvstr[0]); } fprintf(fd,"\n"); } #else fprintf(fd,"\n"); #endif } } fprintf (fd, "\n\n"); if (GameList[GameCnt].flags & draw) { fprintf (fd, CP[54], DRAW); } else if (GameList[GameCnt].score == -9999) { fprintf (fd, "%s\n", ColorStr[player ]); } else if (GameList[GameCnt].score == 9998) { fprintf (fd, "%s\n", ColorStr[player ^ 1]); } fclose (fd); } void Undo (void) /* * Undo the most recent half-move. */ { SHORT f, t; f = GameList[GameCnt].gmove >> 8; t = GameList[GameCnt].gmove & 0xFF; if (board[t] == king && distance (t, f) > 1) (void) castle (GameList[GameCnt].color, f, t, 2); else { /* Check for promotion: */ if (GameList[GameCnt].flags & promote) { board[t] = pawn; } board[f] = board[t]; color[f] = color[t]; board[t] = GameList[GameCnt].piece; color[t] = GameList[GameCnt].color; if (color[t] != neutral) Mvboard[t]--; Mvboard[f]--; } if (GameList[GameCnt].flags & epmask) EnPassant (otherside[color[f]], f, t, 2); else InitializeStats (); epsquare = GameList[GameCnt].epssq; if (TCflag && (TCmoves>1)) ++TimeControl.moves[color[f]]; hashkey = GameList[GameCnt].hashkey; hashbd = GameList[GameCnt].hashbd; GameCnt--; computer = computer ^ 1; opponent = opponent ^ 1; flag.mate = false; Sdepth = 0; player = player ^ 1; ShowSidetoMove (); UpdateDisplay (0, 0, 1, 0); /* if (flag.regularstart) */ Book = BOOKFAIL; } SHORT TestSpeed (void (*f) (SHORT side, SHORT ply), unsigned j) { #ifdef test unsigned jj; #endif unsigned i; long cnt, rate, t1, t2; #ifdef HASGETTIMEOFDAY struct timeval tv; #endif #ifdef HASGETTIMEOFDAY gettimeofday(&tv,NULL); t1 = (tv.tv_sec*100+(tv.tv_usec/10000)); #else t1 = time (0); #endif for (i = 0; i < j; i++) { f (opponent, 2); #ifdef test for(jj=TrPnt[2];if, node->t, node->flags); printf ("%s %s %s %s %d %x\n", mvstr[0], mvstr[1], mvstr[2], mvstr[3],node->score,node->flags); } #endif #else ShowNodeCnt (cnt); #endif return(TrPnt[3] - TrPnt[2]); } void TestPSpeed (SHORT (*f) (SHORT side), unsigned j) { SHORT i; long cnt, rate, t1, t2; #ifdef HASGETTIMEOFDAY struct timeval tv; #endif #ifdef HASGETTIMEOFDAY gettimeofday(&tv,NULL); t1 = (tv.tv_sec*100+(tv.tv_usec/10000)); #else t1 = time (0); #endif for (i = 0; i < j; i++) { (void) f (opponent); } #ifdef HASGETTIMEOFDAY gettimeofday(&tv,NULL); t2 = (tv.tv_sec*100+(tv.tv_usec/10000)); #else t2 = time (0); #endif cnt = j; if (t2 - t1) et = (t2 - t1); else et = 1; rate = (et) ? ((cnt*100) / et) : 0; /*printz ("Nodes= %ld Nodes/sec= %ld\n", cnt, rate);*/ #ifdef NONDSP printz (CP[91], cnt, rate); #else ShowNodeCnt (cnt); #endif } void SetOppTime (CHAR *s) { CHAR *time; register int error, oldet; int m, t, sec; sec = 0; time = &s[strlen (CP[197])]; t = (int)strtol (time, &time, 10); if (*time == ':') { /* If the time does not contain a ":", it is in hundredths of a second; if it does, it is in minutes:seconds. */ time++; sec = (int)strtol(time, &time, 10); t = t*6000 + sec*100; } /* This is a little tricky because opponent's clock is running. TimeControl.clock[opponent] records the time the clock showed when we started it running, not the time it should show now. */ ElapsedTime(0); error = (t + et) - TimeControl.clock[opponent]; /* Assume our error was in deciding when to start the opponent's clock, not in the time it showed at the start. */ time0 += error; oldet = et; et -= error; m = (int)strtol (time, &time, 10); if (m) TimeControl.moves[opponent] = m; printz("otim %ld %d netlag %d %d %ld \n", TimeControl.clock[opponent], TimeControl.moves[opponent], error, oldet, et); } void SetMachineTime (CHAR *s) { CHAR *time; long tmp = 0; int m, t,sec; sec = 0; time = &s[strlen (CP[197])]; t = (int)strtol (time, &time, 10); if (*time == ':') { /* If the time does not contain a ":", it is in hundredths of a second; if it does, it is in minutes:seconds. */ time++; sec = (int)strtol(time, &time, 10); t = t*6000 + sec*100; } m = (int)strtol (time, &time, 10); if (m) TimeControl.moves[computer] = m; tmp = TimeControl.clock[computer]; TimeControl.clock[computer] = t; timecomp[compptr] += (tmp - TimeControl.clock[computer]); printz("time %ld %d netlag %ld %ld %ld\n", TimeControl.clock[computer], TimeControl.moves[computer], tmp - TimeControl.clock[computer], tmp, TimeControl.clock[computer]); } void InputCommand (void) /* * Process the users command. If easy mode is OFF (the computer is thinking * on opponents time) and the program is out of book, then make the 'hint' * move on the board and call SelectMove() to find a response. The user * terminates the search by entering ^C (quit siqnal) before entering a * command. If the opponent does not make the hint move, then set Sdepth to * zero. */ { int eof = 0; SHORT have_shown_prompt = false; SHORT ok, tmp; UTSHORT mv; CHAR s[80], sx[80]; CHAR *p, *q; #if defined CHESSTOOL SHORT normal = false; #endif ok = flag.quit = false; player = opponent; /* if transposition table is filling start it over */ ZeroTTable(1); /* clear ageing table entries */ /* if we have a move for our opponent, and we are thinking on his time, and not in force mode */ if (hint > 0 && !flag.easy && !flag.force) /* if the hint is a promotion don't do anything, we don't know what to promote to. */ if ((board[hint >> 8] != pawn) || ((row (hint & 0x3f) != 0) && (row (hint & 0x3f) != 7))) { ft = time0; fflush (stdout); /* create the hint move as string so we can do it */ algbr ((SHORT) hint >> 8, (SHORT) hint & 0x3f, false); strcpy (s, mvstr[0]); tmp = epsquare; #ifdef DEBUG12 #include "debug12.h" #endif #if !defined CHESSTOOL if (flag.post) GiveHint (); #endif /* do the hint move */ if (VerifyMove (s, 1, &mv)) { Sdepth = 0; #ifdef QUIETBACKGROUND #ifdef NONDSP PromptForMove (); #else ShowSidetoMove (); ShowPrompt (); #endif have_shown_prompt = true; #endif /* QUIETBACKGROUND */ /* would love to put null move in here */ /* after we make the hint move make a 2 ply search with both plys our moves */ /* think on opponents time */ SelectMove (computer, 2); /* undo the hint and carry on */ VerifyMove (s, 2, &mv); Sdepth = 0; } epsquare = tmp; time0 = ft; } while (!(ok || flag.quit)) { #if defined CHESSTOOL normal = false; #endif player = opponent; #ifdef QUIETBACKGROUND if (!have_shown_prompt) { #endif /* QUIETBACKGROUND */ #ifdef NONDSP PromptForMove (); #else ShowSidetoMove (); ShowPrompt (); #endif #ifdef QUIETBACKGROUND } have_shown_prompt = false; #endif /* QUIETBACKGROUND */ #ifdef NONDSP s[0] = sx[0] = '\0'; while (!sx[0]) (void) gets (sx); #else fflush (stdout); #ifdef MSDOS s[0] = '\0'; eof = ( gets (sx) == NULL ); #else eof = ( getstr (sx) == ERR ); #endif #endif sscanf (sx, "%s", s); if (eof) ExitChess (); if (s[0] == '\0') continue; if(s[0] == '!') printf("%s\n",sx); else if (strcmp (s, CP[131]) == 0) /*bd*/ { #if defined CHESSTOOL || defined XBOARD chesstool = 0; #endif /* CHESSTOOL */ ClrScreen (); UpdateDisplay (0, 0, 1, 0); #if defined CHESSTOOL || defined XBOARD chesstool = 1; #endif /* CHESSTOOL */ } else if (strcmp (s, CP[129]) == 0) /* noop */ ; /*alg*/ else if ((strcmp (s, CP[180]) == 0) || (strcmp (s, CP[216]) == 0)) /* quit exit*/ flag.quit = true; else if (strcmp (s, CP[178]) == 0) /*post*/ { flag.post = true; } else if (strcmp (s, CP[19]) == 0) /*nopost*/ { flag.post = false; } else if ((strcmp (s, CP[191]) == 0) || (strcmp (s, CP[154]) == 0)) /*set edit*/ EditBoard (); #ifdef NONDSP else if (strcmp (s, CP[190]) == 0) /*setup*/ SetupBoard (); #endif else if (strcmp (s, CP[156]) == 0) /*first*/ { #if defined CHESSTOOL computer = white; opponent = black; flag.force = false; Sdepth = 0; #endif /* CHESSTOOL */ ok = true; } else if (strcmp (s, CP[162]) == 0) /*go*/ { ok = true; flag.force = false; if (computer == white) { computer = black; opponent = white; } else { computer = white; opponent = black; } } else if (strcmp (s, CP[166]) == 0) /*help*/ help (); else if (strcmp (s, CP[221]) == 0) /*material*/ flag.material = !flag.material; else if (strcmp (s, CP[157]) == 0) /*force*/ {flag.force = !flag.force; flag.bothsides = false;} else if (strcmp (s, CP[134]) == 0) /*book*/ Book = Book ? 0 : BOOKFAIL; else if (strcmp (s, CP[172]) == 0) /*new*/ { NewGame (); #ifdef XBOARD /* Make this work the old way for compatibility */ flag.beep = true; dither = 0; flag.easy = true; #endif XBOARD UpdateDisplay (0, 0, 1, 0); } else if (strcmp (s, CP[171]) == 0) /*list*/ ListGame (); else if (strcmp (s, CP[169]) == 0 || strcmp (s, CP[217]) == 0) /*level clock*/ SelectLevel (sx); else if (strcmp (s, CP[165]) == 0) /*hash*/ flag.hash = !flag.hash; else if (strcmp (s, CP[18]) == 0) /*cache*/ flag.cache = !flag.cache; else if (strcmp (s, CP[227]) == 0) /*gamein*/ flag.gamein = !flag.gamein; else if (strcmp (s, CP[226]) == 0) /*beep*/ flag.beep = !flag.beep; else if (strcmp (s, CP[197]) == 0) /*time*/ { SetMachineTime (sx); } else if (strcmp (s, CP[228]) == 0) /*time*/ { SetOppTime (sx); } else if (strcmp (s, CP[33]) == 0) /*Awindow*/ ChangeAlphaWindow (); else if (strcmp (s, CP[39]) == 0) /*Bwindow*/ ChangeBetaWindow (); else if (strcmp (s, CP[183]) == 0) /*rcptr*/ flag.rcptr = !flag.rcptr; else if (strcmp (s, CP[168]) == 0) /*hint*/ GiveHint (); else if (strcmp (s, CP[135]) == 0) /*both*/ { flag.bothsides = !flag.bothsides; flag.force = false; Sdepth = 0; ElapsedTime (1); SelectMove (opponent, 1); ok = true; } else if (strcmp (s, CP[185]) == 0) /*reverse*/ { flag.reverse = !flag.reverse; ClrScreen (); UpdateDisplay (0, 0, 1, 0); } else if (strcmp (s, CP[195]) == 0) /*switch*/ { computer = computer ^ 1; opponent = opponent ^ 1; xwndw = (computer == white) ? WXWNDW : BXWNDW; flag.force = false; Sdepth = 0; ok = true; } else if (strcmp (s, CP[203]) == 0) /*white*/ { computer = black; opponent = white; xwndw = WXWNDW; flag.force = false; Sdepth = 0; /* * ok = true; don't automatically start with white command */ } else if (strcmp (s, CP[133]) == 0) /*black*/ { computer = white; opponent = black; xwndw = BXWNDW; flag.force = false; Sdepth = 0; /* * ok = true; don't automatically start with black command */ } else if (strcmp (s, CP[201]) == 0 && GameCnt > 0) /*undo*/ { Undo (); } else if (strcmp (s, CP[184]) == 0 && GameCnt > 1) /*remove*/ { Undo (); Undo (); } else if (strcmp (s, CP[160]) == 0) /*get*/ GetGame (); else if (strcmp (s, CP[207]) == 0) /*xget*/ GetXGame (); else if (strcmp (s, CP[189]) == 0) /*save*/ SaveGame (); else if (strcmp (s, CP[151]) == 0) /*depth*/ ChangeSearchDepth (); #ifdef DEBUG else if (strcmp (s, CP[147]) == 0) /*debuglevel*/ ChangeDbLev (); #endif /* DEBUG */ else if (strcmp (s, CP[164]) == 0) /*hashdepth*/ ChangeHashDepth (); else if (strcmp (s, CP[182]) == 0) /*random*/ dither = (dither)?0:DITHER; else if (strcmp (s, "threat") == 0) /*threat*/ flag.threat = !flag.threat; /* tom@izf.tno.nl */ else if (strcmp (s, "null") == 0) /*null*/ flag.nonull = !flag.nonull; /* tom@izf.tno.nl */ else if (strcmp (s, "pvs") == 0) /*PVS*/ flag.pvs = !flag.pvs; /* tom@izf.tno.nl */ else if (strcmp (s, "noscore") == 0) /*noscore*/ flag.noscore = !flag.noscore; /* tom@izf.tno.nl */ else if (strcmp (s, "eval") == 0) /*new eval*/ flag.neweval = !flag.neweval; /* tom@izf.tno.nl */ else if (strcmp (s, "deepnull") == 0) /*deepnull*/ flag.deepnull = !flag.deepnull; /* tom@izf.tno.nl */ else if (strcmp (s, "verydeep") == 0) /*verydeep*/ flag.verydeep = !flag.verydeep; /* tom@izf.tno.nl */ else if (strcmp (s, CP[229]) == 0) /*hard*/ flag.easy = false; else if (strcmp (s, CP[152]) == 0) /*easy*/ flag.easy = !flag.easy; else if (strcmp (s, CP[143]) == 0) /*contempt*/ SetContempt (); else if (strcmp (s, CP[209]) == 0) /*xwndw*/ ChangeXwindow (); else if (strcmp (s, CP[186]) == 0) /*rv*/ { flag.rv = !flag.rv; UpdateDisplay (0, 0, 1, 0); } else if (strcmp (s, CP[145]) == 0) /*coords*/ { flag.coords = !flag.coords; UpdateDisplay (0, 0, 1, 0); } else if (strcmp (s, CP[193]) == 0) /*stars*/ { flag.stars = !flag.stars; UpdateDisplay (0, 0, 1, 0); } #ifdef DEBUG else if (strcmp (s, CP[196]) == 0) /*test*/ { SHORT cnt; ShowMessage (CP[108]);/*test movelist*/ cnt = TestSpeed (MoveList, 20000); printf("moves = %d\n",cnt); ShowMessage (CP[107]);/*test capturelist*/ cnt = TestSpeed (CaptureList, 30000); printf("moves = %d\n",cnt); ShowMessage (CP[85]);/*test score position*/ TestPSpeed (ScorePosition, 15000); } else if (strcmp (s, CP[179]) == 0) /*p*/ ShowPostnValues (); else if (strcmp (s, CP[148]) == 0) /*debug*/ DoDebug (); else if (strcmp (s, "Mwpawn") == 0) /*debug*/ DoTable (Mwpawn); else if (strcmp (s, "Mbpawn") == 0) /*debug*/ DoTable (Mbpawn); else if (strcmp (s, "Mwknight") == 0) /*debug*/ DoTable (Mknight[white]); else if (strcmp (s, "Mbknight") == 0) /*debug*/ DoTable (Mknight[black]); else if (strcmp (s, "Mwbishop") == 0) /*debug*/ DoTable (Mbishop[white]); else if (strcmp (s, "Mbbishop") == 0) /*debug*/ DoTable (Mbishop[black]); #endif else { /* It must be a move */ /* preprocess move; remove x or + change promotion from h1=Q to h1q */ p=s; q=sx; while (*p != '\0'){ if(*p == 'x' || *p == '+') p++; else if(*p == '='){ p++; *q = tolower(*p); p++; q++;} else {*q++ = *p++; } } *q = '\0'; #if defined CHESSTOOL normal = (ok = VerifyMove (sx, 0, &mv)); #else ok = VerifyMove (sx, 0, &mv); #endif Sdepth = 0; } } ElapsedTime (1); if (flag.force) { computer = opponent; opponent = computer ^ 1; } #if defined CHESSTOOL || defined XBOARD #if defined CHESSTOOL if (normal) if (computer == black) printz ("%d. %s\n", ++mycnt2, s); else printz ("%d. ... %s\n", ++mycnt2, s); #else printz ("%d. %s\n", ++mycnt2, s); #endif #ifdef notdef /* optional pass best line to frontend with move */ if (flag.post) { register int i; printz (" %6d ", MSCORE); for (i = 1; MV[i] > 0; i++) { algbr ((SHORT) (MV[i] >> 8), (SHORT) (MV[i] & 0xFF), false); printz ("%5s ", mvstr[0]); } } printz ("\n"); #endif #endif /* CHESSTOOL */ #if !defined CHESSTOOL signal (SIGINT, TerminateSearch); #endif #ifndef MSDOS signal (SIGQUIT, TerminateSearch); #endif /* MSDOS */ } #ifdef HASGETTIMEOFDAY void ElapsedTime (SHORT iop) /* * Determine the time that has passed since the search was started. If the * elapsed time exceeds the target (ResponseTime+ExtraTime) then set timeout * to true which will terminate the search. iop = 0 calculate et bump ETnodes * iop = 1 calculate et set timeout if time exceeded, calculate et */ { struct timeval tv; #ifndef MSDOS int nchar; extern int errno; int i; #ifdef FIONREAD if (i = ioctl ((int) 0, FIONREAD, &nchar)) { perror ("FIONREAD"); fprintf (stderr, "You probably have a non-ANSI ; see README. %d %d %x\n", i, errno, FIONREAD); exit (1); } if (nchar) { if (!flag.timeout) flag.back = true; flag.bothsides = false; } #endif /*FIONREAD*/ #else if (kbhit ()) { if (!flag.timeout) flag.back = true; flag.bothsides = false; } #endif /* MSDOS */ gettimeofday(&tv,NULL); et = (tv.tv_sec*100+(tv.tv_usec/10000)) - time0; ETnodes = NodeCnt + ZNODES; if (et < 0) et = 0; if (iop == 1) { if (et > ResponseTime + ExtraTime && Sdepth > MINDEPTH) flag.timeout = true; ETnodes = NodeCnt + ZNODES; gettimeofday(&tv,NULL); time0 = tv.tv_sec*100+tv.tv_usec/10000; } #if !defined NONDSP #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ UpdateClocks (); #endif #if defined(Think_C) && defined(Window_Events) check_events(); #endif } #else void ElapsedTime (SHORT iop) /* * Determine the time that has passed since the search was started. If the * elapsed time exceeds the target (ResponseTime+ExtraTime) then set timeout * to true which will terminate the search. iop = 0 calculate et bump ETnodes * iop = 1 calculate et set timeout if time exceeded, calculate et */ { #ifndef MSDOS int nchar; extern int errno; int i; #ifdef FIONREAD if (i = ioctl ((int) 0, FIONREAD, &nchar)) { perror ("FIONREAD"); fprintf (stderr, "You probably have a non-ANSI ; see README. %d %d %x\n", i, errno, FIONREAD); exit (1); } if (nchar) { if (!flag.timeout) flag.back = true; flag.bothsides = false; } #endif /*FIONREAD*/ #else if (kbhit ()) { if (!flag.timeout) flag.back = true; flag.bothsides = false; } #endif /* MSDOS */ et = (time ((time_t *) 0) - time0) * 100; ETnodes = NodeCnt + ZNODES; if (et < 0) et = 0; if (iop == 1) { if (et > ResponseTime + ExtraTime && Sdepth > MINDEPTH) flag.timeout = true; ETnodes = NodeCnt + ZNODES; time0 = time ((time_t *) 0); } #if !defined NONDSP #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ UpdateClocks (); #endif #if defined(Think_C) && defined(Window_Events) check_events(); #endif } #endif static SHORT Nmoves[] = NMOVEINIT; void SetTimeControl (void) { flag.gamein = TCflag = false; TimeControl.moves[white] = TimeControl.moves[black] = 0; if (XC){ if (XCmore < XC) { TCmoves = XCmoves[XCmore]; TCminutes = XCminutes[XCmore]; TCseconds = XCseconds[XCmore]; TCadd = XCadd[XCmore]; XCmore++; } if((TCminutes+TCseconds) == 0){TCflag = false;} else { TCflag = true; if(TCmoves == 0) {int i; i = (TCminutes*60+TCseconds + 40 * (TCadd/100))/60; if(i > NMOVELIMIT) i = NMOVELIMIT; TCmoves = Nmoves[i]; flag.gamein = true;} else flag.gamein = false; TimeControl.moves[white] = TimeControl.moves[black] = TCmoves; TimeControl.clock[white] += 6000L * TCminutes + TCseconds * 100; TimeControl.clock[black] += 6000L * TCminutes + TCseconds * 100; } } flag.onemove = (TCmoves == 1); et = 0; ElapsedTime (1); } gnuchess-4.0.pl70/src/eval.c100444 21542 13 145670 5563700645 14742 0ustar cracraftuser/* * eval.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" #include "ataks.h" #include "ttable.h" /* uses hashbd, hashkey and eval cache*/ int PUTVAR = false; SHORT sscore[2]; #ifdef CACHE struct etable *etab[2]; #endif /* Backward pawn bonus indexed by # of attackers on the square */ static const SHORT BACKWARD[16] = {-6, -10, -15, -21, -28, -28, -28, -28, -28, -28, -28, -28, -28, -28, -28, -28}; /* Bishop mobility bonus indexed by # reachable squares */ static const SHORT BMBLTY[14] = {-2, 0, 2, 4, 6, 8, 10, 12, 13, 14, 15, 16, 16, 16}; /* Rook mobility bonus indexed by # reachable squares */ static const SHORT RMBLTY[15] = {0, 2, 4, 6, 8, 10, 11, 12, 13, 14, 14, 14, 14, 14, 14}; /* Positional values for a dying king */ static const SHORT DyingKing[64] = {0, 8, 16, 24, 24, 16, 8, 0, 8, 32, 40, 48, 48, 40, 32, 8, 16, 40, 56, 64, 64, 56, 40, 16, 24, 48, 64, 72, 72, 64, 48, 24, 24, 48, 64, 72, 72, 64, 48, 24, 16, 40, 56, 64, 64, 56, 40, 16, 8, 32, 40, 48, 48, 40, 32, 8, 0, 8, 16, 24, 24, 16, 8, 0}; /* Isoloted pawn penalty by rank */ static const SHORT ISOLANI[8] = {-12, -16, -20, -24, -24, -20, -16, -12}; /* table for King Bishop Knight endings */ static const SHORT KBNK[64] = {620, 560, 500, 440, 380, 320, 260, 240, 560, 520, 460, 400, 340, 280, 230, 260, 500, 460, 320, 280, 260, 220, 280, 320, 440, 400, 280, 200, 200, 260, 340, 380, 380, 340, 260, 200, 200, 280, 400, 440, 320, 280, 220, 260, 280, 320, 460, 500, 260, 230, 280, 340, 400, 460, 520, 560, 240, 260, 320, 380, 440, 500, 560, 620}; /* {99, 90, 80, 70, 60, 50, 40, 40, 90, 80, 60, 50, 40, 30, 20, 40, 80, 60, 40, 30, 20, 10, 30, 50, 70, 50, 30, 10, 0, 20, 40, 60, 60, 40, 20, 0, 10, 30, 50, 70, 50, 30, 10, 20, 30, 40, 60, 80, 40, 20, 30, 40, 50, 60, 80, 90, 40, 40, 50, 60, 70, 80, 90, 99}; */ /* penalty for threats to king, indexed by number of such threats */ static const SHORT KTHRT[36] = {0, -8, -20, -36, -52, -68, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80, -80}; /* King positional bonus inopening stage */ static const SHORT KingOpening[64] = {0, 0, -4, -10, -10, -4, 0, 0, -4, -4, -8, -12, -12, -8, -4, -4, -12, -16, -20, -20, -20, -20, -16, -12, -16, -20, -24, -24, -24, -24, -20, -16, -16, -20, -24, -24, -24, -24, -20, -16, -12, -16, -20, -20, -20, -20, -16, -12, -4, -4, -8, -12, -12, -8, -4, -4, 0, 0, -4, -10, -10, -4, 0, 0}; /* King positional bonus in end stage */ static const SHORT KingEnding[64] = {0, 6, 12, 18, 18, 12, 6, 0, 6, 12, 18, 24, 24, 18, 12, 6, 12, 18, 24, 30, 30, 24, 18, 12, 18, 24, 30, 36, 36, 30, 24, 18, 18, 24, 30, 36, 36, 30, 24, 18, 12, 18, 24, 30, 30, 24, 18, 12, 6, 12, 18, 24, 24, 18, 12, 6, 0, 6, 12, 18, 18, 12, 6, 0}; /* Passed pawn positional bonus */ static const SHORT PassedPawn0[8] = {0, 60, 80, 120, 200, 360, 600, 800}; static const SHORT PassedPawn1[8] = {0, 30, 40, 60, 100, 180, 300, 800}; static const SHORT PassedPawn2[8] = {0, 15, 25, 35, 50, 90, 140, 800}; static const SHORT PassedPawn3[8] = {0, 5, 10, 15, 20, 30, 140, 800}; /* Knight positional bonus */ static const SHORT pknight[64] = {0, 4, 8, 10, 10, 8, 4, 0, 4, 8, 16, 20, 20, 16, 8, 4, 8, 16, 24, 28, 28, 24, 16, 8, 10, 20, 28, 32, 32, 28, 20, 10, 10, 20, 28, 32, 32, 28, 20, 10, 8, 16, 24, 28, 28, 24, 16, 8, 4, 8, 16, 20, 20, 16, 8, 4, 0, 4, 8, 10, 10, 8, 4, 0}; /* Bishop positional bonus */ static const SHORT pbishop[64] = {14, 14, 14, 14, 14, 14, 14, 14, 14, 22, 18, 18, 18, 18, 22, 14, 14, 18, 22, 22, 22, 22, 18, 14, 14, 18, 22, 22, 22, 22, 18, 14, 14, 18, 22, 22, 22, 22, 18, 14, 14, 18, 22, 22, 22, 22, 18, 14, 14, 22, 18, 18, 18, 18, 22, 14, 14, 14, 14, 14, 14, 14, 14, 14}; /* Pawn positional bonus */ static const SHORT PawnAdvance[64] = {0, 0, 0, 0, 0, 0, 0, 0, 4, 4, 4, 0, 0, 4, 4, 4, 6, 8, 2, 10, 10, 2, 8, 6, 6, 8, 12, 16, 16, 12, 8, 6, 8, 12, 16, 24, 24, 16, 12, 8, 12, 16, 24, 32, 32, 24, 16, 12, 12, 16, 24, 32, 32, 24, 16, 12, 0, 0, 0, 0, 0, 0, 0, 0}; #define AHOPEN (-200) SHORT Mwpawn[64], Mbpawn[64], Mknight[2][64], Mbishop[2][64]; static SHORT Mking[2][64], Kfield[2][64]; static SHORT c1, c2, *atk1, *atk2, *PC1, *PC2, atak[2][64]; SHORT emtl[2]; static SHORT PawnBonus, BishopBonus, RookBonus; static SHORT KNIGHTPOST, KNIGHTSTRONG, BISHOPSTRONG, KATAK; static SHORT PEDRNK2B, PWEAKH, PADVNCM, PADVNCI, PAWNSHIELD, PDOUBLED, PBLOK; static SHORT RHOPN, RHOPNX, KHOPN, KHOPNX, KSFTY; static SHORT ATAKD, HUNGP, HUNGX, KCASTLD, KMOVD, XRAY, PINVAL; SHORT pscore[2]; SHORT tmtl; /************************* Evaluation cache code ****************************/ /* NOTE: The static evaluation cache "EETable" belongs to eval.c and cannot /* be moved to ttable.c */ #ifdef CACHE struct etable *etab[2]; inline void PutInEETable (SHORT side,int score) /* * Store the current eval position in the transposition table. */ { register struct etable *ptbl; if(!flag.cache) return; ptbl = &((etab[side])[hashkey % (ETABLE)]); ptbl->ehashbd = hashbd; ptbl->escore[white] = pscore[white]; ptbl->escore[black] = pscore[black]; ptbl->hung[white] = hung[white]; ptbl->hung[black] = hung[black]; ptbl->score = score; #ifndef AMIGADOS memcpy ( &(ptbl->sscore), svalue, sizeof (svalue)); #else memcpy (ptbl->sscore, svalue, sizeof (svalue)); #endif #if defined HASHSTATS EADD++; #endif return; } inline int CheckEETable (SHORT side) /* Get an evaluation from the transposition table */ { register struct etable *ptbl; if(!flag.cache)return false; ptbl = &((etab[side])[hashkey % (ETABLE)]); if (hashbd == ptbl->ehashbd) return true; return false; } inline int ProbeEETable (SHORT side, SHORT *score) /* Get an evaluation from the transposition table */ { register struct etable *ptbl; if(!flag.cache)return false; ptbl = &((etab[side])[hashkey % (ETABLE)]); if (hashbd == ptbl->ehashbd) { pscore[white] = ptbl->escore[white]; pscore[black] = ptbl->escore[black]; #ifndef AMIGADOS memcpy (svalue, &(ptbl->sscore), sizeof (svalue)); #else memcpy (svalue, ptbl->sscore, sizeof (svalue)); #endif *score = ptbl->score; hung[white] = ptbl->hung[white]; hung[black] = ptbl->hung[black]; #if defined HASHSTATS EGET++; #endif return true; } return false; } #else /* Define null stubs for the above procedures */ #define PutInEETable(side, score) #define ProbeEETable(side, score) (false) #define CheckEETable(side) (false) #endif /* CACHE */ /* ............ POSITIONAL EVALUATION ROUTINES ............ */ /* * Inputs are: * pmtl[side] - value of pawns * mtl[side] - value of all material * emtl[side] - vaule of all material - value of pawns - value of king * hung[side] - count of hung pieces * Tscore[ply] - search tree score for ply * ply * Pscore[ply] - positional score for ply ply * INCscore - bonus score or penalty for certain positions * slk - single lone king flag * Sdepth - search goal depth * xwndw - evaluation window about alpha/beta * EWNDW - second evaluation window about alpha/beta * ChkFlag[ply]- checking piece at level ply or 0 if no check * PC1[column] - # of my pawns in this column * PC2[column] - # of opponents pawns in column * PieceCnt[side] - just what it says */ inline int ScoreKPK (SHORT side, SHORT winner, SHORT loser, SHORT king1, register SHORT king2, register SHORT sq) /* * Score King and Pawns versus King endings. */ { register SHORT s, r; s = ((PieceCnt[winner] == 1) ? 50 : 120); if (winner == white) { r = row (sq) - ((side == loser) ? 1 : 0); if (row (king2) >= r && distance (sq, king2) < 8 - r) s += 10 * row (sq); else s = 500 + 50 * row (sq); if (row (sq) < 6) sq += 16; else if (row (sq) == 6) sq += 8; } else { r = row (sq) + ((side == loser) ? 1 : 0); if (row (king2) <= r && distance (sq, king2) < r + 1) s += 10 * (7 - row (sq)); else s = 500 + 50 * (7 - row (sq)); if (row (sq) > 1) sq -= 16; else if (row (sq) == 1) sq -= 8; } s += 8 * (taxicab (king2, sq) - taxicab (king1, sq)); return (s); } #ifndef PRE4PL67 /* this is the new 4pl68 code // I am told it is WORSE than the #else clause which // is based on old 4pl64 code */ static SHORT kpkwv_ (SHORT pf, SHORT pr, SHORT wf, SHORT wr, SHORT bf, SHORT br) { /* * Don Beal's routine, which was originally in Fortran. See AICC 2 */ static SHORT wbdd, mbpf, nbpf, blpu; SHORT dist_ (SHORT, SHORT, SHORT, SHORT); static SHORT brpu, mwpf, wlpu, wrpu, blpuu, brpuu, wlpuu, wrpuu, md, bq, blpuuu, brpuuu, bsd, tbf, sgf, bpp, sdr, sgr, wsd, wsg, ppr, wpp; ppr = ((pr == 2)?3:pr); if (pf == 1) { if (bf == 3) { if (pr == 7 && wf == 1 && wr == 8 && br > 6) return(0); if (pr == 6 && wf < 4 && wr == 6 && br == 8) return(1); } if (bf == 1 && br > pr) return(0); if (pr == 7 && bf > 2) return(1); if (bf <= 3 && br - ppr > 1) return(0); if (wf == 1 && bf == 3 && wr - pr == 1 && br - pr == 1) return(0); } bq = dist_ (bf, br, pf, 8); if (bq > 8 - ppr) return(1); mbpf = bf - pf; if (mbpf < 0) mbpf = -mbpf; bpp = dist_ (bf, br, pf, ppr); wpp = dist_ (wf, wr, pf, ppr); if (bpp - wpp < -1 && br - pr != mbpf) return(0); if (pf == 1 && pr <= 3 && wf <= 2 && wr == 8 && bf == 4 && br >= 7) return(1); if (!(pf != 2 || pr != 6 || bf != 1 || br != 8)) { if (wf <= 3 && wr == 6) return(0); if (wf == 4 && wr == 8) return(0); } if (pr == 7) { if (wr < 8 && wpp == 2 && bq == 0) return(1); if (wr == 6 && wf == pf && bq == 0) return(1); if (wr >= 6 && wpp <= 2 && bq != 0) return(1); } blpuu = dist_ (bf, br, pf - 1, pr + 2); wbdd = dist_ (wf, wr, bf, br - 2); brpuu = dist_ (bf, br, pf + 1, pr + 2); if (pr == 6) { if (dist_ (bf, br, pf + 1, pr) > 1 && brpuu > dist_ (wf, wr, pf + 1, pr)) return(1); if (pf != 1) { if (blpuu > dist_ (wf, wr, pf - 1, pr)) return(1); if (br == 8 && mbpf == 1 && wbdd == 1) return(1); if (br > 6 && nbpf == 2 && dist_ (wf, wr, bf, 5) <= 1) return(1); } else if (wf == 1 && wr == 8 && bf == 2 && br == 6) return(0); } mwpf = wf - pf; if (mwpf < 0) mwpf = -mwpf; if (pr >= 5 && mwpf == 2 && wr == pr && bf == wf && br - pr == 2) return(1); brpu = dist_ (bf, br, pf + 1, pr + 1); wrpu = dist_ (wf, wr, pf + 1, pr + 1); blpu = dist_ (bf, br, pf - 1, pr + 1); wlpu = dist_ (wf, wr, pf - 1, pr + 1); if (!(pf == 1 || pr != 5)) { if (mwpf <= 1 && wr - pr == 1) return(1); if (wrpu == 1 && brpu > 1) return(1); if (wr >= 4 && bf == wf && br - pr >= 2 && mbpf == 3) return(1); if (wlpu == 1 && blpu > 1) return(1); } if (pr == 2 && br == 3 && mbpf > 1 && dist_ (wf, wr, bf, br + 2) <= 1) return(1); if (wr - pr == 2 && br == pr && mbpf == 1 && mwpf > 1 && (wf - pf) * (bf - pf) > 0) return(0); if (pf == 1 && wf == 1 && wr == br && bf > 3) return(1); sgf = pf - 1; if (wf >= pf) { sgf = pf + 1; } sgr = wr - (mwpf - 1); if (mwpf == 0 && wr > br) sgr = wr - 1; wsg = dist_ (wf, wr, sgf, sgr); if (wr - pr - mwpf > 0 && wr - br >= -1 && bpp - (wsg + (sgr - ppr)) >= -1 && dist_ (bf, br, sgf, sgr) > wsg) return(1); md = mbpf - mwpf; if (!(pf != 1 || bf <= 3)) { sdr = br + (bf - 3); if (sdr > 8) sdr = 8; if (wr > br + 1) sdr = br; if (sdr > ppr) { wsd = dist_ (wf, wr, 3, sdr); bsd = dist_ (bf, br, 3, sdr); if (bsd - wsd < -1) return(0); if (bsd <= wsd && md <= 0) return(0); } } brpuuu = dist_ (bf, br, pf + 1, pr + 3); if (brpu > wrpu && brpuuu > wrpu && pr - wr != pf - wf) return(1); if (brpuuu == 0 && wrpu == 1) return(1); blpuuu = dist_ (bf, br, pf - 1, pr + 3); if (pf != 1) { if (blpu > wlpu && blpuuu > wlpu && pr - wr != wf - pf) return(1); if (blpuuu == 0 && wlpu == 1) return(1); } wrpuu = dist_ (wf, wr, pf + 1, pr + 2); if (brpuu > wrpuu) return(1); wlpuu = dist_ (wf, wr, pf - 1, pr + 2); if (pf > 1 && blpuu > wlpuu) return(1); if (br == pr) { if (mwpf <= 2 && wr - pr == -1 && mbpf != 2) return(1); if (dist_ (wf, wr, bf - 1, br + 2) <= 1 && bf - pf > 1) return(1); if (dist_ (wf, wr, bf + 1, br + 2) <= 1 && bf - pf < -1) return(1); } if (pf != 1) { if (br == pr && mbpf > 1 && dist_ (wf, wr, pf, pr - 1) <= 1) return(1); if (br - pr >= 3 && wbdd == 1) return(1); if (wr - pr >= 2 && wr < br && md >= 0) return(1); if (mwpf <= 2 && wr - pr >= 3 && bf != pf && wr - br <= 1) return(1); if (wr >= pr && br - pr >= 5 && mbpf >= 3 && md >= -1 && ppr == 3) return(1); if (md >= -1 && pr == 2 && br == 8) return(1); } tbf = bf - 1; if (pf > bf) tbf = bf + 1; if (mbpf > 1 && br == ppr && dist_ (wf, wr, tbf, wr + 2) <= 1) return(1); if (br == pr && bf - pf == -2 && dist_ (wf, wr, pf + 2, pr - 1) <= 1) return(1); if (pf > 2 && br == pr && bf - pf == 2 && dist_ (wf, wr, pf - 2, pr - 1) <= 1) return(1); return(0); } /* kpkwv_ */ static SHORT kpkbv_ (SHORT pf, SHORT pr, SHORT wf, SHORT wr, SHORT bf, SHORT br) { static SHORT incf[8] = {0, 1, 1, 1, 0, -1, -1, -1}; static SHORT incr[8] = {1, 1, 0, -1, -1, -1, 0, 1}; SHORT dist_ (SHORT, SHORT, SHORT, SHORT); SHORT kpkwv_ (SHORT, SHORT, SHORT, SHORT, SHORT, SHORT); static SHORT i, nm, nbf, nbr; nm = 0; for (i = 0; i < 8; ++i) { nbf = bf + incf[i]; if (nbf < 1 || nbf > 8) continue; nbr = br + incr[i]; if (nbr < 1 || nbr > 8) continue; if (dist_ (nbf, nbr, wf, wr) < 2) continue; if (nbf == pf && nbr == pr) return(0); if (nbr == pr + 1 && (nbf == pf - 1 || nbf == pf + 1)) continue; ++nm; if (kpkwv_ (pf, pr, wf, wr, nbf, nbr) == 0) return(0); } if (nm > 0) return(-1); return(0); } /* kpkbv_ */ SHORT dist_ (SHORT f1, SHORT r1, SHORT f2, SHORT r2) { static SHORT fd, rd; fd = f2 - f1; if (fd < 0) fd = -fd; rd = r2 - r1; if (rd < 0) rd = -rd; return(rd > fd ? rd : fd); } /* dist_ */ inline int ScoreK1PK (SHORT side, SHORT winner, SHORT loser, SHORT king1, register SHORT king2, register SHORT sq) /* * We call Don Beal's routine with the necessary parameters and determine * win/draw/loss. Then we compute the real evaluation which is +-500 for * a win/loss and 10 for a draw, plus some points to lead the computer to * a decisive winning/drawing line. */ { #ifdef WAY4PL64 SHORT s; #endif SHORT win, sqc, sqr, k1c, k1r, k2c, k2r; const int drawn = 10, won = 500; #ifdef WAY4PL64 #ifdef CACHE if (ProbeEETable(side,&s)) return s; #endif #endif sqc = column (sq) + 1; sqr = row (sq) + 1; k1c = column (king1) + 1; k1r = row (king1) + 1; k2c = column (king2) + 1; k2r = row (king2) + 1; if (winner == black) { sqr = 9 - sqr; k1r = 9 - k1r; k2r = 9 - k2r; } if (sqc > 4) { sqc = 9 - sqc; k1c = 9 - k1c; k2c = 9 - k2c; } if (side == winner) win = kpkwv_ (sqc, sqr, k1c, k1r, k2c, k2r); else win = kpkbv_ (sqc, sqr, k1c, k1r, k2c, k2r); #ifdef WAY4PL64 if (!win) s = drawn + 5 * distance (sq, king2) - 5*distance(king1,king2); else s = won + 50 * (sqr - 2) + 10*distance(sq,king2); #else if (!win) return drawn + 5 * distance (sq, king2); else return won + 50 * (sqr - 2); #endif #ifdef WAY4PL64 #ifdef CACHE if (PUTVAR) PutInEETable (side, s); #endif return s; #endif } #ifdef notdef inline int ScoreK1PK (SHORT side, SHORT winner, SHORT loser, SHORT king1, register SHORT king2, register SHORT sq) /* * We call Don Beal's routine with the necessary parameters and determine * win/draw/loss. Then we compute the real evaluation which is +-500 for * a win/loss and 10 for a draw, plus some points to lead the computer to * a decisive winning/drawing line. */ { SHORT win, sqc, sqr, k1c, k1r, k2c, k2r; const int drawn = 10, won = 500; #ifdef CACHE if (ProbeEETable(side,&sqc)) return sqc; #endif /* CACHE */ sqc = column (sq) + 1; sqr = row (sq) + 1; k1c = column (king1) + 1; k1r = row (king1) + 1; k2c = column (king2) + 1; k2r = row (king2) + 1; if (winner == black) { sqr = 9 - sqr; k1r = 9 - k1r; k2r = 9 - k2r; } if (sqc > 4) { sqc = 9 - sqc; k1c = 9 - k1c; k2c = 9 - k2c; } if (side == winner) win = kpkwv_ (sqc, sqr, k1c, k1r, k2c, k2r); else win = kpkbv_ (sqc, sqr, k1c, k1r, k2c, k2r); if (!win) sqc = drawn + 5 * distance (sq, king2); else sqc = won + 50 * (sqr - 2); #ifdef CACHE if (PUTVAR) PutInEETable (side, s); #endif /* CACHE */ return sqc; } #endif inline int ScoreKBNK (SHORT winner, SHORT king1, SHORT king2) /* * Score King+Bishop+Knight versus King endings. Works fine now. */ { register SHORT s, Bsq, Nsq, KBNKsq = 0; if (board[PieceList[winner][1]] == bishop) { Bsq = PieceList[winner][1]; Nsq = PieceList[winner][2]; } else { Bsq = PieceList[winner][2]; Nsq = PieceList[winner][1]; } KBNKsq = (((row (Bsq) % 2) == (column (Bsq) % 2)) ? 0 : 7); s = emtl[winner] - 300; s += ((KBNKsq == 0) ? KBNK[king2] : KBNK[locn (row (king2), 7 - column (king2))]); s -= (8*taxicab(king1,king2) + 2*distance(Nsq,king2) + distance(Bsq,king2)); s += KingEnding[king1]; return (s); } #ifdef notdef inline int ScoreKBNK (SHORT winner, SHORT king1, SHORT king2) /* * Score King+Bishop+Knight versus King endings. This doesn't work all that * well but it's better than nothing. */ { register SHORT s, sq, KBNKsq = 0; for (sq = 0; sq < 64; sq++) if (board[sq] == bishop) KBNKsq = (((row (sq) % 2) == (column (sq) % 2)) ? 0 : 7); s = emtl[winner] - 300; s += ((KBNKsq == 0) ? KBNK[king2] : KBNK[locn (row (king2), 7 - column (king2))]); s -= ((taxicab (king1, king2) + distance (PieceList[winner][1], king2) + distance (PieceList[winner][2], king2))); return (s); } #endif inline SHORT ScoreLoneKing (SHORT side) /* * Static evaluation when loser has only a king and winner has no pawns or no * pieces. */ { register SHORT winner, loser, king1, king2, s, i; if (mtl[white] == valueK && mtl[black] == valueK) return 0; UpdateWeights (); winner = ((mtl[white] > mtl[black]) ? white : black); loser = winner ^ 1; king1 = PieceList[winner][0]; king2 = PieceList[loser][0]; s = 0; if (pmtl[winner] == 0) { if (emtl[winner] == valueB + valueN) s = ScoreKBNK (winner, king1, king2); else if (emtl[winner] == valueN + valueN) s = 0; else if (emtl[winner] < valueR) s = 0; else s = 500 + emtl[winner] - DyingKing[king2] - 2 * distance (king1, king2); } else { if (pmtl[winner] == valueP) s = ScoreK1PK (side, winner, loser, king1, king2, PieceList[winner][1]); else for (i = 1; i <= PieceCnt[winner]; i++) s += ScoreKPK (side, winner, loser, king1, king2, PieceList[winner][i]); } return ((side == winner) ? s : -s); } #else /* old pre 4pl67 code */ SHORT dist_ (SHORT f1, SHORT r1, SHORT f2, SHORT r2) { return distdata [ f1-9+8*r1 ][ f2-9+8*r2 ]; } SHORT kpkwv_ (SHORT pf, SHORT pr, SHORT wf, SHORT wr, SHORT bf, SHORT br) { /* * Don Beal's routine, which was originally in Fortran. See AICC 2 */ const SHORT drawn=0, win=1; SHORT wbdd, mbpf, blpu; SHORT brpu, mwpf, wlpu, wrpu, blpuu, brpuu, wlpuu, wrpuu, md, bq, blpuuu, brpuuu, bsd, tbf, sgf, bpp, sdr, sgr, wsd, wsg, ppr, wpp; ppr = pr; if (pr == 2) { ppr = 3; } if (pf != 1) { goto L2; } if (bf != 3) { goto L1; } if (pr == 7 && wf == 1 && wr == 8 && br > 6) return drawn; if (pr == 6 && wf < 4 && wr == 6 && br == 8) return win; L1: if (bf == 1 && br > pr) return drawn; if (pr == 7 && bf > 2) return win; if (bf <= 3 && br - ppr > 1) return drawn; if (wf == 1 && bf == 3 && wr - pr == 1 && br - pr == 1) return drawn; L2: bq = dist_ (bf, br, pf, 8); if (bq > 8 - ppr) return win; mbpf = bf - pf; if (mbpf < 0) { mbpf = -mbpf; } bpp = dist_ (bf, br, pf, ppr); wpp = dist_ (wf, wr, pf, ppr); if (bpp - wpp < -1 && br - pr != mbpf) return drawn; if (pf == 1 && pr <= 3 && wf <= 2 && wr == 8 && bf == 4 && br >= 7) return win; if (pf != 2 || pr != 6 || bf != 1 || br != 8) { goto L3; } if (wf <= 3 && wr == 6) return drawn; if (wf == 4 && wr == 8) return drawn; L3: if (pr != 7) { goto L4; } if (wr < 8 && wpp == 2 && bq == 0) return win; if (wr == 6 && wf == pf && bq == 0) return win; if (wr >= 6 && wpp <= 2 && bq != 0) return win; L4: blpuu = dist_ (bf, br, pf-1, pr+2); wbdd = dist_ (wf, wr, bf, br-2); brpuu = dist_ (bf, br, pf+1, pr+2); if (pr != 6) { goto L6; } if (dist_ (bf, br, pf+1, pr) > 1 && brpuu > dist_ (wf, wr, pf+1, pr)) return win; if (pf == 1) { goto L5; } if (blpuu > dist_ (wf, wr, pf-1, pr)) return win; if (br == 8 && mbpf == 1 && wbdd == 1) return win; if (br > 6 && mbpf == 2 && dist_ (wf, wr, bf, 5) <= 1) return win; goto L6; L5: if (wf == 1 && wr == 8 && bf == 2 && br == 6) return drawn; L6: mwpf = wf - pf; if (mwpf < 0) { mwpf = -mwpf; } if (pr >= 5 && mwpf == 2 && wr == pr && bf == wf && br - pr == 2) return win; brpu = dist_ (bf, br, pf+1, pr+1); wrpu = dist_ (wf, wr, pf+1, pr+1); blpu = dist_ (bf, br, pf-1, pr+1); wlpu = dist_ (wf, wr, pf-1, pr+1); if (pf == 1 || pr != 5) { goto L7; } if (mwpf <= 1 && wr - pr == 1) return win; if (wrpu == 1 && brpu > 1) return win; if (wr >= 4 && bf == wf && br - pr >= 2 && mbpf == 3) return win; if (wlpu == 1 && blpu > 1) return win; L7: if (pr == 2 && br == 3 && mbpf > 1 && dist_ (wf, wr, bf, br+2) <= 1) return win; if (wr - pr == 2 && br == pr && mbpf == 1 && mwpf > 1 && (wf - pf) * (bf - pf) > 0) return drawn; if (pf == 1 && wf == 1 && wr == br && bf > 3) return win; sgf = pf - 1; if (wf >= pf) { sgf = pf + 1; } sgr = wr - (mwpf - 1); if (mwpf == 0 && wr > br) { sgr = wr - 1; } wsg = dist_ (wf, wr, sgf, sgr); if (wr - pr - mwpf > 0 && wr - br >= -1 && bpp - (wsg + (sgr - ppr)) >= -1 && dist_ (bf, br, sgf, sgr) > wsg) return win; md = mbpf - mwpf; if (pf != 1 || bf <= 3) { goto L8; } sdr = br + (bf - 3); if (sdr > 8) { sdr = 8; } if (wr > br + 1) { sdr = br; } if (sdr <= ppr) { goto L8; } wsd = dist_ (wf, wr, 3, sdr); bsd = dist_ (bf, br, 3, sdr); if (bsd - wsd < -1) return drawn; if (bsd <= wsd && md <= 0) return drawn; L8: brpuuu = dist_ (bf, br, pf+1, pr+3); if (brpu > wrpu && brpuuu > wrpu && pr - wr != pf - wf) return win; if (brpuuu == 0 && wrpu == 1) return win; blpuuu = dist_ (bf, br, pf-1, pr+3); if (pf == 1) { goto L9; } if (blpu > wlpu && blpuuu > wlpu && pr - wr != wf - pf) return win; if (blpuuu == 0 && wlpu == 1) return win; L9: wrpuu = dist_ (wf, wr, pf+1, pr+2); if (brpuu > wrpuu) return win; wlpuu = dist_ (wf, wr, pf-1, pr+2); if (pf > 1 && blpuu > wlpuu) return win; if (br != pr) { goto L10; } if (mwpf <= 2 && wr - pr == -1 && mbpf != 2) return win; if (dist_ (wf, wr, bf-1, br+2) <= 1 && bf - pf > 1) return win; if (dist_ (wf, wr, bf+1, br+2) <= 1 && bf - pf < -1) return win; L10: if (pf == 1) { goto L11; } if (br == pr && mbpf > 1 && dist_ (wf, wr, pf, pr-1) <= 1) return win; if (br - pr >= 3 && wbdd == 1) return win; if (wr - pr >= 2 && wr < br && md >= 0) return win; if (mwpf <= 2 && wr - pr >= 3 && bf != pf && wr - br <= 1) return win; if (wr >= pr && br - pr >= 5 && mbpf >= 3 && md >= -1 && ppr == 3) return win; if (md >= -1 && pr == 2 && br == 8) return win; L11: tbf = bf - 1; if (pf > bf) { tbf = bf + 1; } if (mbpf > 1 && br == ppr && dist_ (wf, wr, tbf, wr+2) <= 1) return win; if (br == pr && bf - pf == -2 && dist_ (wf, wr, pf+2, pr-1) <= 1) return win; if (pf > 2 && br == pr && bf - pf == 2 && dist_ (wf, wr, pf-2, pr-1) <= 1) return win; return drawn; } /* kpkwv_ */ SHORT kpkbv_ (SHORT pf, SHORT pr, SHORT wf, SHORT wr, SHORT bf, SHORT br) { /* Initialized data */ static SHORT incf[8] = {0, 1, 1, 1, 0, -1, -1, -1}; static SHORT incr[8] = {1, 1, 0, -1, -1, -1, 0, 1}; /* System generated locals */ SHORT ret_val; /* Local variables */ static SHORT i; static SHORT nm, nbf, nbr; ret_val = 0; nm = 0; for (i = 1; i <= 8; ++i) { nbf = bf + incf[i - 1]; if (nbf < 1 || nbf > 8) { goto L1; } nbr = br + incr[i - 1]; if (nbr < 1 || nbr > 8) { goto L1; } if (dist_ (nbf, nbr, wf, wr) < 2) { goto L1; } if (nbf == pf && nbr == pr) { goto L2; } if (nbr == pr + 1 && (nbf == pf - 1 || nbf == pf + 1)) { goto L1; } ++nm; if (kpkwv_ (pf, pr, wf, wr, nbf, nbr) == 0) { goto L2; } L1: ; } if (nm > 0) { ret_val = -1; } L2: return ret_val; } /* kpkbv_ */ inline int ScoreK1PK (SHORT int side, SHORT int winner, SHORT int loser, SHORT int king1, register SHORT int king2, register SHORT int sq) /* * We call Don Beal's routine with the necessary parameters and determine * win/draw/loss. Then we compute the real evaluation which is +-500 for * a win/loss and 10 for a draw, plus some points to lead the computer to * a decisive winning/drawing line. */ { SHORT s, win, sqc, sqr, k1c, k1r, k2c, k2r; const int drawn = 10, won = 500; #ifdef CACHE if (ProbeEETable(side,&s)) return s; #endif sqc = column (sq) + 1; sqr = row (sq) + 1; k1c = column (king1) + 1; k1r = row (king1) + 1; k2c = column (king2) + 1; k2r = row (king2) + 1; if (winner == black) { sqr = 9 - sqr; k1r = 9 - k1r; k2r = 9 - k2r; } if (sqc > 4) { sqc = 9 - sqc; k1c = 9 - k1c; k2c = 9 - k2c; } if (side == winner) win = kpkwv_ (sqc, sqr, k1c, k1r, k2c, k2r); else win = kpkbv_ (sqc, sqr, k1c, k1r, k2c, k2r); if (!win) s = drawn + 5 * distance (sq, king2) - 5*distance(king1,king2); else s = won + 50 * (sqr - 2) + 10*distance(sq,king2); /* if (!win) s = drawn + 5 * distance (sq, king2); // old 2.50 way // else s = won + 50 * (sqr - 2); // old 2.50 way */ #ifdef CACHE if (PUTVAR) PutInEETable (side, s); #endif return s; } inline SHORT int ScoreLoneKing (ARGSZ int side) /* * Static evaluation when loser has only a king and winner has no pawns or no * pieces. */ { register SHORT winner, loser, king1, king2, s, i; if (mtl[white] == valueK && mtl[black] == valueK) return 0; UpdateWeights (); winner = ((mtl[white] > mtl[black]) ? white : black); loser = winner ^ 1; king1 = PieceList[winner][0]; king2 = PieceList[loser][0]; s = 0; if (pmtl[winner] == 0) { if (emtl[winner] == valueB + valueN) s = ScoreKBNK (winner, king1, king2); else if (emtl[winner] == valueN + valueN || emtl[winner] == valueN || emtl[winner] == valueB) s = 0; else s = 500 + emtl[winner] - DyingKing[king2] - 2 * distance (king1, king2); } else { if (pmtl[winner] == valueP) s = ScoreK1PK (side, winner, loser, king1, king2, PieceList[winner][1]); else for (i = 1; i <= PieceCnt[winner]; i++) s += ScoreKPK (side, winner, loser, king1, king2, PieceList[winner][i]); } if (side != winner) s = 0 - s; return(s); /* return ((side == winner) ? s : -s);*/ } #endif /* old eval pre 4pl67 way */ int evaluate (register SHORT side, register SHORT ply, register SHORT depth, register SHORT ext, register SHORT alpha, register SHORT beta, SHORT INCscore, SHORT *InChk) /* output Check flag */ /* * Compute an estimate of the score by adding the positional score from the * previous ply to the material difference. If this score falls inside a * window which is 180 points wider than the alpha-beta window (or within a * 50 point window during quiescence search) call ScorePosition() to * determine a score, otherwise return the estimated score. If one side has * only a king and the other either has no pawns or no pieces then the * function ScoreLoneKing() is called. */ { register SHORT xside; register SHORT slk; SHORT s; xside = side ^ 1; s = -Pscore[ply - 1] + mtl[side] - mtl[xside] - INCscore; hung[white] = hung[black] = 0; slk = ((mtl[white] == valueK && (pmtl[black] == 0 || emtl[black] == 0)) || (mtl[black] == valueK && (pmtl[white] == 0 || emtl[white] == 0))); /* should we use the estimete or score the position */ if ( !slk && (ply == 1 || #ifdef CACHE (CheckEETable (side)) || #endif (flag.neweval ? (( (ply==Sdepth || (!ext && depth == 0 && s>=alpha-30 && s<=beta+30)) || (ext && (s >= (alpha - 30) && s <= (beta + 30)) )) ) : ((Sdepth == ply) || (ply > Sdepth && (s >= (alpha - 30) && s <= (beta + 30)) )) ) )) { /* score the position */ ataks (side, atak[side]); if (Anyatak (side, PieceList[xside][0])){ ataks (xside, atak[xside]); ChkFlag[ply-1] = *InChk = (Anyatak (xside, PieceList[side][0]))?(Pindex[TOsquare]+1):0; return (10001 - ply); } ataks (xside, atak[xside]); ChkFlag[ply-1] = *InChk = (Anyatak (xside, PieceList[side][0]))?(Pindex[TOsquare]+1):0; #ifndef BAREBONES EvalNodes++; #endif if(ply>4)PUTVAR=true; s = ScorePosition (side); PUTVAR=false; } else { /* use the estimate but look at check and slk */ *InChk = SqAtakd (PieceList[side][0], xside); ChkFlag[ply - 1] = ((*InChk) ? Pindex[TOsquare] + 1 : 0); if (SqAtakd (PieceList[xside][0], side)){ return (10001 - ply); } #ifdef DEBUG if(debuglevel & 4096){ printf("%lx %lx %d %d\n",hashbd,hashkey,ply,s); } #endif if (slk){ if(ply>4)PUTVAR=true; s = ScoreLoneKing (side); PUTVAR=false;} } Pscore[ply] = s - mtl[side] + mtl[xside]; ChkFlag[ply - 1] = ((*InChk) ? Pindex[TOsquare] + 1 : 0); QueenCheck[ply - 1] = /* tom@izf.tno.nl */ ((*InChk) && board[TOsquare] == queen) ? TOsquare : 0; #ifdef DEBUG if(debuglevel & 4096){ printf("%lx %lx %d %d\n",hashbd,hashkey,ply,s); } #endif return (s); } inline int BRscan (register SHORT sq, SHORT *mob) /* * Find Bishop and Rook mobility, XRAY attacks, and pins. Increment the * hung[] array if a pin is found. */ { register UCHAR *ppos, *pdir; register SHORT s, mobx; register SHORT u, pin; SHORT piece, *Kf; mobx = s = 0; Kf = Kfield[c1]; piece = board[sq]; ppos = nextpos[piece][sq]; pdir = nextdir[piece][sq]; u = ppos[sq]; pin = -1; /* start new direction */ do { s += Kf[u]; if (color[u] == neutral) { mobx++; if (ppos[u] == pdir[u]) pin = -1; /* oops new direction */ u = ppos[u]; } else if (pin < 0) { if (board[u] == pawn || board[u] == king) u = pdir[u]; else { if (ppos[u] != pdir[u]) pin = u; /* not on the edge and on to find a pin */ u = ppos[u]; } } else { if (color[u] == c2 && (board[u] > piece || atk2[u] == 0)) { if (color[pin] == c2) { s += PINVAL; if (atk2[pin] == 0 || atk1[pin] > control[board[pin]] + 1) ++hung[c2]; } else s += XRAY; } pin = -1; /* new direction */ u = pdir[u]; } } while (u != sq); *mob = mobx; return s; } inline SHORT KingScan (register SHORT sq) /* * Assign penalties if king can be threatened by checks, if squares near the * king are controlled by the enemy (especially the queen), or if there are * no pawns near the king. The following must be true: board[sq] == king c1 == color[sq] c2 == otherside[c1] */ #define ScoreThreat \ if (color[u] != c2)\ if (atk1[u] == 0 || (atk2[u] & 0xFF) > 1) ++cnt;\ else s -= 3 { register SHORT cnt; register UCHAR *ppos, *pdir; register SHORT s; register SHORT u; SHORT ok; s = 0; cnt = 0; if (HasBishop[c2] || HasQueen[c2]) { ppos = nextpos[bishop][sq]; pdir = nextdir[bishop][sq]; u = ppos[sq]; do { if (atk2[u] & ctlBQ) ScoreThreat; u = ((color[u] == neutral) ? ppos[u] : pdir[u]); } while (u != sq); } if (HasRook[c2] || HasQueen[c2]) { ppos = nextpos[rook][sq]; pdir = nextdir[rook][sq]; u = ppos[sq]; do { if (atk2[u] & ctlRQ) ScoreThreat; u = ((color[u] == neutral) ? ppos[u] : pdir[u]); } while (u != sq); } if (HasKnight[c2]) { pdir = nextdir[knight][sq]; u = pdir[sq]; do { if (atk2[u] & ctlNN) ScoreThreat; u = pdir[u]; } while (u != sq); } s += (KSFTY * KTHRT[cnt]) / 16; cnt = 0; ok = false; pdir = nextpos[king][sq]; u = pdir[sq]; do { if (board[u] == pawn) ok = true; if (atk2[u] > atk1[u]) { ++cnt; if (atk2[u] & ctlQ) if (atk2[u] > ctlQ + 1 && atk1[u] < ctlQ) s -= 4 * KSFTY; } u = pdir[u]; } while (u != sq); if (!ok) s -= KSFTY; if (cnt > 1) s -= (KSFTY); return (s); } inline int trapped (register SHORT sq) /* * See if the attacked piece has unattacked squares to move to. The following * must be true: c1 == color[sq] c2 == otherside[c1] */ { register SHORT u; register UCHAR *ppos, *pdir; register SHORT piece; piece = board[sq]; ppos = nextpos[ptype[c1][piece]][sq]; pdir = nextdir[ptype[c1][piece]][sq]; if (piece == pawn) { u = ppos[sq]; /* follow no captures thread */ if (color[u] == neutral) { if (atk1[u] >= atk2[u]) return (false); if (atk2[u] < ctlP) { u = ppos[u]; if (color[u] == neutral && atk1[u] >= atk2[u]) return (false); } } u = pdir[sq]; /* follow captures thread */ if (color[u] == c2) return (false); u = pdir[u]; if (color[u] == c2) return (false); } else { u = ppos[sq]; do { if (color[u] != c1) if (atk2[u] == 0 || board[u] >= piece) return (false); u = ((color[u] == neutral) ? ppos[u] : pdir[u]); } while (u != sq); } return (true); } static inline int PawnValue (register SHORT sq, SHORT side) /* * Calculate the positional value for a pawn on 'sq'. */ { register SHORT fyle, rank; register SHORT j, s, a1, a2, in_square, r, e; a1 = (atk1[sq] & 0x4FFF); a2 = (atk2[sq] & 0x4FFF); rank = row (sq); fyle = column (sq); s = 0; if (c1 == white) { s = Mwpawn[sq]; if ((sq == 11 && color[19] != neutral) || (sq == 12 && color[20] != neutral)) s += PEDRNK2B; if ((fyle == 0 || PC1[fyle - 1] == 0) && (fyle == 7 || PC1[fyle + 1] == 0)) s += ISOLANI[fyle]; else if (PC1[fyle] > 1) s += PDOUBLED; if (a1 < ctlP && atk1[sq + 8] < ctlP) { s += BACKWARD[a2 & 0xFF]; if (PC2[fyle] == 0) s += PWEAKH; if (color[sq + 8] != neutral) s += PBLOK; } if(rank != 7 && color[sq+8] == black && board[sq+8] == pawn) s -= PCRASH; if (PC2[fyle] == 0) { r = rank - ((side == black)?1:0); in_square = (row (bking) >= r && distance (sq, bking) < 8 - r); e = (a2 == 0 || side == white)? 0:1; for (j = sq + 8; j < 64; j += 8) if (atk2[j] >= ctlP) { e = 2; break; } else if (atk2[j] > 0 || color[j] != neutral) e = 1; if (e == 2) s += (stage * PassedPawn3[rank]) / 10; else if (in_square || e == 1) s += (stage * PassedPawn2[rank]) / 10; else if (emtl[black] > 0) s += (stage * PassedPawn1[rank]) / 10; else s += PassedPawn0[rank]; } } else if (c1 == black) { s = Mbpawn[sq]; if ((sq == 51 && color[43] != neutral) || (sq == 52 && color[44] != neutral)) s += PEDRNK2B; if ((fyle == 0 || PC1[fyle - 1] == 0) && (fyle == 7 || PC1[fyle + 1] == 0)) s += ISOLANI[fyle]; else if (PC1[fyle] > 1) s += PDOUBLED; if (a1 < ctlP && atk1[sq - 8] < ctlP) { s += BACKWARD[a2 & 0xFF]; if (PC2[fyle] == 0) s += PWEAKH; if (color[sq - 8] != neutral) s += PBLOK; } if(rank != 0 && color[sq-8] == white && board[sq+8] == pawn) s -= PCRASH; if (PC2[fyle] == 0) { r = rank + ((side == white)?1:0); in_square = (row (wking) <= r && distance (sq, wking) < r + 1); e = (a2 == 0 || side == black)?0:1; for (j = sq - 8; j >= 0; j -= 8) if (atk2[j] >= ctlP) { e = 2; break; } else if (atk2[j] > 0 || color[j] != neutral) e = 1; if (e == 2) s += (stage * PassedPawn3[7 - rank]) / 10; else if (in_square || e == 1) s += (stage * PassedPawn2[7 - rank]) / 10; else if (emtl[white] > 0) s += (stage * PassedPawn1[7 - rank]) / 10; else s += PassedPawn0[7 - rank]; } } if((rank >2 && rank < 6) && (fyle > 2 && fyle < 5)) s += PCENTER; if (a2 > 0) { if (a1 == 0 || a2 > ctlP + 1) { s += HUNGP; if (trapped (sq)) hung[c1] += 2; hung[c1]++; } else if (a2 > a1) s += ATAKD; } return (s); } inline int KnightValue (register SHORT sq) /* * Calculate the positional value for a knight on 'sq'. */ { register SHORT s, a2, a1; s = Mknight[c1][sq]; a2 = (atk2[sq] & 0x4FFF); if (a2 > 0) { a1 = (atk1[sq] & 0x4FFF); if (a1 == 0 || a2 > ctlBN + 1) { s += HUNGP; if (trapped (sq)) hung[c1] += 2; hung[c1]++; } else if (a2 >= ctlBN || a1 < ctlP) s += ATAKD; } return (s); } inline int BishopValue (register SHORT sq) /* * Calculate the positional value for a bishop on 'sq'. */ { register SHORT s; register SHORT a2, a1; SHORT mob; s = Mbishop[c1][sq]; s += BRscan (sq, &mob); s += BMBLTY[mob]; a2 = (atk2[sq] & 0x4FFF); if (a2 > 0) { a1 = (atk1[sq] & 0x4FFF); if (a1 == 0 || a2 > ctlBN + 1) { s += HUNGP; if (trapped (sq)) hung[c1] += 2; hung[c1]++; } else if (a2 >= ctlBN || a1 < ctlP) s += ATAKD; } return (s); } inline int RookValue (register SHORT sq) /* * Calculate the positional value for a rook on 'sq'. */ { register SHORT s; register SHORT fyle, a2, a1; SHORT mob; s = RookBonus; /* if(stage < 3 && !castld[c1] ){ if(sq == qrook[c1] && sq == krook[c1]) s += 99; } */ s += BRscan (sq, &mob); s += RMBLTY[mob]; fyle = column (sq); if (PC1[fyle] == 0) { s += RHOPN; if (PC2[fyle] == 0) s += RHOPNX; } if (pmtl[c2] > 100 && row (sq) == rank7[c1]) s += 10; if (stage > 2) s += 14 - taxicab (sq, EnemyKing); a2 = (atk2[sq] & 0x4FFF); if (a2 > 0) { a1 = (atk1[sq] & 0x4FFF); if (a1 == 0 || a2 > ctlR + 1) { s += HUNGP; if (trapped (sq)) hung[c1] += 2; hung[c1]++; } else if (a2 >= ctlR || a1 < ctlP) s += ATAKD; } return (s); } inline int QueenValue (register SHORT sq) /* * Calculate the positional value for a queen on 'sq'. */ { register SHORT s, a2, a1; s = ((distance (sq, EnemyKing) < 3) ? 12 : 0); if (stage > 2) s += 14 - taxicab (sq, EnemyKing); a2 = (atk2[sq] & 0x4FFF); if (a2 > 0) { a1 = (atk1[sq] & 0x4FFF); if (a1 == 0 || a2 > ctlQ + 1) { s += HUNGP; if (trapped (sq)) hung[c1] += 2; hung[c1]++; } else if (a2 >= ctlQ || a1 < ctlP) s += ATAKD; } return (s); } inline int KingValue (register SHORT sq) /* * Calculate the positional value for a king on 'sq'. */ { register SHORT s; register SHORT fyle; SHORT a2, a1; s = (emtl[c2] > KINGPOSLIMIT) ? Mking[c1][sq] : Mking[c1][sq] / 2; if (KSFTY > 0) if (Developed[c2] || stage > 0) s += KingScan (sq); if (castld[c1]) s += KCASTLD; else if (Mvboard[kingP[c1]]) s += KMOVD; /* if(!castld[c1] && sq == kingP[c1])s += 50; */ fyle = column (sq); if (PC1[fyle] == 0) s += KHOPN; if (PC2[fyle] == 0) s += KHOPNX; switch (fyle) { case 5: if (PC1[7] == 0) s += KHOPN; if (PC2[7] == 0) s += KHOPNX; /* Fall through */ case 6: if(HasQueen[c2])if (PC1[7] == 0) s += AHOPEN; case 4: case 0: if (PC1[fyle + 1] == 0) s += KHOPN; if (PC2[fyle + 1] == 0) s += KHOPNX; break; case 2: if (PC1[0] == 0) s += KHOPN; if (PC2[0] == 0) s += KHOPNX; /* Fall through */ case 1: if(HasQueen[c2])if (PC1[0] == 0) s += AHOPEN; case 3: case 7: if (PC1[fyle - 1] == 0) s += KHOPN; if (PC2[fyle - 1] == 0) s += KHOPNX; break; default: /* Impossible! */ break; } a2 = (atk2[sq] & 0x4FFF); if (a2 > 0) { a1 = (atk1[sq] & 0x4FFF); if (a1 == 0 || a2 > ctlK + 1) { s += HUNGP; ++hung[c1]; } else s += ATAKD; } return (s); } SHORT ScorePosition (register SHORT side) /* * Perform normal static evaluation of board position. A score is generated * for each piece and these are summed to get a score for each side. */ { register SHORT score; register SHORT sq, i, xside; SHORT s; xside = side ^ 1; hung[white] = hung[black] = pscore[white] = pscore[black] = 0; #ifdef CACHE if (!(hashkey+hashbd) || !ProbeEETable (side, &s)) { #endif UpdateWeights (); for (c1 = white; c1 <= black; c1++) { c2 = c1 ^ 1; /* atk1 is array of atacks on squares by my side */ atk1 = atak[c1]; /* atk2 is array of atacks on squares by other side */ atk2 = atak[c2]; /* same for PC1 and PC2 */ PC1 = PawnCnt[c1]; PC2 = PawnCnt[c2]; for (i = PieceCnt[c1]; i >= 0; i--) { sq = PieceList[c1][i]; switch (board[sq]) { case pawn: s = PawnValue (sq, side); break; case knight: s = KnightValue (sq); break; case bishop: s = BishopValue (sq); break; case rook: s = RookValue (sq); break; case queen: s = QueenValue (sq); break; case king: s = KingValue (sq); break; default: s = 0; break; } pscore[c1] += s; svalue[sq] = s; } } if (hung[side] > 1) pscore[side] += HUNGX; if (hung[xside] > 1) pscore[xside] += HUNGX; score = mtl[side] - mtl[xside] + pscore[side] - pscore[xside] + 10; #ifndef NODITHER if (dither) { if (flag.hash) gsrand (starttime + (unsigned int) hashbd); score += urand () % dither; } #endif if (score > 0 && pmtl[side] == 0) if (emtl[side] < valueR) score = 0; else if (score < valueR) score /= 2; if (score < 0 && pmtl[xside] == 0) if (emtl[xside] < valueR) score = 0; else if (-score < valueR) score /= 2; if (mtl[xside] == valueK && emtl[side] > valueB) score += 200; if (mtl[side] == valueK && emtl[xside] > valueB) score -= 200; #ifdef CACHE if(PUTVAR)PutInEETable(side,score); #endif return (score); #ifdef CACHE } else { return s; } #endif } static inline void BlendBoard (const SHORT a[64], const SHORT b[64], SHORT c[64]) { register int sq, s; s = 10 - stage; for (sq = 0; sq < 64; sq++) c[sq] = ((a[sq] * s) + (b[sq] * stage)) / 10; } static inline void CopyBoard (const SHORT a[64], SHORT b[64]) { register const SHORT *sqa; register SHORT *sqb; for (sqa = a, sqb = b; sqa < a + 64;) *sqb++ = *sqa++; } void ExaminePosition (void) /* * This is done one time before the search is started. Set up arrays Mwpawn, * Mbpawn, Mknight, Mbishop, Mking which are used in the SqValue() function * to determine the positional value of each piece. */ { register SHORT i, sq; register SHORT fyle; SHORT wpadv, bpadv, wstrong, bstrong, z, side, pp, j, k, val, Pd, rank; static SHORT PawnStorm = false; /* update ataks arrays */ ataks (white, atak[white]); ataks (black, atak[black]); /* */ UpdateWeights (); /* initialize Hasxxx */ HasKnight[white] = HasKnight[black] = 0; HasBishop[white] = HasBishop[black] = 0; HasRook[white] = HasRook[black] = 0; HasQueen[white] = HasQueen[black] = 0; for (side = white; side <= black; side++) for (i = PieceCnt[side]; i >= 0; i--) switch (board[PieceList[side][i]]) { case knight: ++HasKnight[side]; break; case bishop: ++HasBishop[side]; break; case rook: ++HasRook[side]; break; case queen: ++HasQueen[side]; break; } /* Developed if has moved knights and bishops */ if (!Developed[white]) Developed[white] = (board[1] != knight && board[2] != bishop && board[5] != bishop && board[6] != knight); if (!Developed[black]) Developed[black] = (board[57] != knight && board[58] != bishop && board[61] != bishop && board[62] != knight); /* Pawn Storm */ if (!PawnStorm && stage < 5) PawnStorm = ((column (wking) < 3 && column (bking) > 4) || (column (wking) > 4 && column (bking) < 3)); /* setup base tables */ memcpy(Mknight[white],pknight,sizeof(pknight)); memcpy(Mknight[black],pknight,sizeof(pknight)); memcpy(Mbishop[white],pbishop,sizeof(pbishop)); memcpy(Mbishop[black],pbishop,sizeof(pbishop)); #ifdef notdef CopyBoard (pknight, Mknight[white]); CopyBoard (pknight, Mknight[black]); CopyBoard (pbishop, Mbishop[white]); CopyBoard (pbishop, Mbishop[black]); #endif /* linear interpolate on stage */ /* Mking = (KingOpening * (10 - stage) + KingEnding * srage) /10 */ BlendBoard (KingOpening, KingEnding, Mking[white]); BlendBoard (KingOpening, KingEnding, Mking[black]); for (sq = 0; sq < 64; sq++) { fyle = column (sq); rank = row (sq); wstrong = bstrong = true; /* does a black pawn attack to squares in this col from sq to end */ for (i = sq; i < 64; i += 8) if (Patak (black, i)) { wstrong = false; break; } /* does a white pawn attack to squares in this col from sq to end */ for (i = sq; i >= 0; i -= 8) if (Patak (white, i)) { bstrong = false; break; } /* */ wpadv = bpadv = PADVNCM; if ((fyle == 0 || PawnCnt[white][fyle - 1] == 0) && (fyle == 7 || PawnCnt[white][fyle + 1] == 0)) wpadv = PADVNCI; if ((fyle == 0 || PawnCnt[black][fyle - 1] == 0) && (fyle == 7 || PawnCnt[black][fyle + 1] == 0)) bpadv = PADVNCI; Mwpawn[sq] = (wpadv * PawnAdvance[sq]) / 10; Mbpawn[sq] = (bpadv * PawnAdvance[63 - sq]) / 10; Mwpawn[sq] += PawnBonus; Mbpawn[sq] += PawnBonus; /* */ if (Mvboard[kingP[white]]) { if ((fyle < 3 || fyle > 4) && distance (sq, wking) < 3) Mwpawn[sq] += PAWNSHIELD; } else if (rank < 3 && (fyle < 2 || fyle > 5)) Mwpawn[sq] += PAWNSHIELD / 2; /* */ if (Mvboard[kingP[black]]) { if ((fyle < 3 || fyle > 4) && distance (sq, bking) < 3) Mbpawn[sq] += PAWNSHIELD; } else if (rank > 4 && (fyle < 2 || fyle > 5)) Mbpawn[sq] += PAWNSHIELD / 2; /* */ if (PawnStorm) { if ((column (wking) < 4 && fyle > 4) || (column (wking) > 3 && fyle < 3)) Mwpawn[sq] += 3 * rank - 21; if ((column (bking) < 4 && fyle > 4) || (column (bking) > 3 && fyle < 3)) Mbpawn[sq] -= 3 * rank; } /* */ Mknight[white][sq] += 5 - distance (sq, bking); Mknight[white][sq] += 5 - distance (sq, wking); Mknight[black][sq] += 5 - distance (sq, wking); Mknight[black][sq] += 5 - distance (sq, bking); /* */ Mbishop[white][sq] += BishopBonus; Mbishop[black][sq] += BishopBonus; /* */ for (i = PieceCnt[black]; i >= 0; i--) if (distance (sq, PieceList[black][i]) < 3) Mknight[white][sq] += KNIGHTPOST; for (i = PieceCnt[white]; i >= 0; i--) if (distance (sq, PieceList[white][i]) < 3) Mknight[black][sq] += KNIGHTPOST; /* */ if (wstrong) Mknight[white][sq] += KNIGHTSTRONG; if (bstrong) Mknight[black][sq] += KNIGHTSTRONG; if (wstrong) Mbishop[white][sq] += BISHOPSTRONG; if (bstrong) Mbishop[black][sq] += BISHOPSTRONG; /* */ if (HasBishop[white] == 2) Mbishop[white][sq] += 8; if (HasBishop[black] == 2) Mbishop[black][sq] += 8; if (HasKnight[white] == 2) Mknight[white][sq] += 5; if (HasKnight[black] == 2) Mknight[black][sq] += 5; /* */ Kfield[white][sq] = Kfield[black][sq] = 0; if (distance (sq, wking) == 1) Kfield[black][sq] = KATAK; if (distance (sq, bking) == 1) Kfield[white][sq] = KATAK; /* */ Pd = 0; for (k = 0; k <= PieceCnt[white]; k++) { i = PieceList[white][k]; if (board[i] == pawn) { pp = true; z = i + ((row (i) == 6) ? 8 : 16); for (j = i + 8; j < 64; j += 8) if (Patak (black, j) || board[j] == pawn) { pp = false; break; } Pd += ((pp) ? 5 * taxicab (sq, z) : taxicab (sq, z)); } } /* */ for (k = 0; k <= PieceCnt[black]; k++) { i = PieceList[black][k]; if (board[i] == pawn) { pp = true; z = i - ((row (i) == 1) ? 8 : 16); for (j = i - 8; j >= 0; j -= 8) if (Patak (white, j) || board[j] == pawn) { pp = false; break; } Pd += ((pp) ? 5 * taxicab (sq, z) : taxicab (sq, z)); } } /* */ if (Pd != 0) { val = (Pd * stage2) / 10; Mking[white][sq] -= val; Mking[black][sq] -= val; } } } void UpdateWeights (void) /* * If material balance has changed, determine the values for the positional * evaluation terms. */ { register SHORT s1; emtl[white] = mtl[white] - pmtl[white] - valueK; emtl[black] = mtl[black] - pmtl[black] - valueK; tmtl = emtl[white] + emtl[black]; s1 = ((tmtl > 6600) ? 0 : ((tmtl < 1400) ? 10 : (6600 - tmtl) / 520)); if (s1 != stage) { stage = s1; stage2 = ((tmtl > 3600) ? 0 : ((tmtl < 1400) ? 10 : (3600 - tmtl) / 220)); PEDRNK2B = -15; /* centre pawn on 2nd rank & blocked */ PBLOK = -4; /* blocked backward pawn */ PDOUBLED = -14; /* doubled pawn */ PWEAKH = -4; /* weak pawn on half open file */ PAWNSHIELD = 10 - stage; /* pawn near friendly king */ PADVNCM = 10; /* advanced pawn multiplier */ PADVNCI = 7; /* muliplier for isolated pawn */ PawnBonus = stage; KNIGHTPOST = (stage + 2) / 3; /* knight near enemy pieces */ KNIGHTSTRONG = (stage + 6) / 2; /* occupies pawn hole */ BISHOPSTRONG = (stage + 6) / 2; /* occupies pawn hole */ BishopBonus = BBONUS * stage; RHOPN = 10; /* rook on half open file */ RHOPNX = 4; RookBonus = RBONUS * stage; XRAY = 8; /* Xray attack on piece */ PINVAL = 10; /* Pin */ KHOPN = (3 * stage - 30) / 2; /* king on half open file */ KHOPNX = KHOPN / 2; KCASTLD = 10 - stage; KMOVD = -40 / (stage + 1); /* king moved before castling */ KATAK = (10 - stage) / 2; /* B,R attacks near enemy king */ KSFTY = ((stage < 8) ? (KINGSAFETY - 4 * stage) : 0); ATAKD = -6; /* defender > attacker */ HUNGP = -12; /* each hung piece */ HUNGX = -18; /* extra for >1 hung piece */ } } gnuchess-4.0.pl70/src/game.c100444 21542 13 22571 5563700645 14676 0ustar cracraftuser/* * postprint.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include "gnuchess.h" CHAR mvstr[5][7]; #ifdef MSDOS #include #include #include #define RWA_ACC "r+b" #define WA_ACC "w+b" #else #define RWA_ACC "r+" #define WA_ACC "w+" #include #include #endif /* MSDOS */ FILE *fd; #define truescore 0x0001 #define lowerbound 0x0002 #define upperbound 0x0004 #define kingcastle 0x0008 #define queencastle 0x0010 const SHORT otherside[3] = {black, white, neutral}; const SHORT Stboard[64] = {rook, knight, bishop, queen, king, bishop, knight, rook, pawn, pawn, pawn, pawn, pawn, pawn, pawn, pawn, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, pawn, pawn, pawn, pawn, pawn, pawn, pawn, pawn, rook, knight, bishop, queen, king, bishop, knight, rook}; const SHORT Stcolor[64] = {white, white, white, white, white, white, white, white, white, white, white, white, white, white, white, white, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, black, black, black, black, black, black, black, black, black, black, black, black, black, black, black, black}; struct GameRec GameList[512]; long i, j; int nr; SHORT ep; int r, c; CHAR line[128]; CHAR *l; SHORT board[64]; SHORT color[64]; SHORT GameCnt; int from, to; CHAR *InPtr; void skip () { while (*InPtr != ' ') InPtr++; while (*InPtr == ' ') InPtr++; } void skipb () { while (*InPtr == ' ') InPtr++; } int parser (CHAR *f, int side, UTSHORT *flags) { int c1, r1, c2, r2; *flags = 0; if (f[4] == 'o') if (side == black) return 0x3C3A; else return 0x0402; else if (f[0] == 'o') if (side == black) return 0x3C3E; else return 0x0406; else { c1 = f[0] - 'a'; r1 = f[1] - '1'; c2 = f[2] - 'a'; r2 = f[3] - '1'; if (f[4] != ' ') { /* promotion */ for (i = 0; i < 7; i++) if (f[4] == Qxx[i]) { *flags = (UTSHORT)i | promote; break; } } return (locn (r1, c1) << 8) | locn (r2, c2); } return (0); } void algbr (SHORT f, SHORT t, SHORT flag) /* * Generate move strings in different formats. */ { int m3p; if (f != t) { /* algebraic notation */ mvstr[0][0] = Cxx[column (f)]; mvstr[0][1] = Rxx[row (f)]; mvstr[0][2] = Cxx[column (t)]; mvstr[0][3] = Rxx[row (t)]; mvstr[0][4] = mvstr[3][0] = '\0'; if (((mvstr[1][0] = Pxx[board[f]]) == 'P') || (flag & promote)) { if (mvstr[0][0] == mvstr[0][2]) /* pawn did not eat */ { mvstr[2][0] = mvstr[1][0] = mvstr[0][2]; /* to column */ mvstr[2][1] = mvstr[1][1] = mvstr[0][3]; /* to row */ m3p = 2; } else /* pawn ate */ { mvstr[2][0] = mvstr[1][0] = mvstr[0][0]; /* column */ mvstr[2][1] = mvstr[1][1] = mvstr[0][2]; /* to column */ mvstr[2][2] = mvstr[0][3]; m3p = 3; /* to row */ } if (flag & promote) { mvstr[0][4] = mvstr[1][2] = mvstr[2][m3p] = Qxx[flag & pmask]; mvstr[1][3] = mvstr[2][m3p + 1] = mvstr[0][5] = '\0'; #ifdef CHESSTOOL mvstr[3][0] = mvstr[0][0]; /* Allow e7e8 for chesstool */ mvstr[3][1] = mvstr[0][1]; mvstr[3][2] = mvstr[0][2]; mvstr[3][3] = mvstr[0][3]; mvstr[3][4] = '\0'; #endif } mvstr[2][m3p] = mvstr[1][2] = '\0'; } else /* not a pawn */ { mvstr[2][0] = mvstr[1][0]; mvstr[2][1] = mvstr[0][1]; mvstr[2][2] = mvstr[1][1] = mvstr[0][2]; /* to column */ mvstr[2][3] = mvstr[1][2] = mvstr[0][3]; /* to row */ mvstr[2][4] = mvstr[1][3] = '\0'; strcpy (mvstr[3], mvstr[2]); mvstr[3][1] = mvstr[0][0]; if (flag & cstlmask) { if (t > f) { strcpy (mvstr[1], "o-o"); strcpy (mvstr[2], "O-O"); } else { strcpy (mvstr[1], "o-o-o"); strcpy (mvstr[2], "O-O-O"); } } } } else mvstr[0][0] = mvstr[1][0] = mvstr[2][0] = mvstr[3][0] = '\0'; } void GetGame () { CHAR fb[256]; UTSHORT flags; fgets (fb, 256, fd); fgets (fb, 256, fd); while (fgets (fb, 256, fd)) { struct GameRec *g; int side = white; side = otherside[side]; if (fb[0] == '\n') return; ++GameCnt; InPtr = fb; skipb (); g = &GameList[GameCnt]; g->gmove = parser (InPtr, side, &flags); skip (); g->score = atoi (InPtr); skip (); g->depth = atoi (InPtr); skip (); g->nodes = atol (InPtr); skip (); g->time = atol (InPtr); g->flags = flags; skip (); ++GameCnt; g = &GameList[GameCnt]; g->gmove = parser (InPtr, side, &flags); skip (); g->score = atoi (InPtr); skip (); g->depth = atoi (InPtr); skip (); g->nodes = atol (InPtr); skip (); g->time = atol (InPtr); g->flags = flags; } } SHORT xside, side; void getboard (int mvno) { register SHORT f, t; SHORT rf, rt; UTSHORT mv; /* now update the board and hash values */ /* * should really check the moves as we do this, but??? */ mv = GameList[mvno].gmove; f = mv >> 8 & 0x7F; t = mv & 0xFF; /* can only capture other side */ if (board[t] != no_piece) { if (color[t] != xside) { algbr (f, t, 0); printf ("Illegal move - %d %s \n", mvno, mvstr[0]); } } /* there must be a piece to move */ if (board[f] == no_piece || color[f] != side) { algbr (f, t, 0); printf ("Illegal move + %d %s \n", mvno, mvstr[0]); } /* is it EnPassant */ if (board[f] == pawn && board[t] == no_piece) { if ((row (f) == 4 && row (t) == 3) || (row (f) == 5 && row (t) == 6)) { if ((column (t) == column (f) + 1) || (column (t) == column (f) - 1)) { ep = t + ((t > f) ? -8 : 8); if (board[ep] == pawn && color[ep] == xside) { board[ep] = no_piece; color[ep] = neutral; } } } } board[t] = board[f]; color[t] = color[f]; color[f] = neutral; board[f] = no_piece; /* castle moves */ if ((board[t] == king) & ((mv == BLACKCASTLE) || (mv == WHITECASTLE) || (mv == LONGBLACKCASTLE) || (mv == LONGWHITECASTLE))) { if (t > f) { rf = f + 3; rt = t - 1; } else { rf = f - 4; rt = t + 1; } board[rt] = rook; color[rt] = side; board[rf] = no_piece; color[rf] = neutral; } else if (GameList[i].flags & promote) board[t] = GameList[i].flags & pmask; xside = side; side = otherside[side]; } void main (int argc, CHAR **argv) { int from, to; int f = 0; UTSHORT mv; int start, end; if (argc > 4 || argc < 2) { printf ("Usage: game file [start [end] ] \n"); exit (1); } start = end = 0; if (argc > 2) start = (atoi (argv[2]) * 2) - 1; if (argc == 4) end = (atoi (argv[3]) * 2) - 1; side = white; xside = black; for (i = 0; i < 64; i++) { board[i] = Stboard[i]; color[i] = Stcolor[i]; } i = 1; if ((fd = fopen (argv[1], RWA_ACC)) == NULL) exit (1); printf ("/V 11 72 mul def /L 60 def\n"); GetGame (); if (!start || start < 1 || start > GameCnt) start = 1; if (!end || end > GameCnt || end < 1) end = GameCnt; for (i = 1; i < end; i++) { getboard ((int)i); if (i < start) continue; nr++; if (nr == 19) { nr = 1; printf ("showpage\n/V 11 72 mul def\n"); printf ("/L 60 def\n"); f = 0; } /* now process this entry */ strcpy (line, "C ('#["); for (r = 0; r < 8; r++) { l = line + 6 + (7 - r) * 9; for (c = 0; c < 8; c++) { if (color[r * 8 + c] == black) *l++ = Qxx[board[r * 8 + c]]; else *l++ = Pxx[board[r * 8 + c]]; } *l++ = ';'; } l--; line[79] = '\0'; strcat (line, "]') show"); /* decode flags */ printf ("L V moveto\n"); mv = GameList[i].gmove; from = mv >> 8 & 0x7F; to = mv & 0x7F; algbr (from, to, 0); if (i % 2) printf ("R (%d %s score %d time %d", (i + 1) / 2, mvstr[0], GameList[i].score, GameList[i].time); else printf ("R (%d ... %s score %d time %d", (i + 1) / 2, mvstr[0], GameList[i].score, GameList[i].time); printf (") show\n"); printf ("L V 100 sub moveto\n"); printf ("%s\n", line); f++; if (f == 3) { printf ("/V V 120 sub def /L 60 def\n"); f = 0; } else printf ("/L 160 L add def\n"); } if (nr) printf ("showpage\n"); exit (0); } gnuchess-4.0.pl70/src/genmoves.c100444 21542 13 55460 5563700645 15613 0ustar cracraftuser/* * genmoves.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" #include "ataks.h" SHORT *TrP, InCheck; #define min(a,b) (((a) >(b))?(b):(a)) #define Link(from,to,flag,s) \ {\ node->f = from; node->t = to;\ node->reply = 0;\ node->flags = flag;\ node->score = s;\ ++node;\ (*TrP)++;\ } inline int CheckMove (register SHORT f, register SHORT t) /* * See if any piece with color 'side' ataks sq. First check pawns then * Queen, Bishop, Rook and King and last Knight. */ { SHORT xside; register SHORT sq; SHORT side, fsave, tsave, tcsave; if ((tsave = board[t]) == king) return false; xside = color[f]; side = xside ^ 1; fsave = board[f]; sq = ((fsave == king) ? t : PieceList[xside][0]); if (InCheck || fsave == king) { register UCHAR *ppos, *pdir; register SHORT u; board[t] = fsave; tcsave = color[t]; board[f] = no_piece; color[f] = neutral; color[t] = xside; /* try a queen bishop capture */ ppos = nextpos[bishop][sq]; pdir = nextdir[bishop][sq]; u = ppos[sq]; do { if (color[u] == neutral) u = ppos[u]; else if (color[u] == xside) u = pdir[u]; else if ((board[u] == bishop || board[u] == queen)) { board[f] = fsave; board[t] = tsave; color[f] = xside; color[t] = tcsave; return (false); } else u = pdir[u]; } while (u != sq); /* try a queen rook capture */ ppos = nextpos[rook][sq]; pdir = nextdir[rook][sq]; u = ppos[sq]; do { if (color[u] == neutral) u = ppos[u]; else if (color[u] == xside) u = pdir[u]; else if ((board[u] == rook || board[u] == queen)) { board[f] = fsave; board[t] = tsave; color[f] = xside; color[t] = tcsave; return (false); } else u = pdir[u]; } while (u != sq); /* try a knight capture */ pdir = nextdir[knight][sq]; u = pdir[sq]; do { if (color[u] == side && board[u] == knight) { board[f] = fsave; board[t] = tsave; color[f] = xside; color[t] = tcsave; return (false); } u = pdir[u]; } while (u != sq); pdir = nextdir[ptype[xside][pawn]][sq]; u = pdir[sq]; /* follow captures thread */ if (u != sq) { if (board[u] == pawn && color[u] == side) { board[f] = fsave; board[t] = tsave; color[f] = xside; color[t] = tcsave; return (false); } u = pdir[u]; if (u != sq && board[u] == pawn && color[u] == side) { board[f] = fsave; board[t] = tsave; color[f] = xside; color[t] = tcsave; return (false); } } board[f] = fsave; board[t] = tsave; color[f] = xside; color[t] = tcsave; return (true); } else { register SHORT *p, *q, i; /* now one at a time */ /* diag */ if ((row (sq) - row (f)) == (column (sq) - column (f))) { if ((row (sq) - row (t)) == (column (sq) - column (t))) return true; /* diag ++ */ if (f > sq) { for (p = &board[sq + 9], q = &color[sq + 9], i = min (7 - row (sq), 7 - column (sq)); i; p += 9, q += 9, i--) { if (*q == neutral || p == &board[f]) continue; else if (*q == xside) return true; if (*p == bishop || *p == queen) return false; else return true; } /* diag -- */ } else { for (p = &board[sq - 9], q = &color[sq - 9], i = min (row (sq), column (sq)); i; p -= 9, q -= 9, i--) { if (*q == neutral || p == &board[f]) continue; else if (*q == xside) return true; if (*p == bishop || *p == queen) return false; else return true; } } } /* same col */ else if (column (sq) == column (f)) { if (column (f) == column (t)) return true; if (row (sq) < row (f)) { /* col + */ for (p = &board[sq + 8], q = &color[sq + 8]; p <= &board[63]; p += 8, q += 8) { if (*q == neutral || p == &board[f]) continue; else if (*q == xside) return true; if (*p == rook || *p == queen) return false; else return true; } } else { /* col - */ for (p = &board[sq - 8], q = &color[sq - 8]; p >= &board[0]; p -= 8, q -= 8) { if (*q == neutral || p == &board[f]) continue; else if (*q == xside) return true; if (*p == rook || *p == queen) return false; else return true; } } } /* diag */ else if ((row (sq) - row (f)) == (-column (sq) + column (f))) { if ((row (sq) - row (t)) == (-column (sq) + column (t))) return true; /* diag -+ */ if (f < sq) { for (p = &board[sq - 7], q = &color[sq - 7], i = min (row (sq), 7 - column (sq)); i; p -= 7, q -= 7, i--) { if (*q == neutral || p == &board[f]) continue; else if (*q == xside) return true; if (*p == bishop || *p == queen) return false; else return true; } /* diag +- */ } else { for (p = &board[sq + 7], q = &color[sq + 7], i = min (7 - row (sq), column (sq)); i; p += 7, q += 7, i--) { if (*q == neutral || p == &board[f]) continue; else if (*q == xside) return true; if (*p == bishop || *p == queen) return false; else return true; } } } /* same row + */ else if (row (sq) == row (f)) { if (row (sq) == row (t)) return true; if (column (sq) < column (f)) { for (p = &board[sq + 1], q = &color[sq + 1]; p < &board[(f / 8 + 1) * 8]; p += 1, q += 1) { if (*q == neutral || p == &board[f]) continue; else if (*q == xside) return true; if (*p == rook || *p == queen) return false; else return true; } } else { /* same row - */ for (p = &board[sq - 1], q = &color[sq - 1]; p > &board[(f / 8) * 8]; p -= 1, q -= 1) { if (*q == neutral || p == &board[f]) continue; else if (*q == xside) return true; if (*p == rook || *p == queen) return false; else return true; } } } return true; } return true; } inline void LinkMove (SHORT ply, SHORT f, register SHORT t, SHORT flag, SHORT xside) /* * Add a move to the tree. Assign a bonus to order the moves as follows: 1. Principle variation 2. Capture of last moved piece 3. Other captures (major pieces first) 4. Killer moves 5. */ { register SHORT s = 0; #if defined HISTORY register SHORT z; #endif register utshort mv; register struct leaf *node; node = &Tree[*TrP]; mv = (f << 8) | t; #ifdef KILLT s += killt[mv ]; #endif #ifdef HISTORY z = mv; if (xside == white) z |= 0x4000; s += history[z]; #endif if (color[t] != neutral) { /* TOsquare is the square the last piece moved moved to */ s += value[board[t]] - board[f] + ((t == TOsquare) ? 500 : 0); } if (board[f] == pawn) if (row (t) == 0 || row (t) == 7) { flag |= promote; s += 800; #if !defined OLDXBOARD && !defined GNU3 && !defined CHESSTOOL Link (f, t, flag | queen, s - 20000); s -= 200; Link (f, t, flag | knight, s - 20000); s -= 50; Link (f, t, flag | rook, s - 20000); flag |= bishop; s -= 50; #else flag |= queen; #endif } else if (row (t) == 1 || row (t) == 6) { flag |= pwnthrt; s += 600; } else if ((row (t) == ((color[f] == white) ? 5 : 2)) && (ply > MINDEPTH) && (ply < Sdepth + 3)) { if ((mtl[white] - pmtl[white] + mtl[black] - pmtl[black]) < PTVALUE) { flag |= pwnthrt; s += 400; } } /* s += ((value[board[f]])/100); */ Link (f, t, flag, s - 20000); } inline void GenMoves (register SHORT ply, register SHORT sq, SHORT side, SHORT xside) /* * Generate moves for a piece. The moves are taken from the precalulated * array nextpos/nextdir. If the board is free, next move is choosen from * nextpos else from nextdir. */ { register SHORT u, piece; register UCHAR *ppos, *pdir; TrP = &TrPnt[ply + 1]; piece = board[sq]; ppos = nextpos[ptype[side][piece]][sq]; pdir = nextdir[ptype[side][piece]][sq]; if (piece == pawn) { u = ppos[sq]; /* follow no captures thread */ if (color[u] == neutral) { LinkMove (ply, sq, u, 0, xside); u = ppos[u]; if (color[u] == neutral) LinkMove (ply, sq, u, 0, xside); } u = pdir[sq]; /* follow captures thread */ if (color[u] == xside && board[u] != king) { LinkMove (ply, sq, u, capture, xside); } u = pdir[u]; if (color[u] == xside && board[u] != king) { LinkMove (ply, sq, u, capture, xside); } } else { u = ppos[sq]; do { if (color[u] == neutral) { LinkMove (ply, sq, u, 0, xside); u = ppos[u]; } else { if (color[u] == xside && board[u] != king) { LinkMove (ply, sq, u, capture, xside); } u = pdir[u]; } } while (u != sq); } } void MoveList (SHORT side, register SHORT ply) /* * Fill the array Tree[] with all available moves for side to play. Array * TrPnt[ply] contains the index into Tree[] of the first move at a ply. */ { register SHORT i, xside, f; xside = side ^ 1; TrP = &TrPnt[ply + 1]; *TrP = TrPnt[ply]; if (!PV) Swag0 = killr0[ply]; else Swag0 = PV; Swag1 = killr1[ply]; Swag2 = killr2[ply]; Swag3 = killr3[ply]; if (ply > 2) Swag4 = killr1[ply - 2]; else Swag4 = 0; #ifdef KILLT killt[SwagHt ] += 5000; killt[Swag0 ] += 2000; killt[Swag1 ] += 60; killt[Swag2 ] += 50; killt[Swag3 ] += 40; killt[Swag4 ] += 30; #endif #ifdef OLDHISTORY i = (side == black) ? 0x4000 : 0; history[SwagHt | i] += 5000; history[Swag0 | i] += 2000; history[Swag1 | i] += 60; history[Swag2 | i] += 50; history[Swag3 | i] += 40; history[Swag4 | i] += 30; #endif for (i = PieceCnt[side]; i >= 0; i--) GenMoves (ply, PieceList[side][i], side, xside); if (!castld[side]) { f = PieceList[side][0]; if (castle (side, f, f + 2, 0)) { LinkMove (ply, f, f + 2, cstlmask, xside); } if (castle (side, f, f - 2, 0)) { LinkMove (ply, f, f - 2, cstlmask, xside); } } if (epsquare > 0) { register SHORT l; f = epmove1[epsquare]; if (color[f] == side && board[f] == pawn) { l = epsquare + ((epsquare > f) ? -8 : 8); board[l] = no_piece; color[l] = neutral; LinkMove (ply, f, epsquare, capture | epmask, xside); board[l] = pawn; color[l] = xside; } f = epmove2[epsquare]; if (color[f] == side && board[f] == pawn) { l = epsquare + ((epsquare > f) ? -8 : 8); board[l] = no_piece; color[l] = neutral; LinkMove (ply, f, epsquare, capture | epmask, xside); board[l] = pawn; color[l] = xside; } } #ifdef KILLT killt[SwagHt ] -= 5000; killt[Swag0 ] -= 2000; killt[Swag1 ] -= 60; killt[Swag2 ] -= 50; killt[Swag3 ] -= 40; killt[Swag4 ] -= 30; #endif #ifdef OLDHISTORY i = (side == black) ? 0x4000 : 0; history[SwagHt | i] -= 5000; history[Swag0 | i] -= 2000; history[Swag1 | i] -= 60; history[Swag2 | i] -= 50; history[Swag3 | i] -= 40; history[Swag4 | i] -= 30; #endif SwagHt = 0; /* SwagHt is only used once */ GenCnt += (TrPnt[ply + 1] - TrPnt[ply]); } void CaptureList (register SHORT side, SHORT ply) /* * Fill the array Tree[] with all available cature and promote moves for side * to play. Array TrPnt[ply] contains the index into Tree[] of the first move * at a ply. */ { register SHORT u, sq, xside; register struct leaf *node; register UCHAR *ppos, *pdir; SHORT i, piece, *PL, r7; xside = side ^ 1; TrP = &TrPnt[ply + 1]; *TrP = TrPnt[ply]; node = &Tree[*TrP]; r7 = rank7[side]; PL = PieceList[side]; #ifdef notdef sidebit = ((side == white) ? 0 : 0x80); killt[SwagHt | sidebit] += 5000; killt[Swag0 | sidebit] += 2000; killt[Swag1 | sidebit] += 60; killt[Swag2 | sidebit] += 50; killt[Swag3 | sidebit] += 40; killt[Swag4 | sidebit] += 30; #endif for (i = 0; i <= PieceCnt[side]; i++) { SHORT r = row(PieceList[xside][0]); SHORT c = column(PieceList[xside][0]); sq = PL[i]; piece = board[sq]; if (sweep[piece]) { ppos = nextpos[piece][sq]; pdir = nextdir[piece][sq]; u = ppos[sq]; do { if (color[u] == neutral) { if (piece == rook | piece == queen) { if(r == row(sq) || c == column(sq)) Link (sq, u, 0, -999);} else if(abs(r - row(sq)) == abs(c - column(sq)))Link (sq, u, 0, -999); u = ppos[u];} else { if (color[u] == xside) Link (sq, u, capture, value[board[u]] + svalue[u] - piece); u = pdir[u]; } } while (u != sq); } else { pdir = nextdir[ptype[side][piece]][sq]; if (piece == pawn && row (sq) == r7) { u = pdir[sq]; if (color[u] == xside){ Link (sq, u, capture | promote | queen, valueQ); #if !defined OLDXBOARD && !defined GNU3 && !defined CHESSTOOL Link (sq, u, capture | promote | knight, valueN); Link (sq, u, capture | promote | rook, valueR); Link (sq, u, capture | promote | bishop, valueB); #endif } u = pdir[u]; if (color[u] == xside) { Link (sq, u, capture | promote | queen, valueQ); #if !defined OLDXBOARD && !defined GNU3 && !defined CHESSTOOL Link (sq, u, capture | promote | knight, valueN); Link (sq, u, capture | promote | rook, valueR); Link (sq, u, capture | promote | bishop, valueB); #endif } ppos = nextpos[ptype[side][piece]][sq]; u = ppos[sq]; /* also generate non capture promote */ if (color[u] == neutral) { Link (sq, u, promote | queen, valueQ); #if !defined OLDXBOARD && !defined GNU3 && !defined CHESSTOOL Link (sq, u, promote | knight, valueN); Link (sq, u, promote | rook, valueR); Link (sq, u, promote | bishop, valueB); #endif } } else { u = pdir[sq]; do { if (color[u] == xside) Link (sq, u, capture, value[board[u]] + svalue[u] - piece); u = pdir[u]; } while (u != sq); } } } #ifdef notdef sidebit = ((side == white) ? 0 : 0x80); killt[SwagHt | sidebit] -= 5000; killt[Swag0 | sidebit] -= 2000; killt[Swag1 | sidebit] -= 60; killt[Swag2 | sidebit] -= 50; killt[Swag3 | sidebit] -= 40; killt[Swag4 | sidebit] -= 30; #endif SwagHt = 0; /* SwagHt is only used once */ } inline void VGenMoves (register SHORT ply, register SHORT sq, SHORT side, SHORT xside) /* * Generate moves for a piece. The moves are taken from the precalulated * array nextpos/nextdir. If the board is free, next move is choosen from * nextpos else from nextdir. */ { register SHORT u, piece; register UCHAR *ppos, *pdir; TrP = &TrPnt[ply + 1]; piece = board[sq]; ppos = nextpos[ptype[side][piece]][sq]; pdir = nextdir[ptype[side][piece]][sq]; if (piece == pawn) { u = ppos[sq]; /* follow no captures thread */ if (color[u] == neutral) { if (CheckMove (sq, u)) { LinkMove (ply, sq, u, 0, xside); } u = ppos[u]; if (color[u] == neutral) if (CheckMove (sq, u)) { LinkMove (ply, sq, u, 0, xside); } } u = pdir[sq]; /* follow captures thread */ if (color[u] == xside && board[u] != king) { if (CheckMove (sq, u)) { LinkMove (ply, sq, u, capture, xside); } } u = pdir[u]; if (color[u] == xside && board[u] != king) { if (CheckMove (sq, u)) { LinkMove (ply, sq, u, capture, xside); } } } else { u = ppos[sq]; do { if (color[u] == neutral) { if (CheckMove (sq, u)) { LinkMove (ply, sq, u, 0, xside); } u = ppos[u]; } else { if (color[u] == xside && board[u] != king) { if (CheckMove (sq, u)) { LinkMove (ply, sq, u, capture, xside); } } u = pdir[u]; } } while (u != sq); } } void VMoveList (SHORT side, register SHORT ply) /* * Fill the array Tree[] with all available moves for side to play. Array * TrPnt[ply] contains the index into Tree[] of the first move at a ply. */ { register SHORT i, xside, f; xside = side ^ 1; TrP = &TrPnt[ply + 1]; *TrP = TrPnt[ply]; InCheck = SqAtakd (PieceList[side][0], side ^ 1); #ifdef LEGAL if (!PV) Swag0 = killr0[ply]; else Swag0 = PV; Swag1 = killr1[ply]; Swag2 = killr2[ply]; Swag3 = killr3[ply]; if (ply > 2) Swag4 = killr1[ply - 2]; else Swag4 = 0; #ifdef KILLT sidebit = ((side == white) ? 0 : 0x80); killt[SwagHt | sidebit] += 5000; killt[Swag0 | sidebit] += 2000; killt[Swag1 | sidebit] += 60; killt[Swag2 | sidebit] += 50; killt[Swag3 | sidebit] += 40; killt[Swag4 | sidebit] += 30; #endif #ifdef HISTORY i = (side == black) ? 0x4000 : 0; history[SwagHt | i] += 5000; history[Swag0 | i] += 2000; history[Swag1 | i] += 60; history[Swag2 | i] += 50; history[Swag3 | i] += 40; history[Swag4 | i] += 30; #endif #endif for (i = PieceCnt[side]; i >= 0; i--) VGenMoves (ply, PieceList[side][i], side, xside); if (!castld[side]) { f = PieceList[side][0]; if (castle (side, f, f + 2, 0)) { LinkMove (ply, f, f + 2, cstlmask, xside); } if (castle (side, f, f - 2, 0)) { LinkMove (ply, f, f - 2, cstlmask, xside); } } if (epsquare > 0) { register SHORT l; f = epmove1[epsquare]; if (color[f] == side && board[f] == pawn) { l = epsquare + ((epsquare > f) ? -8 : 8); board[l] = no_piece; color[l] = neutral; if (CheckMove (f, epsquare)) { LinkMove (ply, f, epsquare, capture | epmask, xside); } board[l] = pawn; color[l] = xside; } f = epmove2[epsquare]; if (color[f] == side && board[f] == pawn) { l = epsquare + ((epsquare > f) ? -8 : 8); board[l] = no_piece; color[l] = neutral; if (CheckMove (f, epsquare)) { LinkMove (ply, f, epsquare, capture | epmask, xside); } board[l] = pawn; color[l] = xside; } } #ifdef LEGAL #ifdef KILLT killt[SwagHt | sidebit] -= 5000; killt[Swag0 | sidebit] -= 2000; killt[Swag1 | sidebit] -= 60; killt[Swag2 | sidebit] -= 50; killt[Swag3 | sidebit] -= 40; killt[Swag4 | sidebit] -= 30; #endif #ifdef HISTORY i = (side == black) ? 0x4000 : 0; history[SwagHt | i] -= 5000; history[Swag0 | i] -= 2000; history[Swag1 | i] -= 60; history[Swag2 | i] -= 50; history[Swag3 | i] -= 40; history[Swag4 | i] -= 30; #endif SwagHt = 0; /* SwagHt is only used once */ GenCnt += (TrPnt[ply + 1] - TrPnt[ply]); #endif } #ifdef LEGAL void VCaptureList (register SHORT side, SHORT ply) /* * Fill the array Tree[] with all available cature and promote moves for side * to play. Array TrPnt[ply] contains the index into Tree[] of the first move * at a ply. */ { register SHORT u, sq, xside; register struct leaf *node; register UCHAR *ppos, *pdir; SHORT i, piece, *PL, r7; xside = side ^ 1; InCheck = SqAtakd (PieceList[side][0], side ^ 1); TrP = &TrPnt[ply + 1]; *TrP = TrPnt[ply]; node = &Tree[*TrP]; r7 = rank7[side]; PL = PieceList[side]; #ifdef KILLT sidebit = ((side == white) ? 0 : 0x80); killt[SwagHt | sidebit] += 5000; killt[Swag0 | sidebit] += 2000; killt[Swag1 | sidebit] += 60; killt[Swag2 | sidebit] += 50; killt[Swag3 | sidebit] += 40; killt[Swag4 | sidebit] += 30; #endif for (i = 0; i <= PieceCnt[side]; i++) { SHORT r = row(PieceList[xside][0]); SHORT c = column(PieceList[xside][0]); sq = PL[i]; piece = board[sq]; if (sweep[piece]) { ppos = nextpos[piece][sq]; pdir = nextdir[piece][sq]; u = ppos[sq]; do { if (color[u] == neutral) { if (piece == rook | piece == queen) { if(r == row(sq) || c == column(sq)) Link (sq, u, NULL, -999);} else if(abs(r - row(sq)) == abs(c - column(sq)))Link (sq, u, NULL, -999); u = ppos[u];} else { if (color[u] == xside) Link (sq, u, capture, value[board[u]] + svalue[u] - piece); u = pdir[u]; } } while (u != sq); } else { pdir = nextdir[ptype[side][piece]][sq]; if (piece == pawn && row (sq) == r7) { u = pdir[sq]; if (color[u] == xside) { Link (sq, u, capture | promote | queen, valueQ); #if !defined OLDXBOARD && !defined GNU3 && !defined CHESSTOOL Link (sq, u, capture | promote | knight, valueN); Link (sq, u, capture | promote | rook, valueR); Link (sq, u, capture | promote | bishop, valueB); } #endif u = pdir[u]; if (color[u] == xside) { Link (sq, u, capture | promote | queen, valueQ); #if !defined OLDXBOARD && !defined GNU3 && !defined CHESSTOOL Link (sq, u, capture | promote | knight, valueN); Link (sq, u, capture | promote | rook, valueR); Link (sq, u, capture | promote | bishop, valueB); #endif } ppos = nextpos[ptype[side][piece]][sq]; u = ppos[sq]; /* also generate non capture promote */ if (color[u] == neutral) { Link (sq, u, promote | queen, valueQ); #if !defined OLDXBOARD && !defined GNU3 && !defined CHESSTOOL Link (sq, u, promote | knight, valueN); Link (sq, u, promote | rook, valueR); Link (sq, u, promote | bishop, valueB); #endif } } else { u = pdir[sq]; do { if (color[u] == xside) Link (sq, u, capture, value[board[u]] + svalue[u] - piece); u = pdir[u]; } while (u != sq); } } } #ifdef KILLT sidebit = ((side == white) ? 0 : 0x80); killt[SwagHt | sidebit] -= 5000; killt[Swag0 | sidebit] -= 2000; killt[Swag1 | sidebit] -= 60; killt[Swag2 | sidebit] -= 50; killt[Swag3 | sidebit] -= 40; killt[Swag4 | sidebit] -= 30; #endif SwagHt = 0; /* SwagHt is only used once */ } #endif /* LEGAL*/ gnuchess-4.0.pl70/src/Makefile.dos100644 21542 13 32334 5545562012 16037 0ustar cracraftuser# # Makefile for GNU Chess # # Copyright (c) 1992 Free Software Foundation # # This file is part of GNU CHESS. # # GNU Chess is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # # GNU Chess is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with GNU Chess; see the file COPYING. If not, write to # the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. # # # gnuchess is a curses-based chess. # gnuchessn is a fancy-display-curses-based chess. # gnuchessr is a plain dumb-terminal chess (but with full variation output) # gnuchessc is suitable for chesstool use (mimics /usr/games/chess output) # gnuchessx is the xchess based chess. # # The version number of this GNU and Xboard release VERS= 4.0 XVERS = 2.0 # Relevant file areas. DIST= ../README ../README.lang ../doc ../misc ../src ../test # Distribution directory DISTDIR=/tmp_mnt/home/fsf/cracraft/gnuchess-4.0 # Programs being distributed PROGS=gnuchess-$(VERS) xboard-$(XVERS) #PROGS=gnuchess-$(VERS) LIBS = # Change these to something less transitory, like /usr/games, and then # compile. Ask your system admin / unix guru to put gnuchess.{hash,lang,book} # in $(LIBDIR). # Where the binaries live. BINDIR= /games/gnu40/bin BINDIR1 = \games\gnu40\bin # Where language description, our book, and the persistent hash live. LIBDIR= /games/gnu40/misc LIBDIR1 = \games\gnu40\misc # Display routines. LCURSES=-lcurses -ltermcap #compile options for gnuchess # -DAG[0-4] selects a set of values for SpaceBonus tables # -DQUIETBACKGROUND don't print post information in background ( easy OFF) # -DNOMEMSET if your machine does not support memset # -DNOMATERIAL don't call it a draw when no pawns and both sides < rook # -DNODYNALPHA don't dynamically adjust alpha # -DHISTORY use history killer hueristic # -DKILLT use killt killer hueristic # -DHASGETTIMEOFDAY use gettimeofday for more accurate timing # -DCLIENT create client version for use with ICS # -DNOSCORESPACE don't use Scorespace heuristic # -DOLDXBOARD don't generate underpromote moves # -DGNU3 don't generate underpromote moves # -DLONG64 if you have 64bit longs # -DSYSV if you are using SYSV # -DCACHE Cache static evaluations # -DE4OPENING always open e4 if white and respond to e4 with e5 if black # -DQUIETBOOKGEN Don't print errors while loading a book or generating a binbook # -DSEMIQUIETBOOKGEN Print less verbose errors while reading book or generating binbook # -DGDX use random file based book # -DNULLMOVE include null move heuristic # some debug options # -DDEBUG8 dump board,movelist,input move to /tmp/DEBUG if illegal move # -DDEBUG9 dump move list from test command # -DDEBUG10 dump board and move after search before !easy begins # -DDEBUG11 dump board when the move is output # -DDEBUG12 dump boards between moves # -DDEBUG13 dump search control information for each move to /tmp/DEBUG # -DDEBUG40 include extra values of variables for debugging in game list # -DDEBUG41 dump post output to /tmp/DEBUG # the rest of the debug options are tied to the debuglevel command # -DDEBUG -DDEBUG4 set up code for debuglevel command # debuglevel # 1 always force evaluation in evaluate # 4 print move list after search # 8 print move list after book before search # 16 print move list after each ply of search # 32 print adds to transposition table # 64 print returns from transposition table lookups # 256 print search tree as it is generated # 512 debug trace # 1024 interactive tree print # debug? p# where # is no. of plys to print from top of tree (default all plys) # XXXX moves specifying branch of tree to print (default all branches) # return terminates input # 2048 non-interactive trace print # gnufour #OPT= -DHASGETTIMEOFDAY -DGNU3 -DHISTORY -DSEMIQUIETBOOKGEN -DQUIETBACKGROUND -DGDX -DNULLMOVE -DCACHE -DCLIENT # normal OPT= -DQUIETBACKGROUND -DGNU3 -DHISTORY -DGDX -DSEMIQUIETBOOKGEN -DNULLMOVE # The hashfile is a record of positions seen. It is used by # GNU Chess to avoid making the same mistakes, a form of learning. HASH= -DHASHFILE=\"$(LIBDIR)/gnuchess.hash\" # The "book" is a record of the first few moves, for playing good # moves easily and quickly, saving time, and irritating the human # opponent. #BOOK= -DBOOK=\"$(LIBDIR)/gnuchess.book\" BOOK= BINBOOK = -DBINBOOK=\"$(LIBDIR)/gnuchess.data\" # The language file describes capabilities of the program. Perhaps # it is useful for non-English speaking countries and customizing # for their convenience and chess happiness. LANG= -DLANGFILE=\"$(LIBDIR)/gnuchess.lang\" # The compiler used for compiling this software. # Use this for a plain C compiler #CC= cc $(OPT) # Use this for DEC's ANSI C compiler on Ultrix #CC= c89 $(OPT) # Use this if you are lucky enough to have GNU CC. #CC= gcc -W $(OPT) #CC= /contrib/system/bin/gcc -W $(OPT) # Use this if you are using Microsoft C 7.0 for MSDOS CC= cl # Miscellaneous CFLAGS. Uncomment the one you need and comment # the other. #CFLAGS= -p -Dinline="" -traditional-cpp #CFLAGS= -O4 -Qpath . # SunOS cc using unprotoize #CFLAGS= -O4 # Sun acc #CFLAGS= -g -traditional-cpp # debug #CFLAGS= -O2 # DEC ANSI C (c89) on Ultrix. #CFLAGS= +O3 -Aa -D_HPUX_SOURCE -DSYSV # HPUX cc #CFLAGS= -O -finline-functions -fstrength-reduce -D__mips -D__LANGUAGE_C # gnu cc 1.40 on DS5000 #CFLAGS= -O -finline-functions -fstrength-reduce # gnu cc 1.40 on others #CFLAGS= -O2 -funroll-loops -D__mips -D__LANGUAGE_C # gnu cc 2.00 on DS5000 #CFLAGS= -O2 -D__alpha -D__LANGUAGE_C # gnu cc 2.00 on Flamingo #CFLAGS= -O2 -funroll-loops -traditional-cpp # gnu cc 2.00 on SunOS #CFLAGS= -O2 -funroll-loops # gnu cc 2.00 on others CFLAGS= /AH /Ox /G2 /W3 $(OPT) # Microsoft C 7.0 all : gnuchess.exe gnuchesr.exe gnuchesn.exe postprint.exe gnuan.exe game.exe bincheckr.exe checkgame.exe gnuchess.exe: mainN.obj bookN.obj genmoveN.obj ataks.obj util.obj evalN.obj init.obj searchN.obj dspcomN.obj uxdsp.obj $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) /Fegnuchess.exe mainN.obj bookN.obj genmoveN.obj ataks.obj util.obj evalN.obj init.obj searchN.obj dspcomN.obj uxdsp.obj $(LIBS) /F 2000 << gnuan.exe: mainN.obj bookN.obj genmoveN.obj ataks.obj util.obj evalN.obj init.obj searchN.obj gnuan.obj $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) /Fegnuan.exe mainN.obj bookN.obj genmoveN.obj ataks.obj util.obj evalN.obj init.obj searchN.obj gnuan.obj $(LIBS) /F 2000 << Dgnuchesr.exe: mainDR.obj bookN.obj genmoveN.obj ataks.obj utilDR.obj evalDR.obj init.obj searchDR.obj dspcomDR.obj nondspDR.obj $(CC) @<< -DDEBUG -DDEBUG4 $(CFLAGS) $(HASH) $(LANG) $(BOOK) /Fe gnuchesr.exe mainDR.obj bookN.obj genmoveN.obj ataks.obj utilDR.obj evalDR.obj init.obj searchDR.obj dspcomDR.obj nondspDR.obj $(LIBS) /F 2000 << gnuchesr.exe: mainN.obj bookN.obj genmoveN.obj ataks.obj util.obj evalN.obj init.obj searchN.obj dspcomR.obj nondspR.obj $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) /Fegnuchesr.exe mainN.obj bookN.obj genmoveN.obj ataks.obj util.obj evalN.obj init.obj searchN.obj dspcomR.obj nondspR.obj /F 2000 << gnuchesn.exe: mainN.obj bookN.obj genmoveN.obj ataks.obj util.obj evalN.obj init.obj searchN.obj dspcomN.obj nuxdsp.obj $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) /Fegnuchesn.exe mainN.obj bookN.obj genmoveN.obj ataks.obj util.obj evalN.obj init.obj searchN.obj dspcomN.obj nuxdsp.obj /F 2000 << game.exe: game.c gnuchess.h $(CC) $(CFLAGS) game.c postprint.exe: postprint.obj $(CC) @<< $(CFLAGS) $(HASH) postprint.obj << bincheckr.exe: bincheckr.obj $(CC) $(CFLAGS) bincheckr.obj checkgame.exe: checkgame.obj $(CC) $(CFLAGS) checkgame.obj gnuan.obj: gnuan.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c gnuan.c << mainN.obj: main.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) $(BINBOOK) -c main.c << del mainN.obj rename main.obj mainN.obj mainDR.obj: main.c gnuchess.h version.h $(CC) @<< -DDEBUG -DDEBUG4 $(CFLAGS) $(HASH) $(LANG) $(BOOK) $(BINBOOK) \ -c main.c << del mainDR.obj rename main.obj mainDR.obj genmoveN.obj: genmove.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c genmove.c << del genmoveN.obj rename genmove.obj genmoveN.obj bookN.obj: book.c gnuchess.h version.h ataks.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) $(BINBOOK) -c book.c << del bookN.obj rename book.obj bookN.obj ataks.obj: ataks.h ataks.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c ataks.c << util.obj: util.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c util.c << evalN.obj: eval.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c eval.c << del evalN.obj rename eval.obj evalN.obj evalDR.obj: eval.c gnuchess.h version.h $(CC) @<< -DDEBUG4 -DDEBUG $(CFLAGS) $(HASH) $(LANG) $(BOOK) \ -c eval.c << del evalDR.obj rename eval.obj evalDR.obj utilDR.obj: util.c gnuchess.h version.h $(CC) @<< -DDEBUG4 -DDEBUG $(CFLAGS) $(HASH) $(LANG) $(BOOK) \ -c util.c << del utilDR.obj rename util.obj utilDR.obj init.obj: init.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c init.c << searchN.obj: search.c gnuchess.h version.h debug512.h debug10.h debug13.h debug16.h debug256.h debug4.h debug40.h debug41.h debug64.h debug8.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c search.c << del searchN.obj rename search.obj searchN.obj searchDR.obj: search.c gnuchess.h version.h debug512.h debug10.h debug13.h debug16.h debug256.h debug4.h debug40.h debug41.h debug64.h debug8.h $(CC) @<< -DDEBUG4 -DDEBUG $(CFLAGS) $(HASH) $(LANG) $(BOOK) \ -c search.c << del searchDR.obj rename search.obj searchDR.obj uxdsp.obj: uxdsp.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c uxdsp.c << nuxdsp.obj: nuxdsp.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c nuxdsp.c << nondspR.obj: nondsp.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -DNONDSP \ -c nondsp.c << del nondspR.obj rename nondsp.obj nondspR.obj nondspDR.obj: nondsp.c gnuchess.h version.h $(CC) @<< -DDEBUG4 -DDEBUG $(CFLAGS) $(HASH) $(LANG) $(BOOK) -DNONDSP \ -c nondsp.c << del nondspDR.obj rename nondsp.obj nondspDR.obj dspcomN.obj: dspcom.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -c dspcom.c << del dspcomN.obj rename dspcom.obj dspcomN.obj dspcomR.obj: dspcom.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) $(LANG) $(BOOK) -DNONDSP \ -c dspcom.c << del dspcomR.obj rename dspcom.obj dspcomR.obj dspcomDR.obj: dspcom.c gnuchess.h version.h $(CC) @<< -DDEBUG -DDEBUG4 $(CFLAGS) $(HASH) $(LANG) $(BOOK) -DNONDSP \ -c dspcom.c << del dspcomDR.obj rename dspcom.obj dspcomDR.obj postprint.obj: postprint.c gnuchess.h version.h $(CC) @<< $(CFLAGS) $(HASH) -c postprint.c << distribution: -patchlevel=`cat $(DISTDIR)/gnuchess-$(VERS)/src/version.h|grep patchlevel|sed -e 's/[^0-9]//g'` ;\ echo "GNU patchlevel is $$patchlevel" ;\ xpatchlevel=`cat $(DISTDIR)/xboard-$(XVERS)/patchlevel.h|sed -e "s/#define PATCHLEVEL //"` ;\ cd $(DISTDIR) ;\ rm -f gnuchess.tar.$(VERS).Z* gnuchess.tar.$(VERS).Z.uu* ;\ tar cf - $(PROGS) | compress > $(DISTDIR)/gnuchess-$(VERS).pl$$patchlevel.tar.Z ;\ uuencode gnuchess-$(VERS).pl$$patchlevel.tar.Z gnuchess-$(VERS).pl$$patchlevel.tar.Z > gnuchess-$(VERS).pl$$patchlevel.tar.Z.uu ;\ rm -f x?? ;\ split -2500 gnuchess-$(VERS).pl$$patchlevel.tar.Z.uu ;\ for i in x??; do \ rename $$i $(DISTDIR)/GNU_Chess_$$i; \ done install: -copy gnuchesr.exe $(BINDIR1)\gnuchesr.exe -copy gnuchesn.exe $(BINDIR1)\gnuchesn.exe -copy postprint.exe $(BINDIR1)\postprint.exe -copy gnuan.exe $(BINDIR1)\gnuan.exe -copy gnuchess.exe $(BINDIR1)\gnuchess.exe -copy bincheckr.exe $(BINDIR1)\bincheckr.exe -copy checkgame.exe $(BINDIR1)\checkgame.exe -copy ../misc/gnuchess.book $(LIBDIR1)\gnuchess.book -copy ../misc/gnuchess.lang $(LIBDIR1)\gnuchess.lang clean: -rm -f gnuchessx gnuchessc gnuchess gnuchessr gnuchessn gnuchessd postprint gnuan bincheckr checkgame game -echo $(DISTDIR) -rm -f $(DISTDIR)/gnuchess-4.0/misc/gnuchess.book.data -find $(DISTDIR) \( -name '*.obj' -o -name '*~' -o -name 'CL*' -o -name 'PATCH*' -o -name '#*#' -o -name '%*%' -o -name '*orig' \) -exec rm -f {} \; gnuchess-4.0.pl70/src/gnuan.c100444 21542 13 72160 5563700645 15074 0ustar cracraftuser/* * gnuan.c - Analysis interface for gnuchess. * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ /* * This is a front end for a chess analysis program. It takes a file of * moves in algebraic notation and creates a file containing each move that * was made, the move it would have made, the score it would give itself * after making the move it recommended, and the depth it searched for the * move. * * This is a modification of nondsp.c. I have cut out code that was not needed * for this application such as the help and edit functions. Most of the * modifications were done in InputCommand. */ /* * This file will generate two different analysis programs. One is meant to * be run as a background process inwhich the in and out files are * predefined. The other is meant to be run in the foreground where it will * prompt you for the name of the file with the game in it, the maximum depth * the search should be conducted to and the time limit per move. It would * be nice to be able to give these parameters on the command line, but that * would mean changing main which is in the gnuchess.c file. * * For each move it will analyse the move until either it has run out of time or * it has reached the maximum depth. * * To build the version for background processing define BACKGROUND_ANALYSIS * either at the top of this file, or in compilation. The files and depth * used are defined below. They are MAX_DEPTH, MAX_TIME, OUT_FILE, IN_FILE * and PROG_FILE. The PROG_FILE is a file that will be updated as each move * is analysed so you can check its progress. This is only updated when * running the BACKGROUND_ANALYSIS version. In the version where the * filename and depth are entered at runtime, the output goes to stdout. */ /*#define BACKGROUND_ANALYSIS 0*/ #define MAX_DEPTH MAXDEPTH #define MAX_TIME 10 #define OUT_FILE "gnuan.out" #define IN_FILE "gnuan.in" #define PROG_FILE "gnuan.prog" #include #include #include #include #ifdef MSDOS #include #include #include #include #include #else #include #include #include #ifndef AMIGADOS #include #endif void TerminateSearch (int), Die (int); #define O_BINARY 0 #endif /* MSDOS */ #include "gnuchess.h" #include "ttable.h" #include "ataks.h" #undef rxx #undef cxx #undef scanz #undef printz #define rxx "12345678" #define cxx "abcdefgh" #define scanz scanf #define printz printf extern CHAR *ColorStr[2]; int mycnt1, mycnt2; char mvstr[5][7]; static FILE *fpin; static FILE *fpout; int samedepth = false; CHAR *DRAW; UTSHORT MV[MAXDEPTH]; enum { XBOARD, GNUCHESS, OTHER } InFileType; CHAR InBuf[256]; #ifdef BACKGROUND_ANALYSIS static FILE *fpprog; #endif static CHAR white_actual_move[20]; static CHAR black_actual_move[20]; static CHAR white_suggest_move[20]; static CHAR black_suggest_move[20]; static int sdw,sdb; static int white_score; static int black_score; int tmpscore; static int white_moving; static int current_depth; static int current_score; static int enable_update_display = 0; int move_number = 1; int CheckBook (SHORT side, CHAR *s); void Initialize (void) { mycnt1 = mycnt2 = 0; } void ExitChess (void) { ListGame (); exit (0); } #ifndef MSDOS /* never called!!! */ void Die (int sig) { ExitChess (); } #endif /* MSDOS */ void TerminateSearch (int sig) { #ifdef MSDOS sig++; /* shut up the compiler */ #endif /* MSDOS */ if (!flag.timeout) flag.musttimeout = true; flag.bothsides = false; } void algbr (SHORT f, SHORT t, SHORT flag) /* * Generate move strings in different formats. */ { int m3p; if (f != t) { /* algebraic notation */ mvstr[0][0] = cxx[column (f)]; mvstr[0][1] = rxx[row (f)]; mvstr[0][2] = cxx[column (t)]; mvstr[0][3] = rxx[row (t)]; mvstr[0][4] = mvstr[3][0] = '\0'; if (((mvstr[1][0] = pxx[board[f]]) == 'P') || (flag & promote)) { if (mvstr[0][0] == mvstr[0][2]) /* pawn did not eat */ { mvstr[2][0] = mvstr[1][0] = mvstr[0][2]; /* to column */ mvstr[2][1] = mvstr[1][1] = mvstr[0][3]; /* to row */ m3p = 2; } else /* pawn ate */ { mvstr[2][0] = mvstr[1][0] = mvstr[0][0]; /* from column */ mvstr[2][1] = mvstr[1][1] = mvstr[0][2]; /* to column */ mvstr[2][2] = mvstr[0][3]; m3p = 3; /* to row */ } mvstr[2][m3p] = mvstr[1][2] = '\0'; if (flag & promote) { mvstr[0][4] = mvstr[1][2] = mvstr[2][m3p] = qxx[flag & pmask]; mvstr[1][3] = mvstr[2][m3p + 1] = mvstr[0][5] = '\0'; } } else /* not a pawn */ { mvstr[2][0] = mvstr[1][0]; mvstr[2][1] = mvstr[0][1]; mvstr[2][2] = mvstr[1][1] = mvstr[0][2]; /* to column */ mvstr[2][3] = mvstr[1][2] = mvstr[0][3]; /* to row */ mvstr[2][4] = mvstr[1][3] = '\0'; strcpy (mvstr[3], mvstr[2]); mvstr[3][1] = mvstr[0][0]; if (flag & cstlmask) { if (t > f) { strcpy (mvstr[1], "o-o"); strcpy (mvstr[2], "O-O"); strcpy (mvstr[2], "0-0"); } else { strcpy (mvstr[1], "o-o-o"); strcpy (mvstr[2], "O-O-O"); strcpy (mvstr[2], "0-0-0"); } } } } else mvstr[0][0] = mvstr[1][0] = mvstr[2][0] = mvstr[3][0] = '\0'; } int strxcmp(char *sx, char *sbase) /* * Compare strings sx and sbase, but ignore any 'x' characters * found in sx. This kludge lets gnuan parse notation with "x" * for capture. */ { for (;;) { if (*sx == 'x') sx++; if (*sx == '\0') { if (*sbase == '\0') return 0; else return -1; } if (*sx < *sbase) return -1; else if (*sx > *sbase) return 1; sx++; sbase++; } } int VerifyMove (CHAR *s, SHORT iop, UTSHORT *mv) /* * Compare the string 's' to the list of legal moves available for the * opponent. If a match is found, make the move on the board. */ { static SHORT pnt, tempb, tempc, tempsf, tempst, cnt; static struct leaf xnode; struct leaf *node; *mv = 0; if (iop == 2) { UnmakeMove (opponent, &xnode, &tempb, &tempc, &tempsf, &tempst); return (false); } cnt = 0; MoveList (opponent, 2); pnt = TrPnt[2]; while (pnt < TrPnt[3]) { node = &Tree[pnt++]; algbr (node->f, node->t, (SHORT) node->flags); if (strxcmp (s, mvstr[0]) == 0 || strxcmp (s, mvstr[1]) == 0 || strxcmp (s, mvstr[2]) == 0 || strxcmp (s, mvstr[3]) == 0) { cnt++; xnode = *node; } } if (cnt == 1) { MakeMove (opponent, &xnode, &tempb, &tempc, &tempsf, &tempst, &INCscore); if (SqAtakd (PieceList[opponent][0], computer)) { UnmakeMove (opponent, &xnode, &tempb, &tempc, &tempsf, &tempst); printz ("Illegal move\n"); return (false); } else { if (iop == 1) return (true); /* * UpdateDisplay (xnode.f, xnode.t, 0, (SHORT) xnode.flags); */ if ((board[xnode.t] == pawn) || (xnode.flags & capture) || (xnode.flags & cstlmask)) { Game50 = GameCnt; ZeroRPT (); } GameList[GameCnt].depth = GameList[GameCnt].score = 0; GameList[GameCnt].nodes = 0; ElapsedTime (1); GameList[GameCnt].time = (SHORT) et; TimeControl.clock[opponent] -= et; --TimeControl.moves[opponent]; *mv = (xnode.f << 8) | xnode.t; algbr (xnode.f, xnode.t, false); return (true); } } #ifdef CHESSTOOL printz ("Illegal move\n"); #else if (cnt > 1) ShowMessage ("Ambiguous Move!"); #endif if(cnt == 0){ pnt = TrPnt[2]; while (pnt < TrPnt[3]) { node = &Tree[pnt++]; algbr (node->f, node->t, (SHORT) node->flags); printf("%s -> %s\n",s,mvstr[0]); } } return (false); } void help (void) { } void EditBoard (void) /* * Set up a board position. Pieces are entered by typing the piece followed * by the location. For example, Nf3 will place a knight on square f3. */ { } void SetupBoard (void) /* * Compatibility with Unix chess and the nchesstool. Set up a board position. * Eight lines of eight characters are used to setup the board. a8-h8 is the * first line. Black pieces are represented by uppercase characters. */ { } void ShowDepth (CHAR ch) { #ifdef MSDOS ch++; /* shut up the compiler */ #endif /* MSDOS */ } void ShowLine (UTSHORT *bstline) { register int i; for (i = 1; bstline[i] > 0; i++) { if ((i > 1) && (i % 8 == 1)) printf ("\n "); algbr ((SHORT) (bstline[i] >> 8), (SHORT) (bstline[i] & 0xFF), false); printf ("%5s ", mvstr[0]); } printf ("\n"); } void ShowResults (SHORT score, UTSHORT *bstline, CHAR ch) { int i; if (flag.post) { ElapsedTime (2); printf ("%2d%c %6d %4ld %8ld ", Sdepth, ch, score, et / 100, NodeCnt); ShowLine (bstline); } current_score = score; current_depth = Sdepth; for (i = 1; bstline[i] > 0; i++) { MV[i] = bstline[i]; } MV[i] = 0; } void SearchStartStuff (SHORT side) { signal (SIGINT, TerminateSearch); #ifndef MSDOS signal (SIGQUIT, TerminateSearch); #endif /* MSDOS */ if (flag.post) { fprintf (stderr, "\nMove# %d Target= %ld Clock: %ld\n", move_number, ResponseTime, TimeControl.clock[side]); } } void OutputMove (void) { if (white_moving) { strcpy (white_suggest_move, mvstr[0]); white_score = current_score; } else { strcpy (black_suggest_move, mvstr[0]); black_score = current_score; } } #ifdef HASGETTIMEOFDAY #include void ElapsedTime (SHORT iop) /* * Determine the time that has passed since the search was started. If the * elapsed time exceeds the target (ResponseTime+ExtraTime) then set timeout * to true which will terminate the search. iop = 0 calculate et bump ETnodes * iop = 1 calculate et set timeout if time exceeded, calculate et */ { struct timeval tv; #ifndef MSDOS int nchar; extern int errno; int i; #ifdef FIONREAD if (i = ioctl ((int) 0, FIONREAD, &nchar)) { perror ("FIONREAD"); fprintf (stderr, "You probably have a non-ANSI ; see README. %d %d %x\n", i, errno, FIONREAD); exit (1); } if (nchar) { if (!flag.timeout) flag.back = true; flag.bothsides = false; } #endif /*FIONREAD*/ #else if (kbhit ()) { if (!flag.timeout) flag.back = true; flag.bothsides = false; } #endif /* MSDOS */ gettimeofday(&tv,NULL); et = (tv.tv_sec*100+(tv.tv_usec/10000)) - time0; ETnodes = NodeCnt + ZNODES; if (et < 0) et = 0; if (iop == 1) { if (et > ResponseTime + ExtraTime && Sdepth > MINDEPTH) flag.timeout = true; ETnodes = NodeCnt + ZNODES; gettimeofday(&tv,NULL); time0 = tv.tv_sec*100+tv.tv_usec/10000; } } #else void ElapsedTime (SHORT iop) /* * Determine the time that has passed since the search was started. If the * elapsed time exceeds the target (ResponseTime+ExtraTime) then set timeout * to true which will terminate the search. iop = 0 calculate et bump ETnodes * iop = 1 calculate et set timeout if time exceeded, calculate et */ { #ifndef MSDOS int nchar; extern int errno; int i; #ifdef FIONREAD if (i = ioctl ((int) 0, FIONREAD, &nchar)) { perror ("FIONREAD"); fprintf (stderr, "You probably have a non-ANSI ; see README. %d %d %x\n", i, errno, FIONREAD); exit (1); } if (nchar) { if (!flag.timeout) flag.back = true; flag.bothsides = false; } #endif /*FIONREAD*/ #else if (kbhit ()) { if (!flag.timeout) flag.back = true; flag.bothsides = false; } #endif /* MSDOS */ et = (time ((long *) 0) - time0) * 100; ETnodes = NodeCnt + ZNODES; if (et < 0) et = 0; if (iop == 1) { if (et > ResponseTime + ExtraTime && Sdepth > MINDEPTH) flag.timeout = true; ETnodes = NodeCnt + ZNODES; time0 = time ((long *) 0); } } #endif #ifdef notdef void ElapsedTime (SHORT iop) /* * Determine the time that has passed since the search was started. If the * elapsed time exceeds the target (ResponseTime+ExtraTime) then set timeout * to true which will terminate the search. */ { et = (time ((long *) 0) - time0) * 100; /* et = (clock ()/CLOCKS_PER_SEC - time0) * 100;*/ if (et < 0) et = 0; ETnodes += ZNODES; if (iop == 1) { if (et > ResponseTime + ExtraTime && Sdepth > 1) flag.timeout = true; time0 = time ((long *) 0); /* time0 = clock () / CLOCKS_PER_SEC;*/ ETnodes = NodeCnt + ZNODES; } } #endif void SetTimeControl (void) { if (TCflag) { TimeControl.moves[white] = TimeControl.moves[black] = TCmoves; TimeControl.clock[white] = TimeControl.clock[black] = 6000L * TCminutes; } else { TimeControl.moves[white] = TimeControl.moves[black] = 0; TimeControl.clock[white] = TimeControl.clock[black] = 0; MaxResponseTime = 6000L * TCminutes; } et = 0; ElapsedTime (1); } void ClrScreen (void) { #ifndef CHESSTOOL printz ("\n"); #endif } void UpdateDisplay (SHORT f, SHORT t, SHORT redraw, SHORT isspec) { #ifndef CHESSTOOL SHORT r, c, l; if (!enable_update_display) return; if (redraw) { fprintf (fpout, "\n"); for (r = 7; r >= 0; r--) { for (c = 0; c <= 7; c++) { l = locn (r, c); if (color[l] == neutral) fprintf (fpout, " -"); else if (color[l] == white) fprintf (fpout, " %c", qxx[board[l]]); else fprintf (fpout, " %c", pxx[board[l]]); } fprintf (fpout, "\n"); } fprintf (fpout, "\n"); } #endif /* CHESSTOOL */ #ifdef MSDOS f++; t++; isspec++; /* shut up the compiler */ #endif /* MSDOS */ } void GetGame (void) { } void SaveGame (void) { } void ListGame (void) { } void Undo (void) /* * Undo the most recent half-move. */ { SHORT f, t; f = GameList[GameCnt].gmove >> 8; t = GameList[GameCnt].gmove & 0xFF; if (board[t] == king && distance (t, f) > 1) (void) castle (GameList[GameCnt].color, f, t, 2); else { /* Check for promotion: */ if (GameList[GameCnt].flags & promote) { board[t] = pawn; } board[f] = board[t]; color[f] = color[t]; board[t] = GameList[GameCnt].piece; color[t] = GameList[GameCnt].color; if (color[t] != neutral) Mvboard[t]--; Mvboard[f]--; } if (GameList[GameCnt].flags & epmask) EnPassant (otherside[color[f]], f, t, 2); else InitializeStats (); epsquare = GameList[GameCnt].epssq; if (TCflag && (TCmoves>1)) ++TimeControl.moves[color[f]]; hashkey = GameList[GameCnt].hashkey; hashbd = GameList[GameCnt].hashbd; GameCnt--; computer = computer ^ 1; opponent = opponent ^ 1; flag.mate = false; Sdepth = 0; player = player ^ 1; /* ShowSidetoMove (); UpdateDisplay (0, 0, 1, 0); */ if (flag.regularstart) Book = BOOKFAIL; } #ifdef notdef void Undo (void) /* * Undo the most recent half-move. */ { SHORT f, t; f = GameList[GameCnt].gmove >> 8; t = GameList[GameCnt].gmove & 0xFF; if (board[t] == king && distance (t, f) > 1) (void) castle (GameList[GameCnt].color, f, t, 2); else { /* Check for promotion: */ if (GameList[GameCnt].flags & promote) { board[t] = pawn; } board[f] = board[t]; color[f] = color[t]; board[t] = GameList[GameCnt].piece; color[t] = GameList[GameCnt].color; if (color[t] != neutral) Mvboard[t]--; Mvboard[f]--; } if (GameList[GameCnt].flags & epmask) EnPassant (color[t], f, t, 2); if (TCflag) ++TimeControl.moves[color[f]]; GameCnt--; computer = otherside[computer]; opponent = otherside[opponent]; flag.mate = false; Sdepth = 0; InitializeStats (); } #endif void ShowMessage (CHAR *s) { fprintf (stderr, "%s\n", s); } void ShowSidetoMove (void) { } void PromptForMove (void) { #ifndef CHESSTOOL printz ("\nYour move is? "); #endif /* CHESSTOOL */ } void ShowCurrentMove (SHORT pnt, SHORT f, SHORT t) { #ifdef MSDOS f++; t++; pnt++; /* shut up the compiler */ #endif /* MSDOS */ } void ChangeAlphaWindow (void) { printz ("window: "); } void ChangeBetaWindow (void) { printz ("window: "); } void GiveHint (void) { algbr ((SHORT) (hint >> 8), (SHORT) (hint & 0xFF), false); fprintf (stderr, "Hint: %s\n", mvstr[0]); } void SelectLevel (CHAR *sx) { } void ChangeSearchDepth (void) { printz ("depth= "); scanz ("%hd", &MaxSearchDepth); } void SetContempt (void) { printz ("contempt= "); scanz ("%hd", &contempt); } void ChangeXwindow (void) { printz ("xwndw= "); scanz ("%hd", &xwndw); } void TestSpeed (void (*f) (SHORT side, SHORT ply)) { SHORT i; long cnt, rate, t1, t2; t1 = time (0); for (i = 0; i < 10000; i++) { f (opponent, 2); } t2 = time (0); cnt = 10000L * (TrPnt[3] - TrPnt[2]); rate = cnt / (t2 - t1); printz ("Nodes= %ld Nodes/sec= %ld\n", cnt, rate); } int GetNextMove (CHAR *buffer) { CHAR cbuf[128]; CHAR sdepth[128]; int sdindex; CHAR *p,*q; sdw = sdb =0; black_actual_move[0] = '\0'; white_actual_move[0] = '\0'; if(fgets(cbuf,sizeof(cbuf),fpin) != NULL){ p = cbuf; for(;*p;p++){ if(isalpha(*p)){ q = white_actual_move; while(*p != ' ' && *p != '\n') *q++ = *p++; *q = '\0'; if(strcmp(white_actual_move,"Book")==0) continue; else break; break; } } if(*p == '\0' && white_actual_move[0] == '\0')return 0; if(InFileType == GNUCHESS){ if(samedepth){ sdindex = 0; while (*p == ' ' || *p == '\n') p++; while (*p != ' ' && *p != '\0') p++; while (*p == ' ' || *p == '\n')p++; while (*p != ' ' && *p != '\n') sdepth[sdindex++] = *p++; sdepth[sdindex] = '\0'; if(strcmp(sdepth,"Book")==0){sdw = -99;for(;*p!=' ';p++);} else sdw = atoi(sdepth); } } for(;*p;p++){ if(isalpha(*p)){ q = black_actual_move; while(*p != ' ' && *p != '\n') *q++ = *p++; *q = '\0'; if(strcmp(black_actual_move,"Book")==0) continue; else break; } } if(*p == '\0' && black_actual_move[0] == '\0')return 1; if(InFileType == GNUCHESS){ if(samedepth){ sdindex = 0; while (*p == ' ' || *p == '\n') p++; while (*p != ' ' && *p != '\0') p++; while (*p == ' ' || *p == '\n')p++; while (*p != ' ' && *p != '\n') sdepth[sdindex++] = *p++; sdepth[sdindex] = '\0'; if(strcmp(sdepth,"Book")==0){sdb = -99;for(;*p!=' ';p++);} else sdb = atoi(sdepth); } } return 1; } else /* EOF */ return -1; } void InputCommand (void) /* * Open the file of moves to analyse. Go through the file move by move and * do the following for each move. See what gnuchess would have done in that * position. Record the move it would have made along with the score it * would have given and the search depth. Take back its move. Force the move * that was actually made. Keep track of statistics such as how many moves * agreed. */ { int i; SHORT ok, inbook; UTSHORT mv; CHAR s[80]; int search_depth; #if !defined BACKGROUND_ANALYSIS int max_minutes; int max_seconds; CHAR inbuf[256]; #else CHAR outfilename[255]; CHAR progfilename[255]; #endif CHAR infilename[255]; long start_time, end_time, elapsed_time; int total_black_moves, total_white_moves; int same_black_moves, same_white_moves; float white_percent, black_percent; /* Initialize necessary variables. */ flag.quit = false; flag.beep = false; flag.post = true; player = opponent; enable_update_display = 1; ft = 0; Book = false; total_black_moves = 0; total_white_moves = 0; same_black_moves = 0; same_white_moves = 0; #ifdef BACKGROUND_ANALYSIS /* * Set the in files to standard ones for analysis if background * processing selected. */ strcpy (infilename, IN_FILE); strcpy (outfilename, OUT_FILE); strcpy (progfilename, PROG_FILE); fpout = fopen (outfilename, "w"); if (fpout == NULL) { fprintf (fpout, "This file does not exist : %s\n", outfilename); flag.quit = 1; return; } MaxSearchDepth = search_depth = MAX_DEPTH; TCminutes = MAX_TIME; #else /* Request information on where the file is and the depth an time. */ fpout = stderr; fprintf (fpout, "Input the file with the algebraic moves of the game.\n"); fflush(fpout); gets (infilename); fprintf (fpout, "\n"); do { fprintf (fpout, "Input the search depth you want to use. (1 to 29)(- for depth from file)\n"); gets (inbuf); search_depth = atoi (inbuf); if(search_depth < 0) {samedepth = true; search_depth = -search_depth;} } while (search_depth < 1 || search_depth > 29); MaxSearchDepth = search_depth; fprintf (fpout, "\n"); max_minutes = max_seconds = 0; do { fprintf (fpout, "Input the maximum number of minutes per move you want to use.\n"); gets (inbuf); max_minutes = atoi (inbuf); if(max_minutes < 0){max_seconds = -max_minutes;max_minutes=0;} } while ((max_minutes+max_seconds) < 1); printf ("\nYou will search to %d half moves\n", search_depth); printf ("\nWith no search taking more than %d minutes\n",max_minutes); TCminutes = max_minutes; fprintf (fpout, "\n\n"); #endif fpin = fopen (infilename, "r"); if (fpin == NULL) { fprintf (fpout, "This file does not exist : %s\n", infilename); flag.quit = 1; return; } /* lets find out about this file */ fgets (InBuf, 256, fpin); InFileType = OTHER; if (!strncmp (InBuf, "xboard", 6) || !strncmp (InBuf, "# xboard", 8)) { InFileType = XBOARD; fgets (InBuf, 256, fpin); fgets (InBuf, 256, fpin); } else if (!strncmp (InBuf, "gnuchess", 6)) { InFileType = GNUCHESS; fgets (InBuf, 256, fpin); } else rewind (fpin); TCmoves = 1; TCflag = (TCmoves > 1); /* flag.onemove = true; */ OperatorTime = 0; SetTimeControl (); fprintf (fpout, "Move White Black Score Depth Best Line\n"); fprintf (fpout, "------------------------------------------------------------------\n"); #ifdef BACKGROUND_ANALYSIS /* * Update progress in the progress file if this is running in the * background. */ fpprog = fopen (progfilename, "w"); fprintf (fpprog, "Done with move #%d.\n", move_number - 1); fclose (fpprog); #endif time (&start_time); while (1) { opponent = black; computer = white; player = computer; white_moving = 1; if (!GetNextMove (s)) { flag.quit = 1; break; } if(sdw == -99) MaxSearchDepth = search_depth; else MaxSearchDepth = (sdw)?sdw:search_depth; if (!strcmp (white_actual_move, "Black") || !strcmp (white_actual_move, "White") || !strcmp (white_actual_move, "draw")) break; inbook = CheckBook (white, white_actual_move); if (!inbook) { flag.force = 0; SelectMove (computer, 1); Undo (); SetTimeControl (); flag.force = 1; } opponent = white; computer = black; player = opponent; ok = VerifyMove (white_actual_move, 0, &mv); #ifdef notdef ExaminePosition (); tmpscore = ScorePosition (white); #endif if (!ok) { fprintf (fpout, "\nBad move. %s Board position is: \n", white_actual_move); UpdateDisplay (0, 0, 1, 0); flag.quit = 1; break; } else if (inbook) { fprintf (fpout, "%3d %-9s - - book\n", move_number,white_actual_move); fflush (fpout); move_number++; Sdepth = 0; ft = 0; } else { CHAR x[80]; strcpy (x, white_actual_move); if (strcmp (white_actual_move, white_suggest_move)) strcat (x, "*"); #ifdef notdef fprintf (fpout, "%3d %-9s %5d%5d%5d ", move_number, x,tmpscore, white_score, current_depth); #endif if(sdw == -99) fprintf (fpout, "%3d %-9s %5d Book ", move_number, x, white_score, current_depth); else fprintf (fpout, "%3d %-9s %5d%5d ", move_number, x, white_score, current_depth); for (i = 1; MV[i] > 0; i++) { algbr ((SHORT) (MV[i] >> 8), (SHORT) (MV[i] & 0xFF), false); fprintf (fpout,"%5s ", mvstr[0]); } fprintf (fpout,"\n"); fflush (fpout); move_number++; total_white_moves++; if (!strcmp (white_actual_move, white_suggest_move)) same_white_moves++; Sdepth = 0; ft = 0; } player = computer; white_moving = 0; if(sdb == -99) MaxSearchDepth = search_depth; else MaxSearchDepth = (sdb)?sdb:search_depth; if (!strcmp (black_actual_move, "Black") || !strcmp (black_actual_move, "White") || !strcmp (black_actual_move, "draw")) break; inbook = CheckBook (black, black_actual_move); if (!inbook) { flag.force = 0; SelectMove (computer, 1); Undo (); SetTimeControl (); flag.force = 1; } opponent = black; computer = white; player = opponent; ok = VerifyMove (black_actual_move, 0, &mv); #ifdef notdef ExaminePosition (); tmpscore = ScorePosition (black); #endif if (!ok) { fprintf (fpout, "\nBad move. %s Board position is: \n", s); UpdateDisplay (0, 0, 1, 0); flag.quit = 1; break; } else if (inbook) { fprintf (fpout, " %-9s - - book\n",black_actual_move); fflush (fpout); Sdepth = 0; ft = 0; } else { CHAR x[8]; strcpy (x, black_actual_move); if (strcmp (black_actual_move, black_suggest_move)) strcat (x, "*"); #ifdef notdef fprintf (fpout, " %-9s%5d%5d%5d ", x,tmpscore, black_score, current_depth); #endif if(sdb == -99) fprintf (fpout, " %-9s%5d Book ", x, black_score, current_depth); else fprintf (fpout, " %-9s%5d%5d ", x, black_score, current_depth); for (i = 1; MV[i] > 0; i++) { algbr ((SHORT) (MV[i] >> 8), (SHORT) (MV[i] & 0xFF), false); fprintf (fpout,"%5s ", mvstr[0]); } fprintf (fpout,"\n"); fflush (fpout); total_black_moves++; if (!strcmp (black_actual_move, black_suggest_move)) same_black_moves++; Sdepth = 0; ft = 0; } #ifdef BACKGROUND_ANALYSIS /* * Update progress in the progress file if this is running in the * background. */ fpprog = fopen (progfilename, "w"); fprintf (fpprog, "Done with move #%d.\n", move_number - 1); fclose (fpprog); #else /* * fprintf(stderr, "Done with move #%d.\n", move_number-1); */ #endif } white_percent = ((float) same_white_moves) * 100 / (float) total_white_moves; black_percent = ((float) same_black_moves) * 100 / (float) total_black_moves; fprintf (fpout, "\n White's percentage was %5.2f%%. Black's percentage was %5.2f%%.\n", white_percent, black_percent); time (&end_time); elapsed_time = end_time - start_time; fprintf (fpout, "\n Elapsed time was %d seconds.\n", elapsed_time); fclose (fpin); fclose (fpout); exit (0); } #ifdef GDM int CheckBook (SHORT side, CHAR *s) { return false; } #elif defined GDX #ifdef LONG64 #define lts(x) (((x>>48)&0xfffe)|side) #else #define lts(x) (((x>>16)&0xfffe)|side) #endif int CheckBook (SHORT side, CHAR *s) { /* * Check to see if the move in char *s can be found in the book. */ struct gdxadmin { unsigned int bookcount; unsigned int booksize; unsigned long maxoffset; } d; struct gdxdata { unsigned long hashbd; utshort hashkey; utshort bmove; utshort hint; utshort count; } a; unsigned long currentoffset; int gfd = -1; UTSHORT m = 0; CHAR *binbookfile = BINBOOK; unsigned long bhashkey, bhashbd; SHORT flag; bhashkey = hashkey; bhashbd = hashbd; if ((gfd = open (binbookfile, O_RDONLY | O_BINARY)) == -1) return false; read (gfd, &d, sizeof (struct gdxadmin)); currentoffset = (unsigned long) (bhashkey % d.booksize) * sizeof (struct gdxdata) + sizeof (struct gdxadmin); while (true) { lseek (gfd, currentoffset, SEEK_SET); if (read (gfd, &a, sizeof (struct gdxdata)) == 0) break; if (a.bmove == 0) break; if (a.hashkey == (unsigned short)(lts(bhashkey)) && a.hashbd == bhashbd) { m = a.bmove & (~LASTMOVE) & (~BADMOVE); flag = 0; if (toupper(s[0]) == 'O') flag |= cstlmask; /*assume castling*/ algbr (m >> 8, m & 0xFF, flag); if (strcmp (s, mvstr[0]) == 0 || strcmp (s, mvstr[1]) == 0 || strcmp (s, mvstr[2]) == 0 || strcmp (s, mvstr[3]) == 0) return true; } currentoffset += sizeof (struct gdxdata); if (currentoffset > d.maxoffset) currentoffset = sizeof (struct gdxadmin); } return false; } #endif gnuchess-4.0.pl70/src/gnuchess.h100444 21542 13 44105 5563700645 15606 0ustar cracraftuser/* * gnuchess.h - Header file for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #if !defined(__STDC__) && !defined(MSDOS) #define const #endif #ifndef __GNUC__ #define inline #endif #ifndef MSDOS #define huge #endif #include #if !defined(NOMEMSET) #include #endif #ifdef SIGNCHAR typedef signed char CHAR; #else typedef char CHAR; #endif typedef unsigned char UCHAR; typedef short tshort; typedef unsigned short utshort; #ifdef USEINT typedef int SHORT; typedef unsigned int UTSHORT; #else typedef unsigned short UTSHORT; typedef short SHORT; #endif #define SEEK_SET 0 #define SEEK_END 2 #ifdef DEBUG void ShowDBLine (CHAR *, SHORT, SHORT, SHORT, SHORT, SHORT, utshort *); extern FILE *debugfd; extern SHORT debuglevel; #endif /* DEBUG */ #include #include #include #ifdef MSDOS #include #include #define RWA_ACC "r+b" #define WA_ACC "w+b" #define printz printf #define scanz scanf #else #define RWA_ACC "r+" #define WA_ACC "w+" #ifndef Think_C #include #include #ifndef AMIGADOS #include #endif #endif /* Think_C */ #ifdef NONDSP #define printz printf #define scanz scanf #else #include #define scanz fflush(stdout),scanw #define printz printw #endif #endif /* MSDOS */ #ifdef notdef #if defined(__STDC__) || defined(MSDOS) /* */ extern int fclose (FILE *); #ifndef __ultrix /* work around bug in c89 compiler --t.mann */ extern int fscanf (FILE *, const CHAR *, ...); extern int fprintf (FILE *, const CHAR *, ...); #endif /*__ultrix*/ extern int fflush (FILE *); /* */ extern int abs (int); extern int atoi (const CHAR *); /* */ extern long int time (long int *); /* */ extern void *memset (void *, int, size_t); #endif #endif /* Magic for those compilers that can't handle "huge" static structures... */ /* Be sure to also invoke Initialize_mem() if you use this */ #ifdef Think_C #define ALLOCATE(ms) if (!(_##ms=malloc(sizeof(ms)))) \ {perror(#ms);exit(1);}\ else printf("Allocate %s @ %ld, %ld bytes.\n", #ms, _##ms, sizeof(ms)); /* #define etab (*_etab) */ #define nextpos (*_nextpos) #define nextdir (*_nextdir) #define history (*_history) #define Tree (*_Tree) #endif /* Think_C */ /* Piece values */ #define valueP 100 #define valueN 350 #define valueB 355 #define valueR 550 #define valueQ 1100 #define valueK 1200 /* masks into upper 8 bits of ataks array */ #define ctlP 0x4000 #define ctlN 0x2800 #define ctlB 0x1800 #define ctlR 0x0400 #define ctlQ 0x0200 #define ctlK 0x0100 #define ctlBQ 0x1200 #define ctlBN 0x0800 #define ctlRQ 0x0600 #define ctlNN 0x2000 /* attack functions */ #define Patak(c, u) (atak[c][u] > ctlP) #define Anyatak(c, u) (atak[c][u] > 0) /* distance function */ #define taxicab(a,b) taxidata[a][b] /* king positions */ #define wking PieceList[white][0] #define bking PieceList[black][0] #define EnemyKing PieceList[c2][0] /* constants */ /* castle moves */ #define BLACKCASTLE 0x3C3E #define WHITECASTLE 0x0406 #define LONGBLACKCASTLE 0x3C3A #define LONGWHITECASTLE 0x0402 /* truth values */ #define false 0 #define true 1 /* colors */ #define white 0 #define black 1 #define neutral 2 /* piece code defines */ #define no_piece 0 #define pawn 1 #define knight 2 #define bishop 3 #define rook 4 #define queen 5 #define king 6 #define bpawn 7 /* node flags */ #define pmask 0x0007 #define promote 0x0008 #define cstlmask 0x0010 #define epmask 0x0020 #define exact 0x0040 #define pwnthrt 0x0080 #define check 0x0100 #define capture 0x0200 #define draw 0x0400 #define book 0x1000 /* move symbols */ #define pxx (CP[2]) #define qxx (CP[1]) #define rxx (CP[4]) #define cxx (CP[3]) /* for everything that can't use the above */ #define Qxx " pnbrqk" #define Pxx " PNBRQK" #define Cxx "abcdefgh" #define Rxx "12345678" /***************************************************************************/ /***************** Table limits ********************************************/ #define TREE 1500 /* max number of tree entries */ #define MAXDEPTH 35 /* max depth a search can be carried */ #define MINDEPTH 2 /* min search depth =1 (no hint), >1 hint */ #define MAXMOVES 400 /* max number of half moves in a game */ #define NMOVELIMIT 20 #define XCLIMIT 5 /* number of different Time inputs */ #if defined MSDOS #define BOOKSIZE 10000 /* Number of unique position/move combinations allowed */ #else #define BOOKSIZE 250000 /* Number of unique position/move combinations allowed */ #endif #define CPSIZE 235 /* size of lang file max */ #define DEFETABLE 18001 /* static eval cache */ /***************** tuning paramaters **********************************************/ #define NMOVEINIT { 75,75,60,55,55,55,55,58,55,56,60,64,68,72,76,80,84,88,90,94,98,98,98,98,99,99,99} #define MINGAMEIN 4 #define MINMOVES 15 #define CHKDEPTH 1 /* always look forward CHKDEPTH half-moves if in check */ #define FBEYOND 5 #define SBEYOND 9 #define TBEYOND 11 #define HASHDEPTH 2 /* depth above which to use HashFile */ #define HASHMOVELIMIT 40 /* Use HashFile only for this many moves */ #define PTVALUE 0 /* material value below which pawn threats at 5 & 3 are used */ #define ZDEPTH 3 /* depth beyond which to check ZDELTA for extra time */ #define ZDELTA 40 /* score delta per ply to cause extra time to be given */ #define QBLOCK false /* if true cache quiescent positions */ #define BESTDELTA 90 /* about 1/2 second worth of nodes for your machine */ #ifdef Think_C #define ZNODES 500 /* check the time every ZNODES positions */ #else /* Think_C */ #define ZNODES 2000 /* check the time every ZNODES positions */ #endif /* Think_C */ #define MAXTCCOUNTX 10 /* max number of time clicks per search to complete ply*/ #define MAXTCCOUNTR 6 /* max number of time clicks per search extensions*/ #define SDEPTHLIM Sdepth+2 #define HISTORYLIM 4096 /* Max value of history killer */ #define EWNDW 10 /* Eval window to force position scoring at depth greater than Sdepth + 2 */ #define WAWNDW 90 /* alpha window when computer white*/ #define WBWNDW 90 /* beta window when computer white*/ #define BAWNDW 90 /* alpha window when computer black*/ #define BBWNDW 90 /* beta window when computer black*/ #define BXWNDW 90 /* window to force position scoring at lower */ #define WXWNDW 90 /* window to force position scoring at lower */ #ifdef SMALLRANDY #define DITHER 2 /* max amount random can alter a pos value */ #else #define DITHER 5 #endif #define BBONUS 2 /* points per stage value of B increases */ #define RBONUS 6 /* points per stage value of R increases */ #define PCRASHS 5 #define PCRASHV 5 #define PCENTERS 5 #define PCENTERV 5 #define KINGPOSLIMIT -1 /* King positional scoring limit */ #define KINGSAFETY 40 #define NULLMOVELIM 4000 /* below this total material on board don't use null move */ #define DEPTHMARGIN 2 #define THRSTAGE 6 #define CHECKSTAGE 5 /************************* parameters for Opening Book *********************************/ #define BOOKFAIL 8 /* if no book move found for BOOKFAIL turns stop using book */ #define BOOKMAXPLY 28 /* Max plys to keep in book database */ #define BOOKPOCKET 64 #define BOOKRAND 1000 /* used to select an opening move from a list */ #define BOOKENDPCT 950 /* 5 % chance a BOOKEND will stop the book */ #define DONTUSE -32000 /* flag move as don't use */ /*************************** Book access defines ****************************************/ #define SIDEMASK 0x1 #define LASTMOVE 0x4000 /* means this is the last move of an opening */ #define BADMOVE 0x8000 /* means this is a bad move in this position */ /****************************************************************************************/ struct leaf { tshort f; tshort t; tshort score; tshort reply; tshort width; utshort flags; }; struct GameRec { utshort gmove; /* this move */ tshort score; /* score after this move */ tshort depth; /* search depth this move */ long time; /* search time this move */ tshort piece; /* piece captured */ tshort color; /* color */ tshort flags; /* move flags capture, promote, castle */ tshort Game50; /* flag for repetition */ long nodes; /* nodes searched for this move */ unsigned long hashkey, hashbd; /* board key before this move */ tshort epssq; /* epssquare before this move */ #ifdef DEBUG40 UTSHORT d1[7]; #endif }; struct TimeControlRec { SHORT moves[2]; long clock[2]; }; struct flags { SHORT mate; /* the game is over */ SHORT post; /* show principle variation */ SHORT quit; /* quit/exit */ SHORT regularstart; /* did the game start from standard * initial board ? */ SHORT reverse; /* reverse board display */ SHORT bothsides; /* computer plays both sides */ SHORT hash; /* enable/disable transposition table */ SHORT force; /* enter moves */ SHORT easy; /* disable thinking on opponents time */ SHORT beep; /* enable/disable beep */ SHORT timeout; /* time to make a move */ SHORT musttimeout; /* time to make a move */ SHORT back; /* time to make a move */ SHORT rcptr; /* enable/disable recapture heuristics */ SHORT rv; /* reverse video */ SHORT stars; /* add stars to uxdsp screen */ SHORT coords; /* add coords to visual screen */ SHORT shade; SHORT material; /* draw on lack of material */ SHORT illegal; /* illegal position */ SHORT onemove; /* timing is onemove */ SHORT gamein; /* timing is gamein */ SHORT autolist; /* list games */ SHORT cache; /* use eval cache */ SHORT threat; /* Enable threats, tom@izf.tno.nl */ SHORT nonull; /* Disable nullmoves, tom@izf.tno.nl */ SHORT deepnull; /* Enable deep nullmoves, tom@izf.tno.nl */ SHORT verydeep; /* Enable very deep nullmoves, tom@izf.tno.nl */ SHORT pvs; /* Enable PVS, tom@izf.tno.nl */ SHORT neweval; /* Enable new eval, tom@izf.tno.nl */ SHORT noscore; /* Enable no score heuristic, tom@izf.tno.nl */ }; #ifdef DEBUG extern FILE *debugfile; #endif /* DEBUG */ #ifdef HISTORY extern UTSHORT history[32768]; #endif extern CHAR *ColorStr[2]; extern UTSHORT MV[MAXDEPTH]; extern SHORT PCRASH,PCENTER; extern int MSCORE; extern int mycnt1, mycnt2; extern SHORT ahead; extern SHORT chesstool; extern struct leaf Tree[TREE], *root,rootnode; extern CHAR savefile[], listfile[]; extern SHORT TrPnt[]; extern SHORT board[], color[]; extern SHORT PieceList[2][64], PawnCnt[2][8]; extern SHORT castld[], Mvboard[]; extern tshort svalue[64]; extern struct flags flag; extern SHORT opponent, computer, INCscore; extern tshort WAwindow, BAwindow, WBwindow, BBwindow; extern SHORT dither, player; extern tshort xwndw, contempt; extern SHORT epsquare; extern long ResponseTime, ExtraTime, MaxResponseTime, et, et0, time0, ft; extern long reminus, replus; extern unsigned long GenCnt, NodeCnt, ETnodes, EvalNodes; extern tshort HashDepth, HashMoveLimit; extern struct GameRec GameList[]; extern SHORT GameCnt, Game50; extern SHORT Sdepth, MaxSearchDepth; extern int Book; extern struct TimeControlRec TimeControl; extern int TCadd; extern SHORT TCflag, TCmoves, TCminutes, TCseconds, OperatorTime; extern int timecomp[MINGAMEIN], timeopp[MINGAMEIN]; extern int compptr,oppptr; extern SHORT XCmore,XCadd[], XCmoves[], XCminutes[], XCseconds[], XC; extern const SHORT otherside[]; extern const SHORT Stboard[]; extern const SHORT Stcolor[]; extern SHORT hint; extern SHORT TOflag; extern SHORT stage, stage2, Developed[]; extern SHORT ChkFlag[], CptrFlag[], PawnThreat[]; extern SHORT QueenCheck[]; /* tom@izf.tno.nl */ extern SHORT NMoves[]; /* tom@izf.tno.nl */ extern SHORT Threat[]; /* tom@izf.tno.nl */ extern SHORT ThreatSave[]; /* tom@izf.tno.nl */ extern SHORT Pscore[], Tscore[]; extern SHORT mtl[], pmtl[], hung[], emtl[]; extern SHORT Pindex[]; extern SHORT PieceCnt[]; extern SHORT FROMsquare, TOsquare; extern SHORT HasKnight[], HasBishop[], HasRook[], HasQueen[]; extern const SHORT qrook[]; extern const SHORT krook[]; extern const SHORT kingP[]; extern const SHORT rank7[]; extern const SHORT sweep[]; extern const SHORT epmove1[], epmove2[]; extern UTSHORT killr0[], killr1[]; extern UTSHORT killr2[], killr3[]; extern UTSHORT PV, SwagHt, Swag0, Swag1, Swag2, Swag3, Swag4, sidebit; extern tshort killt[0x4000]; extern SHORT mtl[2], pmtl[2], hung[2]; extern const SHORT value[]; extern const SHORT control[]; extern UCHAR nextpos[8][64][64]; extern UCHAR nextdir[8][64][64]; extern const SHORT ptype[2][8]; extern unsigned int starttime; extern SHORT distdata[64][64], taxidata[64][64]; extern CHAR mvstr[5][7]; #ifndef AMIGADOS extern union U admin; #endif extern UTSHORT bookmaxply; extern unsigned long bookcount; extern unsigned long booksize; extern CHAR *CP[]; #ifdef QUIETBACKGROUND extern SHORT background; #endif /* QUIETBACKGROUND */ extern CHAR *DRAW; #define distance(a,b) distdata[a][b] #define row(a) ((a) >> 3) #define column(a) ((a) & 7) #define locn(a,b) (((a) << 3) | (b)) extern SHORT distdata[64][64]; /* init external functions */ extern void InitConst (CHAR *lang); extern void Initialize_dist (void); extern void NewGame (void); extern int parse (FILE * fd, UTSHORT *mv, SHORT side, CHAR *opening); extern void GetOpenings (void); extern int OpeningBook (SHORT *hint, SHORT side); extern void SelectMove (SHORT side, SHORT iop); extern int search (SHORT side, SHORT ply, SHORT depth, SHORT ext, SHORT alpha, SHORT beta, UTSHORT *bstline, SHORT *rpt, SHORT SAVEHT, SHORT didnull ); extern void Initialize_moves (void); extern void MoveList (SHORT side, SHORT ply); extern void CaptureList (SHORT side, SHORT ply); extern int castle (SHORT side, SHORT kf, SHORT kt, SHORT iop); extern void ataks (SHORT side, SHORT *a); extern void MakeMove (SHORT side, struct leaf * node, SHORT *tempb, SHORT *tempc, SHORT *tempsf, SHORT *tempst, SHORT *INCscore); extern void UnmakeMove (SHORT side, struct leaf * node, SHORT *tempb, SHORT *tempc, SHORT *tempsf, SHORT *tempst); extern void InitializeStats (void); extern int evaluate (SHORT side, SHORT ply, SHORT depth, SHORT ext, SHORT alpha, SHORT beta, SHORT INCscore, SHORT *InChk); extern SHORT ScorePosition (SHORT side); extern void ExaminePosition (void); extern void UpdateWeights (void); extern void Initialize (void); extern void InputCommand (void); extern void ExitChess (void); extern void ClrScreen (void); extern void SetTimeControl (void); extern void SelectLevel (CHAR *sx); extern void UpdateDisplay (SHORT f, SHORT t, SHORT flag, SHORT iscastle); extern void ElapsedTime (SHORT iop); extern void ShowSidetoMove (void); extern void SearchStartStuff (SHORT side); extern void ShowDepth (CHAR ch); extern void TerminateSearch (int); extern void ShowResults (SHORT score, UTSHORT *bstline, CHAR ch); extern void PromptForMove (void); extern void SetupBoard (void); extern void algbr (SHORT f, SHORT t, SHORT flag); extern void OutputMove (void); extern void ShowCurrentMove (SHORT pnt, SHORT f, SHORT t); extern void ListGame (void); extern void ShowMessage (CHAR *s); extern void ClrScreen (void); extern void gotoXY (SHORT x, SHORT y); extern void ClrEoln (void); extern void DrawPiece (SHORT sq); extern void UpdateClocks (void); extern void DoDebug (void); extern void DoTable (SHORT table[64]); extern void ShowPostnValues (void); extern void ChangeXwindow (void); extern void SetContempt (void); extern void ChangeHashDepth (void); extern void ChangeBetaWindow (void); extern void ChangeAlphaWindow (void); extern void GiveHint (void); extern void ShowPrompt (void); extern void EditBoard (void); extern void help (void); extern void ChangeSearchDepth (void); extern void skip (void); extern void skipb (void); extern void EnPassant (SHORT xside, SHORT f, SHORT t, SHORT iop); extern void ShowNodeCnt (long int NodeCnt); extern void ShowLine (UTSHORT *bstline); extern int pick (SHORT p1, SHORT p2); extern int VerifyMove (CHAR *s, SHORT inp, UTSHORT *mv); #if defined(GDX) && !defined(AMIGADOS) extern struct gdxadmin B; #endif #if defined(AMIGADOS) && !defined(XBOARD) #define exit(retcode) CleanExit(retcode) #endif /* Take care of NOMEMSET once and for all... */ #if (defined(NOMEMSET) || defined(MSDOS)) && !defined(__GNUC__) #define memset(s,c,l) {\ unsigned long j; \ for (j = 0; j < (l); j++) \ ((CHAR *)s)[j] = (c);} #endif /* NOMEMSET */ gnuchess-4.0.pl70/src/init.c100444 21542 13 30400 5563700646 14717 0ustar cracraftuser/* * init.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" #include "ttable.h" #ifdef HASGETTIMEOFDAY #include #endif /* .... MOVE GENERATION VARIABLES AND INITIALIZATIONS .... */ SHORT distdata[64][64], taxidata[64][64]; #ifdef KILLT /* put moves to the center first */ void Initialize_killt (void) { register UTSHORT f, t, s; register SHORT d; for (f = 64; f--;) for (t = 64; t--;) { d = taxidata[f][0x1b]; if (taxidata[f][0x1c] < d) d = taxidata[f][0x1c]; if (taxidata[f][0x23] < d) d = taxidata[f][0x23]; if (taxidata[f][0x24] < d) d = taxidata[f][0x24]; s = d; d = taxidata[t][0x1b]; if (taxidata[t][0x1c] < d) d = taxidata[t][0x1c]; if (taxidata[t][0x23] < d) d = taxidata[t][0x23]; if (taxidata[t][0x24] < d) d = taxidata[t][0x24]; s -= d; killt[(f << 8) | t] = s; killt[(f << 8) | t | 0x80] = s; } } #endif void Initialize_dist (void) { register SHORT a, b, d, di; for (a = 0; a < 64; a++) for (b = 0; b < 64; b++) { d = abs (column (a) - column (b)); di = abs (row (a) - row (b)); taxidata[a][b] = d + di; distdata[a][b] = (d > di ? d : di); } #ifdef KILLT Initialize_killt (); #endif } const SHORT Stboard[64] = {rook, knight, bishop, queen, king, bishop, knight, rook, pawn, pawn, pawn, pawn, pawn, pawn, pawn, pawn, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, pawn, pawn, pawn, pawn, pawn, pawn, pawn, pawn, rook, knight, bishop, queen, king, bishop, knight, rook}; const SHORT Stcolor[64] = {white, white, white, white, white, white, white, white, white, white, white, white, white, white, white, white, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, neutral, black, black, black, black, black, black, black, black, black, black, black, black, black, black, black, black}; SHORT board[64], color[64]; /* given epsquare, from where can a pawn be taken? */ const SHORT epmove1[64] = {0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 24, 25, 26, 27, 28, 29, 30, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 32, 33, 34, 35, 36, 37, 38, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63}; const SHORT epmove2[64] = {0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 25, 26, 27, 28, 29, 30, 31, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 33, 34, 35, 36, 37, 38, 39, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63}; /* * nextpos[piece][from-square] , nextdir[piece][from-square] gives vector of * positions reachable from from-square in ppos with piece such that the * sequence ppos = nextpos[piece][from-square]; pdir = * nextdir[piece][from-square]; u = ppos[sq]; do { u = ppos[u]; if(color[u] * != neutral) u = pdir[u]; } while (sq != u); will generate the sequence of * all squares reachable from sq. * * If the path is blocked u = pdir[sq] will generate the continuation of the * sequence in other directions. */ UCHAR nextpos[8][64][64]; UCHAR nextdir[8][64][64]; /* * ptype is used to separate white and black pawns, like this; ptyp = * ptype[side][piece] piece can be used directly in nextpos/nextdir when * generating moves for pieces that are not black pawns. */ const SHORT ptype[2][8] = { { no_piece, pawn, knight, bishop, rook, queen, king, no_piece }, { no_piece, bpawn, knight, bishop, rook, queen, king, no_piece } }; /* data used to generate nextpos/nextdir */ static const SHORT direc[8][8] = { { 0, 0, 0, 0, 0, 0, 0, 0 }, { 10, 9, 11, 0, 0, 0, 0, 0 }, { 8, -8, 12, -12, 19, -19, 21, -21 }, { 9, 11, -9, -11, 0, 0, 0, 0 }, { 1, 10, -1, -10, 0, 0, 0, 0 }, { 1, 10, -1, -10, 9, 11, -9, -11 }, { 1, 10, -1, -10, 9, 11, -9, -11 }, { -10, -9, -11, 0, 0, 0, 0, 0 } }; static const SHORT max_steps[8] = {0, 2, 1, 7, 7, 7, 1, 2}; static const SHORT nunmap[120] = { -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 0, 1, 2, 3, 4, 5, 6, 7, -1, -1, 8, 9, 10, 11, 12, 13, 14, 15, -1, -1, 16, 17, 18, 19, 20, 21, 22, 23, -1, -1, 24, 25, 26, 27, 28, 29, 30, 31, -1, -1, 32, 33, 34, 35, 36, 37, 38, 39, -1, -1, 40, 41, 42, 43, 44, 45, 46, 47, -1, -1, 48, 49, 50, 51, 52, 53, 54, 55, -1, -1, 56, 57, 58, 59, 60, 61, 62, 63, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1}; int InitFlag = false; void Initialize_moves (void) /* * This procedure pre-calculates all moves for every piece from every square. * This data is stored in nextpos/nextdir and used later in the move * generation routines. */ { SHORT ptyp, po, p0, d, di, s, delta; UCHAR *ppos, *pdir; SHORT dest[8][8]; SHORT steps[8]; SHORT sorted[8]; for (ptyp = 0; ptyp < 8; ptyp++) for (po = 0; po < 64; po++) for (p0 = 0; p0 < 64; p0++) { nextpos[ptyp][po][p0] = (UCHAR) po; nextdir[ptyp][po][p0] = (UCHAR) po; } for (ptyp = 1; ptyp < 8; ptyp++) for (po = 21; po < 99; po++) if (nunmap[po] >= 0) { ppos = nextpos[ptyp][nunmap[po]]; pdir = nextdir[ptyp][nunmap[po]]; /* dest is a function of direction and steps */ for (d = 0; d < 8; d++) { dest[d][0] = nunmap[po]; delta = direc[ptyp][d]; if (delta != 0) { p0 = po; for (s = 0; s < max_steps[ptyp]; s++) { p0 = p0 + delta; /* * break if (off board) or (pawns only move two * steps from home square) */ if ((nunmap[p0] < 0) || (((ptyp == pawn) || (ptyp == bpawn)) && ((s > 0) && ((d > 0) || (Stboard[nunmap[po]] != pawn))))) break; else dest[d][s] = nunmap[p0]; } } else s = 0; /* * sort dest in number of steps order currently no sort * is done due to compability with the move generation * order in old gnu chess */ steps[d] = s; for (di = d; s > 0 && di > 0; di--) if (steps[sorted[di - 1]] == 0) /* should be: < s */ sorted[di] = sorted[di - 1]; else break; sorted[di] = d; } /* * update nextpos/nextdir, pawns have two threads (capture * and no capture) */ p0 = nunmap[po]; if (ptyp == pawn || ptyp == bpawn) { for (s = 0; s < steps[0]; s++) { ppos[p0] = (UCHAR) dest[0][s]; p0 = dest[0][s]; } p0 = nunmap[po]; for (d = 1; d < 3; d++) { pdir[p0] = (UCHAR) dest[d][0]; p0 = dest[d][0]; } } else { pdir[p0] = (UCHAR) dest[sorted[0]][0]; for (d = 0; d < 8; d++) for (s = 0; s < steps[sorted[d]]; s++) { ppos[p0] = (UCHAR) dest[sorted[d]][s]; p0 = dest[sorted[d]][s]; if (d < 7) pdir[p0] = (UCHAR) dest[sorted[d + 1]][0]; /* * else is already initialized */ } } } } void NewGame (void) /* * Reset the board and other variables to start a new game. */ { SHORT l, c, p; #ifdef HASGETTIMEOFDAY struct timeval tv; #endif #ifdef CLIENT if(GameCnt >0)ListGame(); fflush(stdout); #endif compptr = oppptr = 0; stage = stage2 = -1; /* the game is not yet started */ flag.illegal=flag.mate=flag.quit=flag.bothsides=flag.onemove=flag.force=flag.back=flag.musttimeout=false; flag.easy = true; flag.verydeep= flag.neweval= flag.threat= flag.deepnull= flag.pvs = true; /* TomV */ #ifdef CLIENT flag.gamein = true; #else flag.gamein = false; #endif mycnt1 = mycnt2 = 0; GenCnt = NodeCnt = et0 = epsquare = dither = XCmore = 0; contempt = -200; WAwindow = WAWNDW; WBwindow = WBWNDW; BAwindow = BAWNDW; BBwindow = BBWNDW; xwndw = BXWNDW; if (!MaxSearchDepth) MaxSearchDepth = MAXDEPTH - 1; contempt = 0; GameCnt = 0; Game50 = 1; hint = 0x0C14; ZeroRPT (); Developed[white] = Developed[black] = false; castld[white] = castld[black] = false; PawnThreat[0] = CptrFlag[0] = false; Pscore[0] = Tscore[0] = 12000; opponent = white; computer = black; for (l = 0; l < TREE; l++) Tree[l].f = Tree[l].t = 0; if (!InitFlag) InitHashCode((unsigned int)1); for (l = 0; l < 64; l++) { board[l] = Stboard[l]; color[l] = Stcolor[l]; Mvboard[l] = 0; } ClrScreen (); InitializeStats (); #ifdef HASGETTIMEOFDAY gettimeofday(&tv, NULL); time0 = tv.tv_sec*100+tv.tv_usec/10000; #else time0 = time ((long *) 0); #endif ElapsedTime (1); flag.regularstart = true; Book = BOOKFAIL; TimeControl.clock[white] = TimeControl.clock[black] = 0; SetTimeControl(); if (!InitFlag) { CHAR sx[256]; strcpy(sx,CP[169]); if (!TCflag && MaxResponseTime == 0) SelectLevel (sx); UpdateDisplay (0, 0, 1, 0); GetOpenings (); #ifdef CACHE etab[0] = (struct etable *)malloc(ETABLE*sizeof(struct etable)); etab[1] = (struct etable *)malloc(ETABLE*sizeof(struct etable)); if(etab[0] == NULL || etab[1] == NULL){ perror("can't alloc etab");exit(1);} #endif #if ttblsz Initialize_ttable(); #endif InitFlag = true; } #if ttblsz ZeroTTable(0); #endif /* ttblsz */ #ifdef CACHE memset ((CHAR *) etab[0], 0, ETABLE*sizeof(struct etable)); memset ((CHAR *) etab[1], 0, ETABLE*sizeof(struct etable)); #endif #ifdef NODITHER PCRASH = PCRASHS; PCENTER = PCENTERS; #else PCRASH = PCRASHS + dither?(rand() % PCRASHV):0; PCENTER = PCENTERS + dither?(rand() % PCENTERV):0; #endif return; } void InitConst (CHAR *lang) { FILE *constfile; CHAR s[512]; CHAR sl[5]; int len, entry; CHAR *p, *q; constfile = fopen (LANGFILE, "r"); flag.illegal=flag.mate=flag.post=flag.quit=flag.reverse=flag.bothsides=flag.onemove=flag.force=false; flag.material=flag.coords=flag.hash=flag.cache=flag.easy=flag.beep=flag.rcptr=true; flag.autolist=flag.stars=flag.shade=flag.back=flag.musttimeout=false; #ifdef CLIENT flag.gamein = true; #else flag.gamein = false; #endif #if defined(MSDOS) && !defined(SEVENBIT) flag.rv = false; #else flag.rv = true; #endif /* MSDOS && !SEVENBIT */ if (!constfile) { printf ("NO LANGFILE\n"); exit (1); } while (fgets (s, sizeof (s), constfile)) { if (s[0] == '!') continue; len = strlen (s); for (q = &s[len]; q > &s[8]; q--) if (*q == '}') break; if (q == &s[8]) { printf ("{ error in constfile\n"); exit (1); } *q = '\0'; if (s[3] != ':' || s[7] != ':' || s[8] != '{') { printf ("Langfile format error %s\n", s); exit (1); } s[3] = s[7] = '\0'; if (lang == NULL) { lang = sl; strcpy (sl, &s[4]); } if (strcmp (&s[4], lang)) continue; entry = atoi (s); if (entry < 0 || entry >= CPSIZE) { printf ("Langfile number error\n"); exit (1); } for (q = p = &s[9]; *p; p++) { if (*p != '\\') { *q++ = *p; } else if (*(p + 1) == 'n') { *q++ = '\n'; p++; } } *q = '\0'; if (entry < 0 || entry > 255) { printf ("Langfile error %d\n", entry); exit (0); } CP[entry] = (CHAR *) malloc ((unsigned) strlen (&s[9]) + 1); if (CP[entry] == NULL) { perror ("malloc"); exit (0); } strcpy (CP[entry], &s[9]); } fclose (constfile); } #if defined (ALLOCATE) void Initialize_mem() { ALLOCATE(nextpos); ALLOCATE(nextdir); /* #ifdef CACHE */ /* ALLOCATE(etab); */ /*#endif */ #ifdef HISTORY ALLOCATE(history); #endif ALLOCATE(Tree); printf("Total free memory = %ld\n", FreeMem()); } #endif /* ALLOCATE */ gnuchess-4.0.pl70/src/main.c100444 21542 13 25126 5563700646 14711 0ustar cracraftuser/* * main.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" #include "version.h" #include "ttable.h" #include #if defined Think_C && defined Window_Events #include #endif CHAR *ColorStr[2]; CHAR *CP[CPSIZE]; #ifdef BINBOOK extern CHAR *binbookfile; #endif extern CHAR *bookfile; UTSHORT ETABLE = DEFETABLE; CHAR savefile[128] = ""; CHAR listfile[128] = ""; #ifdef HISTORY UTSHORT history[32768]; #endif tshort svalue[64]; struct leaf Tree[TREE], *root; SHORT TrPnt[MAXDEPTH]; SHORT PieceList[2][64], PawnCnt[2][8]; SHORT castld[2], Mvboard[64]; struct flags flag; SHORT opponent, computer, dither; tshort WAwindow, WBwindow, BAwindow, BBwindow; SHORT INCscore; long ResponseTime, ExtraTime, MaxResponseTime, et, et0, time0, ft; unsigned long GenCnt, NodeCnt, ETnodes, EvalNodes; long replus, reminus; tshort HashDepth = HASHDEPTH, HashMoveLimit = HASHMOVELIMIT; SHORT player; struct GameRec GameList[MAXMOVES + MAXDEPTH]; SHORT Sdepth, Game50, MaxSearchDepth; SHORT GameCnt = 0; SHORT epsquare; tshort contempt, xwndw; int Book; struct TimeControlRec TimeControl; int TCadd = 0; SHORT TCflag, TCmoves, TCminutes, TCseconds, OperatorTime; SHORT XCmoves[3], XCminutes[3], XCseconds[3],XCadd[3], XC, XCmore; const SHORT otherside[3] = {black, white, neutral}; SHORT hint; SHORT TOflag; /* force search re-init if we backup search */ SHORT mtl[2], pmtl[2], hung[2]; SHORT Pindex[64]; SHORT PieceCnt[2]; SHORT FROMsquare, TOsquare; SHORT HasKnight[2], HasBishop[2], HasRook[2], HasQueen[2]; SHORT ChkFlag[MAXDEPTH], CptrFlag[MAXDEPTH], PawnThreat[MAXDEPTH]; SHORT QueenCheck[MAXDEPTH]; /* tom@izf.tno.nl */ SHORT NMoves[MAXDEPTH]; /* tom@izf.tno.nl */ SHORT Threat[MAXDEPTH]; /* tom@izf.tno.nl */ SHORT ThreatSave[MAXDEPTH]; /* tom@izf.tno.nl */ SHORT Pscore[MAXDEPTH], Tscore[MAXDEPTH]; const SHORT qrook[3] = {0, 56, 0}; const SHORT krook[3] = {7, 63, 0}; const SHORT kingP[3] = {4, 60, 0}; const SHORT rank7[3] = {6, 1, 0}; const SHORT sweep[8] = {false, false, false, true, true, true, false, false}; UTSHORT killr0[MAXDEPTH], killr1[MAXDEPTH]; UTSHORT killr2[MAXDEPTH], killr3[MAXDEPTH]; UTSHORT PV, SwagHt, Swag0, Swag1, Swag2, Swag3, Swag4, sidebit; #ifdef KILLT tshort killt[0x4000]; #endif const SHORT value[7] = {0, valueP, valueN, valueB, valueR, valueQ, valueK}; const SHORT control[7] = {0, ctlP, ctlN, ctlB, ctlR, ctlQ, ctlK}; SHORT stage, stage2, Developed[2]; unsigned int starttime; SHORT ahead = true, hash = true; SHORT PCRASH, PCENTER; #if defined CHESSTOOL || defined XBOARD void TerminateChess (int sig) { ExitChess (); } #endif int timeopp[MINGAMEIN], timecomp[MINGAMEIN]; int compptr, oppptr; inline void TimeCalc () { /* adjust number of moves remaining in gamein games */ int increment = 0; int topsum = 0; int tcompsum = 0; int me,him; int i; /* dont do anything til you have enough numbers */ if (GameCnt < (MINGAMEIN * 2)) return; /* calculate average time in sec for last MINGAMEIN moves */ for (i = 0; i < MINGAMEIN; i++) { tcompsum += timecomp[i]; topsum += timeopp[i]; } topsum /= (100 * MINGAMEIN); tcompsum /= (100 * MINGAMEIN); /* if I have less time than opponent add another move */ me = TimeControl.clock[computer]/100; him = TimeControl.clock[opponent]/100; if(me < him) increment += 2; /* if I am > 60 sec behind increment or if I am less and in last 2 min */ if((him - me) > 60 || (me 60) && tcompsum < topsum) increment--; if ( tcompsum > topsum) increment +=2; /* but dont let moves go below MINMOVES */ else if (TimeControl.moves[computer] < MINMOVES && !increment) increment++; /* if I am doing really well use more time per move */ else if (me > him && tcompsum < topsum) increment = -1; if (me > (him+60) ) increment = -1; TimeControl.moves[computer] += increment; } /* hmm.... shouldn`t main be moved to the interface routines */ int main (int argc, CHAR **argv) { CHAR *xwin = 0; CHAR *Lang = NULL; #if defined Think_C && defined Window_Events if (StillDown()) /* fake command line by holding mouse btn */ argc = ccommand(&argv); #endif gsrand (starttime = ((unsigned int) time ((long *) 0))); /* init urand */ #ifdef ttblsz ttblsize = ttblsz; rehash = -1; #endif /* ttblsz */ if (argc > 2) { if (argv[1][0] == '-' && argv[1][1] == 'L') { Lang = argv[2]; argv += 2; argc -= 2; } } InitConst (Lang); ColorStr[0] = CP[118]; ColorStr[1] = CP[119]; while (argc > 1 && ((argv[1][0] == '-') || (argv[1][0] == '+'))) { switch (argv[1][1]) { case 'a': ahead = ((argv[1][0] == '-') ? false : true); break; case 'b': argv++; argc--; if (argc > 1) { bookfile = argv[1]; #ifdef notdef #ifdef BINBOOK binbookfile = NULL; #endif #endif } break; #ifdef BINBOOK case 'B': argv++; argc--; if (argc > 1) binbookfile = argv[1]; break; #endif #ifdef CACHE case 'C': argc--; argv++; if(argc > 1)ETABLE = atoi(argv[1]); break; #endif case 'N': /* tom@izf.tno.nl */ flag.nonull = ((argv[1][0] == '-') ? true : false); break; case 'V': /* tom@izf.tno.nl */ flag.verydeep = ((argv[1][0] == '-') ? false : true); break; case 'D': /* tom@izf.tno.nl */ flag.deepnull = ((argv[1][0] == '-') ? false : true); break; case 'p': /* tom@izf.tno.nl */ flag.pvs = ((argv[1][0] == '-') ? false : true); break; case 'F': /* tom@izf.tno.nl */ flag.noscore = ((argv[1][0] == '-') ? false : true); break; case 'e': /* tom@izf.tno.nl */ flag.neweval = ((argv[1][0] == '-') ? false : true); break; case 'E': /* tom@izf.tno.nl */ flag.threat = ((argv[1][0] == '-') ? false : true); break; case 'h': hash = ((argv[1][0] == '-') ? false : true); break; case 's': argc--; argv++; if (argc > 1) strcpy (savefile, argv[1]); break; case 'l': argc--; argv++; if (argc > 1) strcpy (listfile, argv[1]); break; #ifndef GDBM case 'S': argc--; argv++; if(argc > 1)booksize = atoi(argv[1]); break; #endif case 'P': argc--; argv++; if(argc > 1)bookmaxply = atoi(argv[1]); break; #if ttblsz case 'r': if (argc > 2) rehash = atoi (argv[2]); argc--; argv++; if (rehash > MAXrehash) rehash = MAXrehash; break; case 'T': if (argc > 2) ttblsize = atoi (argv[2]); argc--; argv++; if ((ttblsize <= MINTTABLE)) ttblsize = (MINTTABLE)+1; break; case 'H': if (argc > 2) HashDepth = atoi (argv[2]); argc--; argv++; break; #ifdef NEWAGE case 'A': if (argc > 2) newage = atoi (argv[2]); argc--; argv++; break; #endif #ifdef HASHFILE case 't': /* create or test persistent transposition */ TestHashFile(); return 0; case 'c': /* create or test persistent transposition table */ { long filesz = 0L; filesz = atol (argv[2]); if (filesz < 0) filesz = 0; if (filesz < 24) filesz = (1 << filesz); CreateHashFile(filesz); return (0); } #endif /* HASHFILE */ #endif /* ttblsz */ case 'x': xwin = &argv[1][2]; break; case 'v': fprintf (stderr, CP[102], version, patchlevel); exit (1); default: fprintf (stderr, CP[113]); exit (1); } argv++; argc--; } XC = 0; MaxResponseTime = 0; #if defined CHESSTOOL || defined XBOARD signal (SIGTERM, TerminateChess); XCmoves[0] = 40; XCminutes[0] = 5; XCseconds[0] = 0; XCadd[0] = 0; XC = 1; TCflag = true; #else TCflag = false; #endif if (argc == 2) { CHAR *p; MaxResponseTime = 100L * strtol (argv[1], &p, 10); if (*p == ':') MaxResponseTime = 60L * MaxResponseTime + 100L * strtol (++p, (CHAR **) NULL, 10); XCadd[0] = 0; XCmoves[0] = 0; XCminutes[0] = 0; XCseconds[0] = 0; } if (argc >= 3) { CHAR *p; if (argc > 9) { printf ("%s\n", CP[220]); exit (1); } XCmoves[0] = atoi (argv[1]); XCminutes[0] = (SHORT)strtol (argv[2], &p, 10); if (*p == ':') XCseconds[0] = (SHORT)strtol (p + 1, (CHAR **) NULL, 10); else XCseconds[0] = 0; XC = 1; argc -= 3; argv += 3; while (argc > 1) { XCmoves[XC] = atoi (argv[0]); XCminutes[XC] = (SHORT)strtol (argv[1], &p, 10); if (*p == ':') XCseconds[XC] = (SHORT)strtol (p + 1, (CHAR **) NULL, 10); else XCseconds[XC] = 0; if (XCmoves[XC] && (XCminutes[XC] || XCseconds[XC])) XC++; else { printf (CP[220]); exit (1); } argc -= 2; argv += 2; } if (argc) { printf ("%s\n", CP[220]); exit (1); } } #ifdef Think_C /* Allocate memory for "huge" static arrays */ Initialize_mem(); #endif Initialize (); Initialize_dist (); Initialize_moves (); NewGame (); flag.easy = ahead; flag.hash = hash; if (xwin) xwndw = atoi (xwin); OpenHashFile(); /* Open persistent transposition table */ while (!(flag.quit)) { oppptr = (oppptr + 1) % MINGAMEIN; if (flag.bothsides && !flag.mate) SelectMove (opponent, 1); else InputCommand (); if (opponent == black) if (flag.gamein || TCadd) { TimeCalc (); } else if (TimeControl.moves[opponent] == 0 && TCflag) { SetTimeControl (); } compptr = (compptr + 1) % MINGAMEIN; if (!(flag.quit || flag.mate || flag.force)) { SelectMove (computer, 1); if (computer == black) if (flag.gamein) { TimeCalc (); } else if (TimeControl.moves[computer] == 0 && TCflag) { SetTimeControl (); } } } CloseHashFile(); ExitChess (); return (0); } gnuchess-4.0.pl70/src/nondsp.c100444 21542 13 43251 5567302420 15255 0ustar cracraftuser/* * nondsp.c - UNIX & MSDOS NON-DISPLAY, AND CHESSTOOL interface for Chess * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" #include "ttable.h" /* calls ShowHashStats() to display stats; move to main.c? */ #include #ifdef MSDOS #include /*#include */ #elif !defined(Think_C) #include #ifndef AMIGADOS #include #endif void TerminateSearch (int), Die (int); #endif /* MSDOS */ #ifdef DEBUG SHORT debuglevel = 0; #endif /* DEBUG */ UTSHORT MV[MAXDEPTH]; int MSCORE; #if defined CHESSTOOL || defined XBOARD SHORT chesstool = 1; #else SHORT chesstool = 0; #endif /* CHESSTOOL */ int mycnt1, mycnt2; CHAR *DRAW; extern CHAR *InPtr; extern SHORT pscore[]; void Initialize (void) { mycnt1 = mycnt2 = 0; #if defined CHESSTOOL || defined XBOARD #if defined(SYSV) || defined(AMIGADOS) setvbuf (stdout, NULL, _IOLBF, BUFSIZ); #else setlinebuf (stdout); #endif printf (CP[43]); /*Chess*/ if (!TCflag && (MaxResponseTime == 0)) MaxResponseTime = 15L*100L; #endif /* CHESSTOOL */ } void ExitChess (void) { signal (SIGTERM, SIG_IGN); if(flag.autolist)ListGame (); exit (0); } #ifndef MSDOS /* never called!!! */ void Die (int sig) { CHAR s[80]; ShowMessage (CP[31]); /*Abort?*/ scanz ("%s", s); if (strcmp (s, CP[210]) == 0) /*yes*/ ExitChess (); } #endif /* MSDOS */ void TerminateSearch (int sig) { #ifdef MSDOS sig++; /* shut up the compiler */ #endif /* MSDOS */ if (!flag.timeout) flag.back = true; flag.bothsides = false; } void help (void) { ClrScreen (); /*printz ("CHESS command summary\n");*/ printz (CP[40]); printz ("----------------------------------------------------------------\n"); /*printz ("g1f3 move from g1 to f3 quit Exit Chess\n");*/ printz (CP[158]); /*printz ("Nf3 move knight to f3 cache turn %s\n", (flag.cache) ? "off" : "on");*/ printz (CP[86], (flag.cache) ? CP[92] : CP[93]); /*printz ("a7a8q promote pawn to queen\n");*/ printz (CP[128], (flag.material) ? CP[92] : CP[93]); /*printz ("o-o castle king side easy turn %s\n", (flag.easy) ? "off" : "on");*/ printz (CP[173], (flag.easy) ? CP[92] : CP[93]); /*printz ("o-o-o castle queen side hash turn %s\n", (flag.hash) ? "off" : "on");*/ printz (CP[174], (flag.hash) ? CP[92] : CP[93]); /*printz ("bd redraw board reverse board display\n");*/ printz (CP[130]); /*printz ("list game to chess.lst book turn %s used %d of %d\n", (Book) ? "off" : "on", bookcount);*/ printz (CP[170], (Book) ? CP[92] : CP[93], bookcount,booksize); /*printz ("undo undo last ply remove take back a move\n");*/ printz (CP[200]); /*printz ("edit edit board force enter game moves\n");*/ printz (CP[153]); /*printz ("switch sides with computer both computer match\n");*/ printz (CP[194]); /*printz ("white computer plays white black computer plays black\n");*/ printz (CP[202]); /*printz ("depth set search depth clock set time control\n");*/ printz (CP[149]); /*printz ("post principle variation hint suggest a move\n");*/ printz (CP[177],(flag.post) ? CP[93] : CP[92]); /*printz ("save game to file get game from file\n");*/ printz (CP[188]); /*printz ("random randomize play new start new game\n");*/ printz (CP[181]); printz ("----------------------------------------------------------------\n"); /*printz ("Computer: %-12s Opponent: %s\n",*/ printz (CP[46], ColorStr[computer], ColorStr[opponent]); /*printz ("Depth: %-12d Response time: %d sec\n",*/ printz (CP[51], MaxSearchDepth, MaxResponseTime/100); /*printz ("Random: %-12s Easy mode: %s\n",*/ printz (CP[99], (dither) ? CP[93] : CP[92], (flag.easy) ? CP[93] : CP[92]); /*printz ("Beep: %-12s Transposition file: %s\n",*/ printz (CP[36], (flag.beep) ? CP[93] : CP[92], (flag.hash) ? CP[93] : CP[92]); /*printz ("Time Control %s %d moves %d seconds %d opr %d depth\n", (TCflag) ? "ON" : "OFF",*/ if(flag.gamein) printz (CP[230], (TCflag) ? CP[93] : CP[92], TimeControl.clock[white] / 100, TCadd/100, MaxSearchDepth); else printz (CP[110], (TCflag) ? CP[93] : CP[92], TimeControl.moves[white], TimeControl.clock[white] / 100, TCadd/100, MaxSearchDepth); #if !defined CHESSTOOL signal (SIGINT, TerminateSearch); #endif #ifndef MSDOS signal (SIGQUIT, TerminateSearch); #endif /* MSDOS */ } void EditBoard (void) /* * Set up a board position. Pieces are entered by typing the piece followed * by the location. For example, Nf3 will place a knight on square f3. */ { SHORT a, r, c, sq, i, found; CHAR s[80]; flag.regularstart = true; Book = BOOKFAIL; ClrScreen (); UpdateDisplay (0, 0, 1, 0); /*printz (". exit to main\n");*/ printz (CP[29]); /*printz ("# clear board\n");*/ printz (CP[28]); /*printz ("c change sides\n");*/ printz (CP[136]); /*printz ("enter piece & location: \n");*/ printz (CP[155]); a = white; do { scanz ("%s", s); found=0; if (s[0] == CP[28][0]) /*#*/ for (sq = 0; sq < 64; sq++) { board[sq] = no_piece; color[sq] = neutral; } else if (s[0] == CP[136][0]) /*c*/ a = otherside[a]; else { c = s[1] - 'a'; r = s[2] - '1'; if ((c >= 0) && (c < 8) && (r >= 0) && (r < 8)) { sq = locn (r, c); color[sq] = a; board[sq] = no_piece; for (i = no_piece; i <= king; i++) if ((s[0] == pxx[i]) || (s[0] == qxx[i])) { board[sq] = i; found=1; break; } if (found==0) color[sq] = neutral; } } } while (s[0] != CP[29][0]); for (sq = 0; sq < 64; sq++) Mvboard[sq] = ((board[sq] != Stboard[sq]) ? 10 : 0); GameCnt = 0; Game50 = 1; ZeroRPT (); Sdepth = 0; InitializeStats (); ClrScreen (); UpdateDisplay (0, 0, 1, 0); } void SetupBoard (void) /* * Compatibility with Unix chess and the nchesstool. Set up a board position. * Eight lines of eight characters are used to setup the board. a8-h8 is the * first line. Black pieces are represented by uppercase characters. */ { SHORT r, c, sq, i; CHAR ch; CHAR s[80]; NewGame (); gets (s); /* skip "setup" command */ for (r = 7; r >= 0; r--) { gets (s); for (c = 0; c <= 7; c++) { ch = s[c]; sq = locn (r, c); color[sq] = neutral; board[sq] = no_piece; for (i = no_piece; i <= king; i++) if (ch == pxx[i]) { color[sq] = black; board[sq] = i; break; } else if (ch == qxx[i]) { color[sq] = white; board[sq] = i; break; } } } for (sq = 0; sq < 64; sq++) Mvboard[sq] = ((board[sq] != Stboard[sq]) ? 10 : 0); InitializeStats (); ClrScreen (); UpdateDisplay (0, 0, 1, 0); /*printz ("Setup successful\n");*/ printz (CP[106]); } void ShowDepth (CHAR ch) { #ifdef MSDOS ch++; /* shut up the compiler */ #endif /* MSDOS */ } void ShowLine (UTSHORT *bstline) { register int i; for (i = 1; bstline[i] > 0; i++) { if ((i > 1) && (i % 8 == 1)) printf ("\n "); algbr ((SHORT) (bstline[i] >> 8), (SHORT) (bstline[i] & 0xFF), false); printf ("%5s ", mvstr[0]); } printf ("\n"); } void ShowResults (SHORT score, UTSHORT *bstline, CHAR ch) { #if !defined CHESSTOOL if (flag.post) { ElapsedTime (2); printf ("%2d%c %6d %4ld %8ld ", Sdepth, ch, score, et / 100, NodeCnt); ShowLine (bstline); } #else register int i; MSCORE = score; MV[30] = ch; for (i = 1; bstline[i] > 0; i++) { MV[i] = bstline[i]; } MV[i] = 0; #endif /* CHESSTOOL */ } void SearchStartStuff (SHORT side) { signal (SIGINT, TerminateSearch); #ifndef MSDOS signal (SIGQUIT, TerminateSearch); #endif /* MSDOS */ #if !defined CHESSTOOL if (flag.post) { printf (CP[123], GameCnt/2+1, ResponseTime, TimeControl.clock[side]); } #endif /* CHESSTOOL */ } void OutputMove (void) { #ifdef DEBUG11 if (1) { FILE *D; extern UTSHORT PrVar[]; CHAR d[80]; int r, c, l, i; D = fopen ("/tmp/DEBUGA", "a+"); fprintf (D, "inout move is %s\n", mvstr[0]); strcpy (d, mvstr[0]); for (i = 1; PrVar[i] > 0; i++) { algbr ((SHORT) (PrVar[i] >> 8), (SHORT) (PrVar[i] & 0xFF), false); fprintf (D, "%5s ", mvstr[0]); } fprintf (D, "\n"); fprintf (D, "\n current board is\n"); for (r = 7; r >= 0; r--) { for (c = 0; c <= 7; c++) { l = locn (r, c); if (color[l] == neutral) fprintf (D, " -"); else if (color[l] == white) fprintf (D, " %c", qxx[board[l]]); else fprintf (D, " %c", pxx[board[l]]); } fprintf (D, "\n"); } fprintf (D, "\n"); fclose (D); strcpy (mvstr[0], d); } #endif if(flag.illegal){printf("%s\n",CP[225]);return;} if (mvstr[0][0] == '\0') goto nomove; #ifdef CLIENT if(mvstr[0][4] != '\0' && mvstr[0][4] != 'o'){mvstr[0][5]=toupper(mvstr[0][4]);mvstr[0][4]='=';mvstr[0][6]='\0';} #endif #if defined CHESSTOOL if (computer == black) printz ("%d. ... %s\n", ++mycnt1, mvstr[0]); else printz ("%d. %s\n", ++mycnt1, mvstr[0]); #else printz ("%d. ... %s\n", ++mycnt1, mvstr[0]); #endif /* CHESSTOOL */ nomove: if ((root->flags & (draw)) || flag.mate) goto summary; #ifndef BAREBONES if (flag.post) { SHORT h, l, t; h = TREE; l = 0; t = TREE >> 1; while (l != t) { if (Tree[t].f || Tree[t].t) l = t; else h = t; t = (l + h) >> 1; } #if defined MORESTATS ShowHashStats(); #endif #if !defined HASHSTATS /*printf ("Nodes %ld Tree %d Eval %ld Rate %ld RS high %ld low %ld\n",*/ printf (CP[89],GenCnt,NodeCnt,t,EvalNodes,(et>100)?(NodeCnt/(et/100)):0,0,0,reminus,replus); #else printf (CP[89],GenCnt,NodeCnt,t,EvalNodes,(et>100)?(NodeCnt/(et/100)):0,EADD,EGET,reminus,replus); /*printf ("Hin/Hout/Coll/Fin/Fout = %ld/%ld/%ld/%ld/%ld\n",*/ printf (CP[71], HashAdd, HashCnt, THashCol, HashCol,FHashCnt, FHashAdd); #endif } UpdateDisplay (root->f, root->t, 0, root->flags); /*printf ("My move is: %s\n", mvstr[0]);*/ #if !defined CHESSTOOL printf (CP[83], mvstr[0]); #endif if (flag.beep) printz ("%c", 7); #endif /* BAREBONES */ summary: if (root->flags & draw) /* printf ("Drawn game!\n");*/ printf (CP[57]); else if(flag.mate){ if (root->score == -9999) printf("%s mates!\n",ColorStr[opponent]); else if (root->score == 9998) printf("%s mates!\n",ColorStr[computer]); } #if !defined CHESSTOOL && !defined XBOARD #ifdef VERYBUGGY else if (root->score < -9000) printf("%s has a forced mate!\n",ColorStr[opponent]); else if (root->score > 9000) printf("%s has a forced mate!\n",ColorStr[computer]); #endif /*VERYBUGGY*/ #endif /* CHESSTOOL */ } void ClrScreen (void) { #if !defined CHESSTOOL && !defined XBOARD printz ("\n"); #endif } void UpdateDisplay (SHORT f, SHORT t, SHORT redraw, SHORT isspec) { SHORT r, c, l, m; if (redraw && !chesstool) { printz ("\n"); r = (SHORT)(TimeControl.clock[white] / 6000); c = (SHORT)((TimeControl.clock[white] % 6000) / 100); l = (SHORT)(TimeControl.clock[black] / 6000); m = (SHORT)((TimeControl.clock[black] % 6000) / 100); /*printz ("White %d:%02d Black %d:%02d\n", r, c, l, m);*/ printz (CP[116], r, c, l, m); printz ("\n"); for (r = 7; r >= 0; r--) { for (c = 0; c <= 7; c++) { l = ((flag.reverse) ? locn (7 - r, 7 - c) : locn (r, c)); if (color[l] == neutral) printz (" -"); else if (color[l] == white) printz (" %c", qxx[board[l]]); else printz (" %c", pxx[board[l]]); } printz ("\n"); } printz ("\n"); } } void skip () { while (*InPtr != ' ') InPtr++; while (*InPtr == ' ') InPtr++; } void skipb () { while (*InPtr == ' ') InPtr++; } void ShowMessage (CHAR *s) { printf("%s\n", s); } void ShowSidetoMove (void) { } void PromptForMove (void) { #if !defined CHESSTOOL && !defined XBOARD /*printz ("\nYour move is? ");*/ printz (CP[124]); #endif /* CHESSTOOL */ } void ShowCurrentMove (SHORT pnt, SHORT f, SHORT t) { #ifdef MSDOS f++; t++; pnt++; /* shut up the compiler */ #endif /* MSDOS */ } void ChangeAlphaWindow (void) { printz ("WAwindow: "); scanz ("%hd", &WAwindow); printz ("BAwindow: "); scanz ("%hd", &BAwindow); } void ChangeBetaWindow (void) { printz ("WBwindow: "); scanz ("%hd", &WBwindow); printz ("BBwindow: "); scanz ("%hd", &BBwindow); } void GiveHint (void) { if (hint) { algbr ((SHORT) (hint >> 8), (SHORT) (hint & 0xFF), false); printf(CP[72], mvstr[0]); /*hint*/ } else printz (CP[223]); } void SelectLevel (CHAR *sx) { CHAR T[64], *p, *q; XC = XCmore =0; if ((p = strstr (sx, CP[169])) != NULL) p += strlen (CP[169]); else if ((p = strstr (sx, CP[217])) != NULL) p += strlen (CP[217]); strcat (sx, "XX"); q = T; *q = '\0'; for (; *p != 'X'; *q++ = *p++); *q = '\0'; /* line empty ask for input */ while(true){ if (!T[0]) { printz (CP[61]); gets (T); } strcat (T, "XX"); /* skip whitespace */ for (p = T; *p == ' '; p++); /* Input forms are: M m[:s] - M moves in m:s time m[:s] t - game in m:s time increment t m:[s] - game in m:s time M m[:s] t - for M moves m:s time increment t then reset */ /* could be moves or a incremental clock */ TCminutes = TCmoves = TCseconds = TCadd = 0; TCmoves = (SHORT) strtol (p, &q, 10); if (*q == ':') { /* its gamein form: m:s or m:s t */ TCminutes = TCmoves; TCmoves = 0; if(*(q+1) != ' ') TCseconds = (SHORT) strtol (q + 1, &q, 10); else {q++; } if(*q != 'X' && *q != '+'){ TCadd = (SHORT) strtol (q, &q, 10) * 100; } } else { /* m or m t or M m t*/ while (*q == ' ') q++; if (*q == 'X' || *q == '+') { /* m only 1 number must be gamein */ TCminutes = TCmoves; TCmoves = 0; } else { /* M m or M m[:s] t */ TCminutes = (SHORT) strtol (q, &q, 10); if (*q == ':') { /* M m[:s] t */ if(*(q+1) != ' ') TCseconds = (SHORT) strtol (q + 1, &q, 10); else {q++; } TCadd = (SHORT) strtol (q, &q, 10); }else{/* M m or M m t */ if(*q != 'X' && *q != '+')/* its M m t*/ TCadd = (SHORT) strtol (q, &q, 10)*100; } } } while(*q == ' ')q++; XCmoves[XC] = TCmoves; XCminutes[XC] = TCminutes; XCseconds[XC] = TCseconds; XCadd[XC] = TCadd; XC++; if(*q != '+' || XC == 3) break; T[0]='\0'; } TimeControl.clock[white] = TimeControl.clock[black] = 0; SetTimeControl (); } #ifdef DEBUG void ChangeDbLev (void) { printz (CP[146]); #ifdef USEINT scanz ("%d", &debuglevel); #else scanz ("%hd", &debuglevel); #endif printf("%d\n",debuglevel); } #endif /* DEBUG */ void ChangeSearchDepth (void) { printz ("depth= "); #ifdef USEINT scanz ("%d", &MaxSearchDepth); #else scanz ("%hd", &MaxSearchDepth); #endif TCflag = !(MaxSearchDepth > 0); } void ChangeHashDepth (void) { printz ("hashdepth= "); scanz ("%hd", &HashDepth); printz ("MoveLimit= "); scanz ("%hd", &HashMoveLimit); } void SetContempt (void) { printz ("contempt= "); scanz ("%hd", &contempt); } void ChangeXwindow (void) { printz ("xwndw= "); scanz ("%hd", &xwndw); } void ShowPostnValue (SHORT sq) /* * must have called ExaminePosition() first */ { SHORT score; score = ScorePosition (color[sq]); if (color[sq] != neutral){ printz ("%3d%c ", svalue[sq],(color[sq] == black)?'b':'w');} else printz(" * "); } void DoDebug (void) { SHORT c, p, sq, tp, tc, tsq, score,j,k; CHAR s[40]; ExaminePosition (); ShowMessage (CP[65]); scanz ("%s", s); c = neutral; if (s[0] == CP[9][0] || s[0] == CP[9][1]) /* w W*/ c = white; if (s[0] == CP[9][2] || s[0] == CP[9][3]) /*b B*/ c = black; for (p = king; p > no_piece; p--) if ((s[1] == pxx[p]) || (s[1] == qxx[p])) break; if(p > no_piece) for(j=7;j>=0;j--){ for(k=0;k<8;k++){ sq=j*8+k; tp = board[sq]; tc = color[sq]; board[sq] = p; color[sq] = c; tsq = PieceList[c][1]; PieceList[c][1] = sq; ShowPostnValue (sq); PieceList[c][1] = tsq; board[sq] = tp; color[sq] = tc; } printz("\n"); } score = ScorePosition (opponent); printz (CP[103], score, mtl[computer], pscore[computer], mtl[opponent],pscore[opponent]); } void DoTable (SHORT table[64]) { SHORT sq,j,k; ExaminePosition (); for(j=7;j>=0;j--){ for(k=0;k<8;k++){ sq=j*8+k; printz ("%3d ", table[sq]); } printz("\n"); } } void ShowPostnValues (void) { SHORT sq, score,j,k; ExaminePosition (); for(j=7;j>=0;j--){ for(k=0;k<8;k++){ sq=j*8+k; ShowPostnValue (sq); } printz("\n"); } score = ScorePosition (opponent); printz (CP[103], score, mtl[computer], pscore[computer], mtl[opponent],pscore[opponent]); printz("\nhung white %d hung black %d\n",hung[white],hung[black]); } gnuchess-4.0.pl70/src/nuxdsp.c100444 21542 13 53163 5563700647 15311 0ustar cracraftuser/* * nuxdsp.c - (new) ALPHA interface for CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #ifdef MSDOS #include /*#include */ #include #include #include #define ESC 0x1B #define refresh() fflush(stdout) static void param (SHORT n); #else #include #include #include #include #ifdef notdef #if defined(__STDC__) /* */ extern void *malloc (size_t); extern void exit (int); /* */ extern CHAR *strcat (CHAR *, const CHAR *); extern int strcmp (const CHAR *, const CHAR *); extern CHAR *strcpy (CHAR *, const CHAR *); /* */ extern long int time (long int *); #endif #endif #endif /* MSDOS */ #include "gnuchess.h" int mycnt1, mycnt2; extern tshort sscore[]; extern SHORT pscore[2]; #define TAB (43) /* coordinates within a square for the following are ([1,5],[1,3]) */ #define SQW (5) #define SQH (3) #define VIR_C(s) ((flag.reverse) ? 7-column(s) : column(s)) #define VIR_R(s) ((flag.reverse) ? 7-row(s) : row(s)) #define VSQ_X(x) ((flag.reverse) ? SQW + 1 - (x) : (x)) #define VSQ_Y(y) ((flag.reverse) ? SQH + 1 - (y) : (y)) #define Vblack(s) (!((VIR_C(s) + VIR_R(s)) % 2)) /* Squares swapped */ #define Vcoord(s,x,y) \ ((SQW)*(VIR_C(s)))+(x),((SQH)*(7-VIR_R(s))+(y)) /* Squares and internal locations swapped */ #define VcoordI(s,x,y) \ ((SQW)*(VIR_C(s)))+(VSQ_X(x)),((SQH)*(7-VIR_R(s))+(VSQ_Y(y))) /* Squares and internal rows swapped */ #define VcoordR(s,x,y) \ ((SQW)*(VIR_C(s)))+(x),((SQH)*(7-VIR_R(s))+(VSQ_Y(y))) CHAR Analysis[128] = ""; UTSHORT MV[MAXDEPTH]; int MSCORE; CHAR *DRAW; extern SHORT Mwpawn[64], Mbpawn[64], Mknight[2][64], Mbishop[2][64]; SHORT PositionFlag = 0; #if defined(MSDOS) && !defined(SEVENBIT) static void ONormal (void); static void OReverse (void); #endif /* MSDOS && !SEVENBIT */ /* extern CHAR *getenv (const CHAR *);*/ void TerminateSearch (int), Die (int); void Initialize (void) { signal (SIGINT, Die); #ifndef MSDOS signal (SIGQUIT, Die); initscr (); crmode (); #else mycnt1 = mycnt2 = 0; #endif /* MSDOS */ } void ExitChess (void) { ListGame (); gotoXY (1, 24); #ifndef MSDOS refresh(); nocrmode (); endwin (); #endif /* MSDOS */ exit (0); } void Die (int Sig) { CHAR s[80]; signal (SIGINT, SIG_IGN); #ifdef MSDOS Sig++; /* shut up the compiler */ #else signal (SIGQUIT, SIG_IGN); #endif /* MSDOS */ ShowMessage (CP[31]); /*Abort?*/ scanz ("%s", s); if (strcmp (s, CP[210]) == 0) /*yes*/ ExitChess (); signal (SIGINT, Die); #ifndef MSDOS signal (SIGQUIT, Die); #endif /* MSDOS */ } void TerminateSearch (int Sig) { signal (SIGINT, SIG_IGN); #ifdef MSDOS Sig++; /* shut up the compiler */ #else signal (SIGQUIT, SIG_IGN); #endif /* MSDOS */ if (!flag.timeout) flag.musttimeout = true; flag.bothsides = false; signal (SIGINT, Die); #ifndef MSDOS signal (SIGQUIT, Die); #endif /* MSDOS */ } void ShowLine (UTSHORT *bstline) { } void help (void) { ClrScreen (); /*printz ("CHESS command summary\n");*/ printz (CP[40]); printz ("----------------------------------------------------------------\n"); /*printz ("g1f3 move from g1 to f3 quit Exit Chess\n");*/ printz (CP[158]); /*printz ("Nf3 move knight to f3 cache turn %s\n", (flag.cache) ? "off" : "on");*/ printz (CP[86], (flag.cache) ? CP[92] : CP[93]); /*printz ("a7a8q promote pawn to queen\n");*/ printz (CP[128], (flag.material) ? CP[92] : CP[93]); /*printz ("o-o castle king side easy turn %s\n", (flag.easy) ? "off" : "on");*/ printz (CP[173], (flag.easy) ? CP[92] : CP[93]); /*printz ("o-o-o castle queen side hash turn %s\n", (flag.hash) ? "off" : "on");*/ printz (CP[174], (flag.hash) ? CP[92] : CP[93]); /*printz ("bd redraw board reverse board display\n");*/ printz (CP[130]); /*printz ("list game to chess.lst book turn %s used %d of %d\n", (Book) ? "off" : "on", bookcount, booksize);*/ printz (CP[170], (Book) ? CP[92] : CP[93], bookcount, BOOKSIZE); /*printz ("undo undo last ply remove take back a move\n");*/ printz (CP[200]); /*printz ("edit edit board force enter game moves\n");*/ printz (CP[153]); /*printz ("switch sides with computer both computer match\n");*/ printz (CP[194]); /*printz ("white computer plays white black computer plays black\n");*/ printz (CP[202]); /*printz ("depth set search depth clock set time control\n");*/ printz (CP[149]); /*printz ("hint suggest a move post turn %s principle variation\n", (flag.post) ? "off" : "on");*/ printz (CP[177], (flag.post) ? CP[92] : CP[93]); /*printz ("save game to file get game from file\n");*/ printz (CP[188]); /*printz ("random randomize play new start new game\n");*/ printz (CP[181]); /*printz ("coords show coords rv reverse video\n");*/ printz (CP[144]); #if !defined(MSDOS) || defined(SEVENBIT) printz (CP[192]); #endif /* !MSDOS || SEVENBIT */ gotoXY (10, 20); printz (CP[47], ColorStr[computer]); gotoXY (10, 21); printz (CP[97], ColorStr[opponent]); gotoXY (10, 22); printz (CP[79], MaxResponseTime/100); gotoXY (10, 23); printz (CP[59], (flag.easy) ? CP[93] : CP[92]); gotoXY (40, 20); printz (CP[52], MaxSearchDepth); gotoXY (40, 21); printz (CP[100], (dither) ? CP[93] : CP[92]); gotoXY (40, 22); printz (CP[112], (flag.hash) ? CP[93] : CP[92]); gotoXY (40, 23); printz (CP[73]); gotoXY (10, 24); if(flag.gamein) printz (CP[230], (TCflag) ? CP[93] : CP[92], TimeControl.clock[white] / 100, TCadd/100, MaxSearchDepth); else printz (CP[110], (TCflag) ? CP[93] : CP[92], TimeControl.moves[white], TimeControl.clock[white] / 100, TCadd/100, MaxSearchDepth); refresh (); #ifdef BOGUS fflush (stdin); /*what is this supposed to do??*/ #endif /*BOGUS*/ getchar (); ClrScreen (); UpdateDisplay (0, 0, 1, 0); } void EditBoard (void) /* * Set up a board position. Pieces are entered by typing the piece followed * by the location. For example, Nf3 will place a knight on square f3. */ { SHORT a, r, c, sq, i; CHAR s[80]; flag.regularstart = true; Book = BOOKFAIL; ClrScreen (); UpdateDisplay (0, 0, 1, 0); gotoXY (TAB, 3); printz (CP[29]); gotoXY (TAB, 4); printz (CP[28]); gotoXY (TAB, 5); printz (CP[136]); gotoXY (TAB, 7); printz (CP[64]); a = white; do { gotoXY (TAB, 6); printz (CP[60], ColorStr[a]); /*Editing %s*/ gotoXY (TAB + 24, 7); ClrEoln (); scanz ("%s", s); if (s[0] == CP[28][0]) /*#*/ { for (sq = 0; sq < 64; sq++) { board[sq] = no_piece; color[sq] = neutral; DrawPiece (sq); } } if (s[0] == CP[136][0]) /*c*/ a = otherside[a]; c = s[1] - 'a'; r = s[2] - '1'; if ((c >= 0) && (c < 8) && (r >= 0) && (r < 8)) { sq = locn (r, c); for (i = king; i > no_piece; i--) if ((s[0] == pxx[i]) || (s[0] == qxx[i])) break; board[sq] = i; color[sq] = ((board[sq] == no_piece) ? neutral : a); DrawPiece (sq); } } while (s[0] != CP[29][0]); for (sq = 0; sq < 64; sq++) Mvboard[sq] = ((board[sq] != Stboard[sq]) ? 10 : 0); GameCnt = 0; Game50 = 1; ZeroRPT (); Sdepth = 0; InitializeStats (); ClrScreen (); UpdateDisplay (0, 0, 1, 0); } void ShowPlayers (void) { gotoXY (TAB, ((flag.reverse) ? 23 : 2)); printz ("%s", (computer == black) ? CP[218] : CP[74]); gotoXY (TAB, ((flag.reverse) ? 2 : 23)); printz ("%s", (computer == white) ? CP[218] : CP[74]); } void ShowDepth (CHAR ch) { gotoXY (TAB, 4); printz (CP[53], Sdepth, ch); /*Depth= %d%c*/ ClrEoln (); } void ShowScore (SHORT score) { gotoXY (TAB, 5); printz (CP[104], score); ClrEoln (); } void ShowMessage (CHAR *s) { gotoXY (TAB, 6); printz ("%s", s); ClrEoln (); } void ClearMessage (void) { gotoXY (TAB, 6); ClrEoln (); } void ShowCurrentMove (SHORT pnt, SHORT f, SHORT t) { algbr (f, t, false); gotoXY (TAB, 7); printz ("(%2d) %4s", pnt, mvstr[0]); } void ShowHeader (void) { gotoXY (TAB, 10); #ifdef MSDOS printz (CP[67]); #else printz (CP[68]); #endif /* MSDOS */ } void ShowSidetoMove (void) { gotoXY (TAB, 14); printz ("%2d: %s", 1 + GameCnt / 2, ColorStr[player]); ClrEoln (); } void ShowPrompt (void) { gotoXY (TAB, 19); printz (CP[121]); /*Your movwe is?*/ ClrEoln (); } void ShowNodeCnt (long int NodeCnt) { gotoXY (TAB, 21); printz (CP[90], NodeCnt, (et > 100) ? NodeCnt / (et / 100) : 0); ClrEoln (); } void ShowResults (SHORT score, UTSHORT *bstline, CHAR ch) { UCHAR d, ply; if (flag.post) { ShowDepth (ch); ShowScore (score); d = 7; for (ply = 1; bstline[ply] > 0; ply++) { if (ply % 4 == 1) { gotoXY (TAB, ++d); ClrEoln (); } algbr ((SHORT) bstline[ply] >> 8, (SHORT) bstline[ply] & 0xFF, false); printz ("%5s ", mvstr[0]); } ClrEoln (); while (d < 13) { gotoXY (TAB, ++d); ClrEoln (); } } } void SearchStartStuff (SHORT side) { SHORT i; signal (SIGINT, TerminateSearch); #ifdef MSDOS side++; /* shut up the compiler */ #else signal (SIGQUIT, TerminateSearch); #endif /* MSDOS */ for (i = 4; i < 14; i++) { gotoXY (TAB, i); ClrEoln (); } } void OutputMove (void) { UpdateDisplay (root->f, root->t, 0, (SHORT) root->flags); gotoXY (TAB, 17); if(flag.illegal) {printz (CP[225]); return;} printz (CP[84], mvstr[0]); /*My move is %s*/ if (flag.beep) putchar (7); ClrEoln (); gotoXY (TAB, 24); if (root->flags & draw) printz (CP[56], DRAW); else if (root->score == -9999) printz (CP[95]); else if (root->score == 9998) printz (CP[44]); #ifdef VERYBUGGY else if (root->score < -9000) printz (CP[96]); else if (root->score > 9000) printz (CP[45]); #endif /*VERYBUGGY*/ ClrEoln (); if (flag.post) { register SHORT h, l, t; h = TREE; l = 0; t = TREE >> 1; while (l != t) { if (Tree[t].f || Tree[t].t) l = t; else h = t; t = (l + h) >> 1; } ShowNodeCnt (NodeCnt); gotoXY (TAB, 22); printz (CP[81], t); /*Max Tree= %d*/ ClrEoln (); } } void UpdateClocks (void) { SHORT m, s; m = (SHORT) (et / 6000); s = (SHORT) (et - 6000 * (long) m) / 100; if (TCflag) { m = (SHORT) ((TimeControl.clock[player] - et) / 6000); s = (SHORT) ((TimeControl.clock[player] - et - 6000 * (long) m) / 100); } if (m < 0) m = 0; if (s < 0) s = 0; if (player == white) gotoXY (60, (flag.reverse) ? 2 : 23); else gotoXY (60, (flag.reverse) ? 23 : 2); printz ("%d:%02d ", m, s); if (flag.post) ShowNodeCnt (NodeCnt); refresh (); } void gotoXY (SHORT x, SHORT y) { #ifdef MSDOS putchar (ESC); putchar ('['); param (y); putchar (';'); param (x); putchar ('H'); #else move (y - 1, x - 1); #endif /* MSDOS */ } void ClrScreen (void) { #ifdef MSDOS putchar (ESC); putchar ('['); putchar ('2'); putchar ('J'); #else clear (); #endif /* MSDOS */ refresh (); } void ClrEoln (void) { #ifdef MSDOS putchar (ESC); putchar ('['); putchar ('K'); #else clrtoeol (); #endif /* MSDOS */ refresh (); } #ifdef MSDOS void param (SHORT n) { if (n >= 10) { register SHORT d, q; q = n / 10; d = n % 10; putchar (q + '0'); putchar (d + '0'); } else putchar (n + '0'); } #endif /* MSDOS */ void OReverse () { #ifdef MSDOS putchar (ESC); putchar ('['); param (7); putchar ('m'); #else standout (); /* attron (A_REVERSE); */ #endif /* MSDOS */ } void ONormal () { #ifdef MSDOS putchar (ESC); putchar ('['); param (0); putchar ('m'); #else standend (); /* attroff (A_REVERSE); */ #endif /* MSDOS */ } void DrawPiece (SHORT sq) { gotoXY (VcoordR (sq, 2, 2)); switch (color[sq]) { case black: if (flag.rv) OReverse (); #if defined(MSDOS) && !defined(SEVENBIT) printz (" %c ", pxx[board[sq]]); #else printz ((flag.stars ? "*%c*" : " %c "), pxx[board[sq]]); #endif /* MSDOS && !SEVENBIT */ ONormal (); break; case neutral: #if defined(MSDOS) && !defined(SEVENBIT) if (flag.rv) printz (Vblack (sq) ? "\262\262\262" : "\260\260\260"); else printz (Vblack (sq) ? "\260\260\260" : "\262\262\262"); #else if (flag.shade) printz (Vblack (sq) ? "///" : " "); else { if (Vblack (sq)) OReverse (); printz (" "); ONormal (); } #endif /* MSDOS && !SEVENBIT */ break; case white: #if defined(MSDOS) && !defined(SEVENBIT) if (!flag.rv) OReverse (); printz (" %c ", pxx[board[sq]]); ONormal (); #else printz (" %c ", pxx[board[sq]]); #endif /* MSDOS && !SEVENBIT */ break; default: ShowMessage (CP[55]); /*Draw piece color[sq] err*/ break; } } void DrawSquare (SHORT sq) { #if defined(MSDOS) && !defined(SEVENBIT) if (flag.rv) { gotoXY (Vcoord (sq, 1, 1)); printz (Vblack (sq) ? "\262\262\262\262\262" : "\260\260\260\260\260"); gotoXY (Vcoord (sq, 1, 2)); printz (Vblack (sq) ? "\262\262\262\262\262" : "\260\260\260\260\260"); gotoXY (Vcoord (sq, 1, 3)); printz (Vblack (sq) ? "\262\262\262\262\262" : "\260\260\260\260\260"); } else { gotoXY (Vcoord (sq, 1, 1)); printz (Vblack (sq) ? "\260\260\260\260\260" : "\262\262\262\262\262"); gotoXY (Vcoord (sq, 1, 2)); printz (Vblack (sq) ? "\260\260\260\260\260" : "\262\262\262\262\262"); gotoXY (Vcoord (sq, 1, 3)); printz (Vblack (sq) ? "\260\260\260\260\260" : "\262\262\262\262\262"); } #else if (flag.shade) { gotoXY (Vcoord (sq, 1, 1)); printz (Vblack (sq) ? "/////" : " "); gotoXY (Vcoord (sq, 1, 2)); printz (Vblack (sq) ? "/////" : " "); gotoXY (Vcoord (sq, 1, 3)); printz (Vblack (sq) ? "/////" : " "); } else { if (Vblack (sq)) OReverse (); gotoXY (Vcoord (sq, 1, 1)); printz (" "); gotoXY (Vcoord (sq, 1, 2)); printz (" "); gotoXY (Vcoord (sq, 1, 3)); printz (" "); ONormal (); } #endif /* MSDOS && !SEVENBIT */ } void DrawCoords (void) { SHORT z; for (z = 0; z <= 7; z++) { SHORT sq; sq = z << 3; gotoXY (VcoordI (sq, 1, 1)); #if !defined(MSDOS) || defined(SEVENBIT) if ((Vblack (sq) || flag.shade) && flag.rv) #endif /* !MSDOS || SEVENBIT */ OReverse (); printz ("%d", 1 + z); ONormal (); } for (z = 0; z <= 7; z++) { SHORT sq; sq = z; gotoXY (VcoordI (sq, SQW, SQH)); #if !defined(MSDOS) || defined(SEVENBIT) if ((Vblack (sq) || flag.shade) && flag.rv) #endif /* !MSDOS || SEVENBIT */ OReverse (); printz ("%c", cxx[z]); ONormal (); } #if !defined(MSDOS) || defined(SEVENBIT) for (z = 1; z <= (8 * SQH); z++) { gotoXY ((8 * SQW) + 1, z); printz ("|"); } #endif /* MSDOS && !SEVENBIT */ } void ShowPostnValue (SHORT sq) /* * must have called ExaminePosition() first */ { SHORT score; gotoXY (VcoordR (sq, 2, 1)); score = ScorePosition (color[sq]); #if !defined(MSDOS) || defined(SEVENBIT) if (Vblack (sq) && !flag.shade) OReverse (); #endif /* !MSDOS || SEVENBIT */ if (color[sq] != neutral) printz ("%3d", svalue[sq]); else #if defined(MSDOS) && !defined(SEVENBIT) { if (flag.rv) printz (Vblack (sq) ? "\262\262\262" : "\260\260\260"); else printz (Vblack (sq) ? "\260\260\260" : "\262\262\262"); } #else printz (flag.shade && Vblack (sq) ? "///" : " "); #endif /* MSDOS && !SEVENBIT */ ONormal (); } void ShowPostnValues (void) { SHORT sq, score; ExaminePosition (); for (sq = 0; sq < 64; sq++) ShowPostnValue (sq); score = ScorePosition (opponent); gotoXY (TAB, 5); printz (CP[103], score, mtl[computer], pscore[computer], mtl[opponent],pscore[opponent]); ClrEoln (); } void UpdateDisplay (SHORT f, SHORT t, SHORT redraw, SHORT isspec) { SHORT sq; if (redraw) { ShowHeader (); ShowPlayers (); for (sq = 0; sq < 64; sq++) { DrawSquare (sq); DrawPiece (sq); } if (flag.coords) DrawCoords (); } else { DrawPiece (f); DrawPiece (t); if (isspec & cstlmask) if (t > f) { DrawPiece (f + 3); DrawPiece (t - 1); } else { DrawPiece (f - 4); DrawPiece (t + 1); } else if (isspec & epmask) { DrawPiece (t - 8); DrawPiece (t + 8); } } if (PositionFlag) ShowPostnValues (); refresh (); } extern CHAR *InPtr; void skip () { while (*InPtr != ' ') InPtr++; while (*InPtr == ' ') InPtr++; } void skipb () { while (*InPtr == ' ') InPtr++; } void ChangeAlphaWindow (void) { ShowMessage (CP[114]); scanz ("%hd", &WAwindow); ShowMessage (CP[34]); scanz ("%hd", &BAwindow); } void ChangeBetaWindow (void) { ShowMessage (CP[115]); scanz ("%hd", &WBwindow); ShowMessage (CP[35]); scanz ("%hd", &BBwindow); } void GiveHint (void) { CHAR s[40]; if (hint) { algbr ((SHORT) (hint >> 8), (SHORT) (hint & 0xFF), false); strcpy (s, CP[198]); /*try*/ strcat (s, mvstr[0]); ShowMessage (s); } else ShowMessage (CP[223]); } void ChangeHashDepth (void) { ShowMessage (CP[163]); scanz ("%hd", &HashDepth); ShowMessage (CP[82]); scanz ("%hd", &HashMoveLimit); } void ChangeSearchDepth (void) { ShowMessage (CP[150]); scanz ("%hd", &MaxSearchDepth); TCflag = !(MaxSearchDepth > 0); } void SetContempt (void) { ShowMessage (CP[142]); scanz ("%hd", &contempt); } void SetAnalysis (void) { ShowMessage (CP[159]); scanz ("%s", Analysis); } void ChangeXwindow (void) { ShowMessage (CP[208]); scanz ("%hd", &xwndw); } void SelectLevel (CHAR *sx) { CHAR T[64], *p, *q; ClrScreen (); XC = XCmore =0; if ((p = strstr (sx, CP[169])) != NULL) p += strlen (CP[169]); else if ((p = strstr (sx, CP[217])) != NULL) p += strlen (CP[217]); strcat (sx, "XX"); q = T; *q = '\0'; for (; *p != 'X'; *q++ = *p++); *q = '\0'; /* line empty ask for input */ while(true){ if (!T[0]) { gotoXY(5,2); printz(CP[61]); refresh(); getstr (T); } strcat (T, "XX"); /* skip whitespace */ for (p = T; *p == ' '; p++); /* Input forms are: M m[:s] - M moves in m:s time m[:s] t - game in m:s time increment t m:[s] - game in m:s time M m[:s] t - for M moves m:s time increment t then reset */ /* could be moves or a incremental clock */ TCminutes = TCmoves = TCseconds = TCadd = 0; TCmoves = (SHORT) strtol (p, &q, 10); if (*q == ':') { /* its gamein form: m:s or m:s t */ TCminutes = TCmoves; TCmoves = 0; if(*(q+1) != ' ') TCseconds = (SHORT) strtol (q + 1, &q, 10); else {q++; } if(*q != 'X' && *q != '+'){ TCadd = (SHORT) strtol (q, &q, 10) * 100; } } else { /* m or m t or M m t*/ while (*q == ' ') q++; if (*q == 'X' || *q == '+') { /* m only 1 number must be gamein */ TCminutes = TCmoves; TCmoves = 0; } else { /* M m or M m[:s] t */ TCminutes = (SHORT) strtol (q, &q, 10); if (*q == ':') { /* M m[:s] t */ if(*(q+1) != ' ') TCseconds = (SHORT) strtol (q + 1, &q, 10); else {q++; } TCadd = (SHORT) strtol (q, &q, 10); }else{/* M m or M m t */ if(*q != 'X' && *q != '+')/* its M m t*/ TCadd = (SHORT) strtol (q, &q, 10)*100; } } } while(*q == ' ')q++; XCmoves[XC] = TCmoves; XCminutes[XC] = TCminutes; XCseconds[XC] = TCseconds; XCadd[XC] = TCadd; XC++; if(*q != '+' || XC == 3) break; T[0]='\0'; } TimeControl.clock[white] = TimeControl.clock[black] = 0; SetTimeControl (); ClrScreen (); UpdateDisplay (0, 0, 1, 0); } void DoDebug (void) { SHORT c, p, sq, tp, tc, tsq, score; CHAR s[40]; ExaminePosition (); ShowMessage (CP[65]); scanz ("%s", s); c = neutral; if (s[0] == CP[9][0] || s[0] == CP[9][1]) /* w W*/ c = white; if (s[0] == CP[9][2] || s[0] == CP[9][3]) /*b B*/ c = black; for (p = king; p > no_piece; p--) if ((s[1] == pxx[p]) || (s[1] == qxx[p])) break; if(p > no_piece) for (sq = 0; sq < 64; sq++) { tp = board[sq]; tc = color[sq]; board[sq] = p; color[sq] = c; tsq = PieceList[c][1]; PieceList[c][1] = sq; ShowPostnValue (sq); PieceList[c][1] = tsq; board[sq] = tp; color[sq] = tc; } score = ScorePosition (opponent); gotoXY (TAB, 5); printz (CP[103], score, mtl[computer], pscore[computer], mtl[opponent],pscore[opponent]); ClrEoln (); } void DoTable (SHORT table[64]) { SHORT sq; ExaminePosition (); for (sq=0;sq<64;sq++){ gotoXY (VcoordR (sq, 2, 1)); #if !defined(MSDOS) || defined(SEVENBIT) if (Vblack (sq) && !flag.shade) OReverse (); #endif /* !MSDOS || SEVENBIT */ printz ("%3d", table[sq]); ONormal (); } } gnuchess-4.0.pl70/src/postprint.c100444 21542 13 12266 5563700647 16031 0ustar cracraftuser/* * postprint.c - C source for GNU CHESS * * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include "gnuchess.h" #if !defined HASHFILE #ifdef MSDOS #define HASHFILE "gnuchess.has" #else #define HASHFILE "/usr/local/lib/gnuchess.hash" #endif #endif #ifdef MSDOS #include #include #include #define RWA_ACC "r+b" #define WA_ACC "w+b" #else #define RWA_ACC "r+" #define WA_ACC "w+" #include #include #endif /* MSDOS */ FILE *hashfile; long i, j; int nr[MAXDEPTH]; int r, c; CHAR line[128]; CHAR *l; short t; int cc1, cc2; CHAR mvstr[5][7]; SHORT board[64]; struct fileentry { UCHAR bd[32]; UCHAR f, t, flags, depth, sh, sl; } n; unsigned long hashkey, hashbd; /* hashtable flags */ #define truescore 0x0001 #define lowerbound 0x0002 #define upperbound 0x0004 #define kingcastle 0x0008 #define queencastle 0x0010 #define evalflag 0x0020 void algbr (SHORT f, SHORT t, SHORT flag) /* * Generate move strings in different formats. */ { int m3p; if (f != t) { /* algebraic notation */ mvstr[0][0] = Cxx[column (f)]; mvstr[0][1] = Rxx[row (f)]; mvstr[0][2] = Cxx[column (t)]; mvstr[0][3] = Rxx[row (t)]; mvstr[0][4] = mvstr[3][0] = '\0'; if (((mvstr[1][0] = Pxx[board[f]]) == 'P') || (flag & promote)) { if (mvstr[0][0] == mvstr[0][2]) { /* pawn did not eat */ mvstr[2][0] = mvstr[1][0] = mvstr[0][2]; /* to column */ mvstr[2][1] = mvstr[1][1] = mvstr[0][3]; /* to row */ m3p = 2; } else /* pawn ate */ { mvstr[2][0] = mvstr[1][0] = mvstr[0][0]; /* from column */ mvstr[2][1] = mvstr[1][1] = mvstr[0][2]; /* to column */ mvstr[2][2] = mvstr[0][3]; m3p = 3; /* to row */ } mvstr[2][m3p] = mvstr[1][2] = '\0'; if (flag & promote) { mvstr[0][4] = mvstr[1][2] = mvstr[2][m3p] = Qxx[flag & pmask]; mvstr[1][3] = mvstr[2][m3p + 1] = mvstr[0][5] = '\0'; } } else /* not a pawn */ { mvstr[2][0] = mvstr[1][0]; mvstr[2][1] = mvstr[0][1]; mvstr[2][2] = mvstr[1][1] = mvstr[0][2]; /* to column */ mvstr[2][3] = mvstr[1][2] = mvstr[0][3]; /* to row */ mvstr[2][4] = mvstr[1][3] = '\0'; strcpy (mvstr[3], mvstr[2]); mvstr[3][1] = mvstr[0][0]; if (flag & cstlmask) { if (t > f) { strcpy (mvstr[1], "o-o"); strcpy (mvstr[2], "O-O"); } else { strcpy (mvstr[1], "o-o-o"); strcpy (mvstr[2], "O-O-O"); } } } } else mvstr[0][0] = mvstr[1][0] = mvstr[2][0] = mvstr[3][0] = '\0'; } void main (int argc, CHAR **argv) { int f = 0; CHAR flbuf[10]; CHAR *fl; if ((hashfile = fopen (HASHFILE, RWA_ACC)) == NULL) exit (1); for (i = 0; i < MAXDEPTH; i++) nr[i] = 0; fseek (hashfile, 0L, SEEK_END); i = ftell (hashfile) / sizeof (struct fileentry); fseek (hashfile, 0L, SEEK_SET); printf ("/V 11 72 mul def /L 60 def\n"); for (j = 0; j < i; j++) { fread (&n, sizeof (struct fileentry), 1, hashfile); if (n.depth) { nr[0]++; if (nr[0] == 19) { nr[0] = 1; printf ("showpage\n/V 11 72 mul def\n"); printf ("/L 60 def\n"); f = 0; } /* now process this entry */ strcpy (line, "C ('#["); for (r = 0; r < 8; r++) { l = line + 6 + (7 - r) * 9; for (c = 0; c < 4; c++) { cc1 = (n.bd[r * 4 + c] >> 4) & 0xf; cc2 = n.bd[r * 4 + c] & 0xf; board[r * 8 + c * 2] = (int) cc1 & 0x7; board[r * 8 + c * 2 + 1] = (int) cc2 & 0x7; if (cc1 & 0x8) *l++ = Qxx[cc1 & 0x7]; else *l++ = Pxx[cc1 & 0x7]; if (cc2 & 0x8) *l++ = Qxx[cc2 & 0x7]; else *l++ = Pxx[cc2 & 0x7]; } *l++ = ';'; } l--; line[79] = '\0'; strcat (line, "]') show"); algbr (n.f, n.t, 0); t = (n.sh << 8) + n.sl; /* decode flags */ fl = flbuf; if (n.flags & kingcastle) *fl++ = 'k'; if (n.flags & queencastle) *fl++ = 'q'; if (n.flags & truescore) *fl++ = 't'; if (n.flags & lowerbound) *fl++ = 'l'; if (n.flags & upperbound) *fl++ = 'u'; *fl = '\0'; printf ("L V moveto\n"); printf ("R (%s flags %s depth %d score %d", mvstr[0], flbuf, n.depth, t); printf (") show\n"); printf ("L V 100 sub moveto\n"); printf ("%s\n", line); f++; if (f == 3) { printf ("/V V 120 sub def /L 60 def\n"); f = 0; } else printf ("/L 160 L add def\n"); } } if (nr[0]) printf ("showpage\n"); } gnuchess-4.0.pl70/src/search.c100444 21542 13 124760 5563700647 15257 0ustar cracraftuser/* * search.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback Copyright (c) 1992 Free Software * Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify it under * the terms of the GNU General Public License as published by the Free * Software Foundation; either version 2, or (at your option) any later * version. * * GNU Chess is distributed in the hope that it will be useful, but WITHOUT ANY * WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS * FOR A PARTICULAR PURPOSE. See the GNU General Public License for more * details. * * You should have received a copy of the GNU General Public License along with * GNU Chess; see the file COPYING. If not, write to the Free Software * Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" #include "ttable.h" #include "ttable.c" /* inline doesn't work with separate compilation!! */ #ifdef NULLMOVE #undef DEEPNULL #endif #if !defined OLDTIME && defined HASGETTIMEOFDAY double pow (); #endif SHORT background = 0; static SHORT DepthBeyond; UTSHORT PrVar[MAXDEPTH]; #if defined NULLMOVE || defined DEEPNULL SHORT null; /* Null-move already made or not */ SHORT no_null; SHORT PVari; /* Is this the PV */ #endif #ifdef DEBUG40 extern int whichway; #endif #ifdef DEBUG int xxxtmp; int tracetmp; UTSHORT DBLINE[MAXDEPTH]; struct leaf *dbptr; #endif SHORT zwndw; SHORT start_stage; SHORT thrashing_tt; /* must we recycle slots at random. TomV */ int ooo; #include "ataks.h" #include "debug41.h" /* ............ MOVE GENERATION & SEARCH ROUTINES .............. */ inline int repetition () /* Check for draw by threefold repetition. */ { register SHORT i, c, cnt; register SHORT m; SHORT b[64]; cnt = c = 0; /* try to avoid work */ if (GameCnt > Game50 + 3) { memset ((CHAR *) b, (int)0, (int)sizeof (b)); for (i = GameCnt; i >= Game50; i--) { m = GameList[i].gmove; /* does piece exist on diff board? */ if (b[m & 0x3f]) { /* does diffs cancel out, piece back? */ if ((b[m >> 8] += b[m & 0x3f]) == 0) --c; b[m & 0x3f] = 0; } else { /* create diff */ ++c; /* does diff cancel out another diff? */ if (!(b[m >> 8] -= (b[m & 0x3f] = board[m & 0x3f] + (color[m & 0x3f] << 8)))) --c;; } /* if diff count is 0 we have a repetition */ if (c == 0) if ((i ^ GameCnt) & 1) cnt++; } } return cnt; } int plyscore, globalscore; int pick (SHORT p1, SHORT p2) /* * Find the best move in the tree between indexes p1 and p2. Swap the best * move into the p1 element. * */ { register struct leaf *p, *q, *r, *k; register s0; struct leaf temp; k = p = &Tree[p1]; q = &Tree[p2]; s0 = p->score; for (r = p + 1; r <= q; r++) if (r->score != 9999 && (r->score) > s0) { s0 = (r->score); p = r; } if (p != k) { temp = *p; *p = *k; *k = temp; return true; } return false; } #ifdef DEBUG UTSHORT trace[MAXDEPTH]; CHAR traceline[256]; UTSHORT tracelog[MAXDEPTH]; int tracen = 0; int traceflag = 0; int traceply = 0; #endif int bookflag = false; int Jscore = 0; static int TCcount, TCleft; void SelectMove (SHORT side, SHORT iop) /* * Select a move by calling function search() at progressively deeper ply * until time is up or a mate or draw is reached. An alpha-beta window of * -Awindow to +Bwindow points is set around the score returned from the * previous iteration. If Sdepth != 0 then the program has correctly * predicted the opponents move and the search will start at a depth of * Sdepth+1 rather than a depth of 1. */ { static SHORT i, tempb, tempc, tempsf, tempst, xside, rpt; static SHORT alpha, beta, score; static struct GameRec *g; SHORT InChkDummy; SHORT start_score; unsigned int j; #ifdef DEBUG if (debuglevel & (512 | 1024)) { CHAR b[32]; SHORT c1, c2, r1, r2; tracen = 0; traceflag = false; traceply = 0; tracelog[0] = 0; while (true) { printf ("debug?"); gets (b); if (b[0] == 'p') traceply = atoi (&b[1]); else if (b[0] == '\0') break; else { c1 = b[0] - 'a'; r1 = b[1] - '1'; c2 = b[2] - 'a'; r2 = b[3] - '1'; trace[++tracen] = (locn (r1, c1) << 8) | locn (r2, c2); } if (tracen == 0 && traceply > 0) traceflag = true; } } #endif flag.timeout = false; flag.back = false; flag.musttimeout = false; INCscore = 0; xside = side ^ 1; /* we need to test if recycle will still have an effect -- DanO*/ /* recycle = (GameCnt % rehash) - rehash; /* not used anymore */ /* if background mode set to infinite */ if (iop == 2) { ResponseTime = 9999999; background = true; } else { player = side; if (TCflag) { TCcount = 0; background = false; if (TimeControl.moves[side] < 1) TimeControl.moves[side] = 1; /* special case time per move specified */ if (flag.onemove) { ResponseTime = TimeControl.clock[side] - 100; TCleft = 0; } else { /* calculate avg time per move remaining */ ResponseTime = (TimeControl.clock[side]) / (((TimeControl.moves[side]) * 3)/2 + 1); TCleft = (int) ResponseTime / 3; ResponseTime += TCadd / 2; if (TimeControl.moves[side] < 5) TCcount = MAXTCCOUNTX - 10; } if (ResponseTime < 101) { ResponseTime = 100; TCcount = MAXTCCOUNTX - 10; } else if (ResponseTime < 200) { TCcount = MAXTCCOUNTX - 10; } } else { ResponseTime = MaxResponseTime; TCleft = 0; ElapsedTime (1); } if (TCleft) { TCcount = ((int) ((TimeControl.clock[side] - ResponseTime)) / 2) / TCleft; if (TCcount > MAXTCCOUNTX) TCcount = 0; else TCcount = MAXTCCOUNTX - TCcount; } else TCcount = MAXTCCOUNTX; } ExtraTime = 0; ExaminePosition (); stage= -1; /* Force init in UpdateWeights() */ start_score= Tscore[0]= Tscore[1]= score= evaluate (side, 1, 1, 0, -9999, 9999, 0, &InChkDummy); start_stage= stage; #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ ShowSidetoMove (); #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ SearchStartStuff (side); #ifdef HISTORY memset ((UCHAR *) history, 0, (unsigned long) sizeof (history)); #endif FROMsquare = TOsquare = -1; PV = 0; if (iop == 1) hint = 0; for (i = 0; i < MAXDEPTH; i++) PrVar[i] = killr0[i] = killr1[i] = killr2[i] = killr3[i] = 0; /* set initial window for search */ alpha = score - ((computer == black) ? BAwindow : WAwindow); beta = score + ((computer == black) ? BBwindow : WBwindow); rpt = 0; TrPnt[1] = 0; root = &Tree[0]; #ifdef LEGAL VMoveList (side, 1); #else MoveList (side, 1); #endif for (i = TrPnt[1]; i < TrPnt[2]; i++) pick (i, TrPnt[2] - 1); /* can I get a book move? */ if (flag.regularstart && Book) { flag.timeout = bookflag = OpeningBook (&hint, side); if (TCflag && !flag.onemove) ResponseTime += ResponseTime; } /* zero stats for hash table */ reminus = replus = 0; GenCnt = NodeCnt = ETnodes = EvalNodes = 0; #if defined HASHSTATS ClearHashStats(); #endif globalscore = plyscore = score; Jscore = 0; zwndw = 20; #include "debug4.h" /********************* main loop ********************************/ Sdepth = (MaxSearchDepth < (MINDEPTH - 1)) ? MaxSearchDepth : (MINDEPTH - 1); while (!flag.timeout) { /* go down a level at a time */ Sdepth++; #if defined NULLMOVE || defined DEEPNULL null = 0; PVari = 1; #endif DepthBeyond = Sdepth + ((Sdepth == 1) ? FBEYOND : flag.threat ? SBEYOND: TBEYOND); #if defined NULLMOVE || defined DEEPNULL no_null= (emtl[xside] == 0 || emtl[side] == 0); #endif #ifndef BAREBONES #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ ShowDepth (' '); #endif root->score= Tscore[0]= Tscore[1]= start_score; /* search at this level returns score of PV */ score = search (side, 1, Sdepth, 0, alpha, beta, PrVar, &rpt, QBLOCK, false); /* save PV as killer */ for (i = 1; i <= Sdepth; i++) killr0[i] = PrVar[i]; /* low search failure re-search with (-inf,score) limits */ if (score < alpha) { #ifndef BAREBONES reminus++; #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ ShowDepth ('-'); #endif if (TCflag && TCcount < MAXTCCOUNTR) { TCcount = MAXTCCOUNTR - 1; ExtraTime += (8 * TCleft); } root->score= Tscore[0]= Tscore[1]= start_score; score = search (side, 1, Sdepth, 0, -9999, 9999, PrVar, &rpt,QBLOCK,false); } /* high search failure re-search with (score, +inf) limits */ else if (score > beta && !(root->flags & exact)) { #ifndef BAREBONES replus++; #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ ShowDepth ('+'); #endif root->score= Tscore[0]= Tscore[1]= start_score; score = search (side, 1, Sdepth, 0, -9999, 9999, PrVar, &rpt,QBLOCK,false); } /**************** out of search ********************************************/ if (flag.musttimeout || Sdepth >= MaxSearchDepth) flag.timeout = true; else if (TCflag && (Sdepth > (MINDEPTH - 1)) && (TCcount < MAXTCCOUNTR)) { if (killr0[1] != PrVar[1] /* || Killr0[2] != PrVar[2] */ ) { TCcount++; ExtraTime += TCleft; } if ((abs (score - globalscore) / Sdepth) > ZDELTA) { TCcount++; ExtraTime += TCleft; } } if (score > (Jscore - zwndw) && score > (Tree[1].score + 250)) ExtraTime = 0; ElapsedTime (2); if (root->flags & exact) flag.timeout = true; #if defined OLDTIME || !defined HASGETTIMEOFDAY else if (!(Sdepth < MINDEPTH) && TCflag && ((4 * et) > (2 * ResponseTime + ExtraTime))) flag.timeout = true; #else else if (!(Sdepth < MINDEPTH) && TCflag && !flag.onemove && ((int) ((double)1.93913099l * (pow ((double) et, (double)1.12446928l))) > (ResponseTime + ExtraTime))) { flag.timeout = true;} #endif /************************ time control ***********************************/ /* save PV as killer */ for (i = 1; i <= Sdepth + 1; i++) killr0[i] = PrVar[i]; if (!flag.timeout) start_score= Tscore[0] = score; /* if (!flag.timeout) */ /* if done or nothing good to look at quit */ if ((root->flags & exact) || (score < -9000)) flag.timeout = true; /* find the next best move put below root */ #include "debug13.h" if (!flag.timeout) { /* */ #if !defined NODYNALPHA Jscore = (plyscore + score) >> 1; #endif zwndw = 20 + abs (Jscore / 12); plyscore = score; /* recompute search window */ beta = score + ((computer == black) ? BBwindow : WBwindow); #if !defined NODYNALPHA alpha = ((Jscore < score) ? Jscore : score) - ((computer == black) ? BAwindow : WAwindow) - zwndw; #else alpha = score - ((computer == black) ? BAwindow : WAwindow); #endif } #ifndef BAREBONES #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ ShowResults (score, PrVar, '.'); #ifdef DEBUG41 debug41 (score, PrVar, '.'); #endif #endif #include "debug16.h" } /******************************* end of main loop ***********************************/ /* background mode */ if (iop == 2) return; #include "debug4.h" /* if no moves and not in check then draw */ if ((score == -9998) && !(SqAtakd (PieceList[side][0], xside))) { root->flags |= draw; DRAW = CP[87]; /* No moves */ } else if (GameCnt == MAXMOVES) { root->flags |= draw; DRAW = CP[80]; /* Max Moves */ } /* not in book so set hint to guessed move for other side */ if (!bookflag) hint = ((PrVar[1]) ? PrVar[2] : 0); algbr (root->f, root->t, (SHORT) root->flags); /* if not mate or draw make move and output it */ if (((score != -9998) && (score != 9998) && (rpt <= 2)) || (root->flags & draw)) { MakeMove (side, &Tree[0], &tempb, &tempc, &tempsf, &tempst, &INCscore); #if !defined NOMATERIAL if (flag.material && !pmtl[black] && !pmtl[white] && (mtl[white] < (valueR + valueK)) && (mtl[black] < (valueR + valueK))) { root->flags |= draw; DRAW = CP[224]; /* No pieces */ } else #endif if (!PieceCnt[black] && !PieceCnt[white]) { root->flags |= draw; DRAW = CP[88]; /* No pieces */ } } else { root->score = score; /* When mate, ignore distinctions! * --SMC */ } g = &GameList[GameCnt]; if (g->flags & capture && g->piece == king) { flag.mate = flag.illegal = true; } /* If Time Control get the elapsed time */ if (TCflag) ElapsedTime (1); /* if mate set flag */ if ((score == -9998) || (score == 9998)) {flag.mate = true; #ifndef CLIENT flag.quit = true; #endif } OutputMove (); /* if mate clear hint */ if (flag.mate) hint = 0; /* if pawn move or capture or castle or promote zero repitition array */ if ((board[root->t] == pawn) || (root->flags & (capture | cstlmask | promote))) { Game50 = GameCnt; ZeroRPT (); } /* add move to game list */ g->score = score; g->nodes = NodeCnt; g->time = (et + 50) / 100; g->depth = Sdepth; #include "debug40.h" /* update time comtrol info */ if (TCflag) { #if defined CHESSTOOL || defined XBOARD TimeControl.clock[side] -= (et + OperatorTime + 45); timecomp[compptr] = (et + OperatorTime + 45); #else TimeControl.clock[side] -= (et + OperatorTime); timecomp[compptr] = (et + OperatorTime); #endif TimeControl.clock[side] += TCadd; /* finished our required moves - setup the next set */ --TimeControl.moves[side]; } /* check for end conditions */ if ((root->flags & draw) /* && flag.bothsides */ ) #if !defined CLIENT flag.mate = true; #else ; #endif else if (GameCnt == MAXMOVES) { flag.mate = true; } /* out of move store, you loose */ else /* switch to other side */ player = xside; Sdepth = 0; } int search (SHORT side, register SHORT ply, register SHORT depth, SHORT ext, SHORT alpha, SHORT beta, UTSHORT *bstline, SHORT *rpt, SHORT SAVEHT, SHORT didnull) /* * Perform an alpha-beta search to determine the score for the current board * position. If depth <= 0 only capturing moves, pawn promotions and * responses to check are generated and searched, otherwise all moves are * processed. The search depth is modified for check evasions, certain * re-captures and threats. Extensions may continue for up to 11 ply beyond * the nominal search depth. */ { register SHORT j, pnt; SHORT tempb, tempc, tempsf, tempst; SHORT xside, pbst, score, rcnt, InChk; UTSHORT mv, nxtline[MAXDEPTH]; struct leaf *node, tmp; SHORT best = -12000; SHORT bestwidth = 0; #if defined NULLMOVE || defined DEEPNULL SHORT PVsave; SHORT PVarisave; SHORT verydeep= flag.verydeep; #endif SHORT extdb= 0; SHORT threat= 0; /* tom@izf.tno.nl */ SHORT threat2= 0; /* tom@izf.tno.nl */ SHORT do_pvs; NodeCnt++; /* look every ZNODE nodes for a timeout */ #if defined NULLMOVE || defined DEEPNULL if (!null) { #endif if (NodeCnt > ETnodes) { ElapsedTime (2); if (flag.back) { flag.back = false; flag.timeout = true; flag.musttimeout = false; } else if (TCflag || MaxResponseTime) { if ((et >= (ResponseTime + ExtraTime)) && Sdepth > MINDEPTH ) { /* try to extend to finish ply */ if (!flag.onemove && (flag.back || (TCflag && TCcount < MAXTCCOUNTX))) { flag.back = false; flag.musttimeout = true; TCcount += 1; ExtraTime += TCleft; } else { flag.back = false; flag.timeout = true; flag.musttimeout = false; } } } else if (flag.back) { flag.back = false; flag.timeout = true; flag.musttimeout = false; } } else if (!TCflag && flag.musttimeout && Sdepth > MINDEPTH) { flag.timeout = true; flag.musttimeout = false; } #if defined NULLMOVE || defined DEEPNULL } #endif xside = side ^ 1; if (ply == 1) INCscore= 0; score = evaluate (side, ply, depth, ext, alpha, beta, INCscore, &InChk); /* * check for possible repitition if so call repitition - rpt is * repeat count */ if (ProbeRPThash(side,hashkey)) { *rpt = repetition (); if (*rpt == 1) score = -contempt; else if (*rpt > 2) { bstline[ply] = 0; return (-contempt); } } else *rpt = 0; /* score > 9000 its a draw or mate */ if (score > 9000 || root->flags & draw) { bstline[ply] = 0; return (score); } /* Do we need to add depth because of special conditions */ /* if in check or pawn threat or in capture sequence search deeper */ /*************************************** depth extensions ***********************************/ #define DOTHREAT (start_stage < THRSTAGE) #define DOCHECK (start_stage < CHECKSTAGE) Threat[ply]= 0; if (depth > 0) { /* Allow opponent a chance to check again */ if (InChk) { if (flag.threat) depth= DOCHECK && (ply+depth1 && PawnThreat[ply - 1] && ply+depth2 && CptrFlag[ply - 1] && CptrFlag[ply - 2] && ((ply (root->score - valueP/4) && score <(root->score + valueP/4)))) #endif (score > alpha && score < beta))) ) ++depth; } else { int tripple_check = 0; if (score >= alpha && (InChk || (ply>1 && PawnThreat[ply - 1] && depth 1 && !ext))) { threat2= 1; ext++; depth= 1; } else if (score <= beta && ((ply4 && ChkFlag[ply-2] && ChkFlag[ply-4] && (ChkFlag[ply-2] != ChkFlag[ply-4] || (flag.threat && DOTHREAT && QueenCheck[ply-2]))) || (flag.threat && ply6 && ChkFlag[ply-2] && ChkFlag[ply-4] && ChkFlag[ply-6] && (tripple_check=1) && ((ply < Sdepth+4 ? (ChkFlag[ply-2] != ChkFlag[ply-4] || ChkFlag[ply-2] != ChkFlag [ply-6]) : (ChkFlag[ply-2] != ChkFlag[ply-4] && ChkFlag[ply-2] != ChkFlag[ply-6] && ChkFlag[ply-4] != ChkFlag[ply-6])) || (DOTHREAT && QueenCheck[ply-2] && QueenCheck[ply-4] && QueenCheck[ply-6] && QueenCheck[ply-2] != QueenCheck[ply-6])) ))) { if (tripple_check && DepthBeyond < Sdepth+13+DEPTHMARGIN) { extdb += 2; DepthBeyond += 2; } depth= 1; ext++; Threat[ply]= threat= 1; } } ThreatSave[ply]= ((ply>1 && ThreatSave[ply-1]) || threat); /*******************************************************************************************/ /* Make sure that width test at lower ply gets non random move count in case of pruning: -- TomV This test also allows us to delay move generation till the null move is done. */ if (ply>1) TrPnt[ply+1]= TrPnt[ply]; /* * if more then DepthBeyond ply past goal depth or at goal depth and * score > beta quit - means we are out of the window */ if (ply > DepthBeyond || (depth < 1 && score > beta)) { return (score); } /* * if below first ply and not at goal depth generate all moves else only * capture moves */ #if defined ttblsz if ( flag.hash) { if (ProbeTTable (side, depth, ply, &alpha, &beta, &score) == true) { if (beta == -20000 || alpha > beta) { bstline[ply] = PV; bstline[ply + 1] = 0; /* * make sure the move is in the * MoveList */ if (ply == 1) { struct leaf tmp; register int spnt; for (spnt = TrPnt[ply]; spnt < TrPnt[ply + 1]; spnt++) { if (((Tree[spnt].f << 8) | Tree[spnt].t) == PV) { if (ply == 1 && Tree[spnt].score == DONTUSE) {bstline[1] = 0; break;} Tree[spnt].score = (beta == -20000) ? score : alpha; if (abs (score) > 9000) Tree[spnt].flags |= exact; if (spnt != TrPnt[ply]) { tmp = Tree[TrPnt[ply]]; Tree[TrPnt[ply]] = Tree[spnt]; Tree[spnt] = tmp; } #include "debug64.h" if (beta == -20000) return (score); else return (alpha); } } } else { register int i = TrPnt[ply]; Tree[i].t = PV & 0x3f; Tree[i].f = PV>>8; Tree[i].flags = 0; Tree[i].reply = 0; Tree[i].score = (beta == -20000) ? score : alpha; TrPnt[ply+1] = i+1; if (abs (score) > 9000) Tree[i].flags |= exact; if (beta == -20000) return (score); else return (alpha); } } } /* ok try the transition file if its there */ else if (hashfile && (depth > HashDepth) && (GameCnt < HashMoveLimit) && (ProbeFTable (side, depth, ply, &alpha, &beta, &score) == true)) { if (beta == -20000 || alpha > beta) { bstline[ply] = PV; bstline[ply + 1] = 0; /* * make sure the move is in the * MoveList */ if (ply == 1) { struct leaf tmp; register int spnt; for (spnt = TrPnt[ply]; spnt < TrPnt[ply + 1]; spnt++) { if (((Tree[spnt].f << 8) | Tree[spnt].t) == PV) { if (ply == 1 && Tree[spnt].score == DONTUSE) {bstline[1] = 0; break;} Tree[spnt].score = (beta == -20000) ? score : alpha; if (abs (score) > 9000) Tree[spnt].flags |= exact; if (spnt != TrPnt[ply]) { tmp = Tree[TrPnt[ply]]; Tree[TrPnt[ply]] = Tree[spnt]; Tree[spnt] = tmp; } PutInTTable (side, score, depth, ply, alpha, beta, PV); #include "debug10.h" if (beta == -20000) return (score); else return (alpha); } } } else { register int i = TrPnt[ply]; Tree[i].t = PV & 0x3f; Tree[i].f = PV>>8; Tree[i].score = (beta == -20000) ? score : alpha; TrPnt[ply+1] = i+1; if (abs (score) > 9000) Tree[i].flags |= exact; if (beta == -20000) return (score); else return (alpha); } } } } #endif /* ttblsz */ if (depth > 0 || (background && ply < Sdepth + 2)) {if(ply >1) #ifdef LEGAL VMoveList (side, ply);} #else MoveList (side, ply);} #endif else { #ifdef LEGAL VCaptureList (side, ply); #else CaptureList (side, ply); #endif if(!SAVEHT)SAVEHT = ply; } /* no moves return what we have */ /* * normally a search will continue til past goal and no more capture * moves exist */ /* unless it hits DepthBeyond */ if (TrPnt[ply] == TrPnt[ply + 1]) { if(!InChk) return (score); else return (-10001+ply); } /* if not at goal set best = -inf else current score */ best = (depth > 0) ? -12000 : score; #ifdef NULLMOVE PVarisave = PVari; if (!null && /* no previous null-move */ !PVari && /* no null-move during the PV */ (ply > 2) && /* not at ply 1 */ (ply <= Sdepth) && (depth > 3) && !InChk && /* no check */ ((mtl[side] + mtl[xside]) > NULLMOVELIM)) /* enough material such that zugzwang is unlike but who knows which value is suitable? */ { /* ok, we make a null move, i.e. this means we have nothing to do but we have to keep the some arrays up to date otherwise gnuchess gets confused. Maybe somebody knows exactly which informations are important and which not. Another idea is that we try the null-move first and generate the moves later. This may save time but we have to take care that PV and other variables contain the right value so that the move ordering works right. */ register struct GameRec *g; nxtline[ply + 1] = 0; CptrFlag[ply] = 0; PawnThreat[ply] = 0; Tscore[ply] = score; PVsave = PV; PV = 0; null = 1; g = &GameList[++GameCnt]; g->hashkey = hashkey; g->hashbd = hashbd; epsquare = -1; TOsquare = -1; g->Game50 = Game50; g->gmove = -1; g->flags = 0; g->piece = 0; g->color = neutral; best = -search (xside, ply + 1, false, depth - 2, -beta - 1, -beta, nxtline, &rcnt,false,false); null = 0; PV = PVsave; GameCnt--; if (best < alpha) best = -12000; else if (best > 0 && best > beta) return (best); else best = -12000; } #elif defined DEEPNULL /* * The deepnull algoritm is taken from the article by * Christian Donninger in ICCA journal Vol 16, No. 3. TomV */ PVarisave = PVari; if ((flag.deepnull ? !didnull : !null) && /* no previous null-move */ !flag.nonull && !no_null && !PVari && /* no null-move during the PV */ (ply > (flag.deepnull ? 1: 2)) && /* not at ply 1 */ (score > alpha - 150 || !flag.deepnull) && (ply <= Sdepth || flag.deepnull) && (depth > (flag.deepnull ? (verydeep ? 1: 2): 3)) && !InChk && /* no check */ /* enough material such that zugzwang is unlikely: */ ! (emtl[xside] == 0 || emtl[side] <= valueB)) { /* ok, we make a null move, i.e. this means we have nothing to do but we have to keep the some arrays up to date otherwise gnuchess gets confused. Another idea is that we try the null-move first and generate the moves later. This may save time but we have to take care that PV and other variables contain the right value so that the move ordering works right. */ CptrFlag[ply] = 0; PawnThreat[ply] = 0; Tscore[ply] = score; PVsave = PV; PV = 0; epsquare = -1; TOsquare = -1; if (!null) null= ply; if (flag.deepnull) { int nmscore = -search (xside, ply + 1, (depth >= 3 ? depth - 3: 0), ext, -beta, -alpha, nxtline, &rcnt,false,1); if (ply == null) null = 0; PV = PVsave; if (nmscore > beta) { DepthBeyond-= extdb; return nmscore; } if (nmscore > alpha) best= nmscore; if (depth <= 3 && ply < DepthBeyond-depth-4 && score >= beta && nmscore < score - 350) depth++; } else { best = -search (xside, ply + 1, depth - 2, ext, -beta - 1, -beta, nxtline, &rcnt, false, 1); null = 0; PV = PVsave; if (best < alpha) best = -12000; else if (best > beta) { DepthBeyond-= extdb; return (best); } else best = -12000; } } #endif /* if best so far is better than alpha set alpha to best */ if (best > alpha) alpha = best; /********************** main loop ************************************************************************/ /* look at each move until no more or beta cutoff */ do_pvs = 0; for (pnt = pbst = TrPnt[ply]; pnt < TrPnt[ply + 1] && best <= beta; pnt++) { /* find the most interesting looking of the remaining moves */ if (ply > 1) pick (pnt, TrPnt[ply + 1] - 1); #if defined NULLMOVE || defined DEEPNULL PVari = PVarisave && (pnt == pbst); /* Is this the PV? */ #endif node = &Tree[pnt]; if (pnt == pbst) do_pvs= flag.pvs #if defined NULLMOVE || defined DEEPNULL && !null #endif && (PrVar[ply] == ((node->f << 8) | node->t)); /* is this a forbidden move */ if (ply == 1 && node->score == DONTUSE) continue; #ifdef DEBUG if (debuglevel & (512 | 1024)) { if (!tracen) traceflag = ((ply > traceply) ? false : true); else if (ply <= tracen && (ply == 1 || traceflag)) { if (trace[ply] == (Tree[pnt].t | (Tree[pnt].f << 8))) traceflag = true; else traceflag = false; } tracelog[ply] = (Tree[pnt].t | (Tree[pnt].f << 8)); tracelog[ply + 1] = 0; } #endif nxtline[ply + 1] = 0; #ifndef BAREBONES /* if at top level */ if (ply == 1) { /* at the top update search status */ if (flag.post) #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ ShowCurrentMove (pnt, node->f, node->t); } #endif /* make the move and go deeper */ MakeMove (side, node, &tempb, &tempc, &tempsf, &tempst, &INCscore); CptrFlag[ply] = (node->flags & capture)?TOsquare+1:0; PawnThreat[ply] = (node->flags & pwnthrt); Tscore[ply] = node->score; PV = node->reply; #ifdef DEBUG xxxtmp = node->score; tracetmp = traceflag; #endif if (do_pvs) { if (pbst == pnt) { node->score= -search (xside, ply + 1, depth > 0 ? depth - 1 : 0, ext, -beta, -alpha, nxtline, &rcnt,SAVEHT, 0); } else { node->score= -search(xside, ply + 1, depth > 0 ? depth - 1 : 0, ext, -alpha-1, -alpha, nxtline, &rcnt,SAVEHT, 0); if (node->score >= best && alpha <= node->score && node->score <= beta) node->score = -search (xside, ply + 1, depth > 0 ? depth - 1 : 0, ext, -beta, -node->score, nxtline, &rcnt,SAVEHT, 0); } } else node->score = -search (xside, ply + 1, (depth > 0) ? depth - 1 : 0, ext, -beta, -alpha, nxtline, &rcnt, SAVEHT, false); node->width = (ply % 2 == 1) ? (TrPnt[ply + 2] - TrPnt[ply + 1]) : 0; if (abs (node->score) > 9000) node->flags |= exact; else if (rcnt == 1) node->score /= 2; if(node->score == 9999-ply && !ChkFlag[ply] ) {node->flags |= draw; node->score = (-contempt);} #include "debug256.h" if ((rcnt >= 2 || GameCnt - Game50 > 99 )) { node->flags |= (draw | exact); DRAW = CP[58]; /* Draw */ node->score = -contempt; } node->reply = nxtline[ply + 1]; /* reset to try next move */ UnmakeMove (side, node, &tempb, &tempc, &tempsf, &tempst); /* if best move so far */ if (!flag.timeout && ((node->score > best) || ((node->score == best) && (node->width > bestwidth)))) { /* * all things being equal pick the denser part of the * tree */ bestwidth = node->width; /* * if not at goal depth and better than alpha and not * an exact score increment by depth */ if (depth > 0 && node->score > alpha && !(node->flags & exact)) node->score += depth; best = node->score; pbst = pnt; if (best > alpha) { alpha = best; } /* update best line */ for (j = ply + 1; nxtline[j] > 0; j++) bstline[j] = nxtline[j]; bstline[j] = 0; bstline[ply] = (node->f << 8) | node->t; /* if at the top */ if (ply == 1) { /* * if its better than the root score make it * the root */ if ((best > root->score) || ((best == root->score) && (bestwidth > root->width))) { tmp = Tree[pnt]; for (j = pnt - 1; j >= 0; j--) Tree[j + 1] = Tree[j]; Tree[0] = tmp; pbst = 0; } #ifndef BAREBONES #ifdef QUIETBACKGROUND if (!background) #endif /* QUIETBACKGROUND */ if (Sdepth > 2) if (best > beta) { ShowResults (best, bstline, '+'); #ifdef DEBUG41 debug41 (best, bstline, '+'); #endif } else if (best < alpha) { ShowResults (best, bstline, '-'); #ifdef DEBUG41 debug41 (best, bstline, '-'); #endif } else ShowResults (best, bstline, '&'); #ifdef DEBUG41 debug41 (best, bstline, '&'); #endif #endif if (!background && Sdepth > 2){ if( best < alpha ) { TCcount = 0;ExtraTime += 20*TCleft;} } } } if (flag.timeout) { DepthBeyond-= extdb; #if defined NULLMOVE || defined DEEPNULL PVari = PVarisave; #endif return (Tscore[ply - 1]); } } /**************************************************************/ /*************** out of main loop *****************************/ node = &Tree[pbst]; mv = (node->f << 8) | node->t; #if defined NULLMOVE || defined DEEPNULL PVari = PVarisave; #endif #ifdef DEBUG #include "debug512.h" #endif /* * we have a move so put it in local table - if it's already there * done else if not there or needs to be updated also put it in * hashfile */ #if ttblsz if (flag.hash && !SAVEHT /*&& ply <= Sdepth*/ && *rpt == 0 && best == alpha) { if (PutInTTable (side, best, depth, SAVEHT?SAVEHT:ply, alpha, beta, mv) && hashfile && (depth > HashDepth) && (GameCnt < HashMoveLimit)) { PutInFTable (side, best, depth, ply, alpha, beta, node->f, node->t); } } #endif /* ttblsz */ if (depth > 0) { #ifdef HISTORY j = (node->f << 8) | node->t; if (side == black) j |= 0x4000; if (history[j] < HISTORYLIM) history[j] += (unsigned short) 1 << depth; #endif if (node->t != (SHORT) (GameList[GameCnt].gmove & 0xFF)) if (best <= beta) killr3[ply] = mv; else if (mv != killr1[ply]) { killr2[ply] = killr1[ply]; killr1[ply] = mv; } killr0[ply] = ((best > 9000) ? mv : 0); } return (best); } int castle (SHORT side, SHORT kf, SHORT kt, SHORT iop) /* Make or Unmake a castling move. */ { register SHORT rf, rt, t0, xside; xside = side ^ 1; if (kt > kf) { rf = kf + 3; rt = kt - 1; } else { rf = kf - 4; rt = kt + 1; } if (iop == 0) { if (kf != kingP[side] || board[kf] != king || board[rf] != rook || color[kf] != side || color[rf] != side || Mvboard[kf] != 0 || Mvboard[rf] != 0 || color[kt] != neutral || color[rt] != neutral || color[kt - 1] != neutral || SqAtakd (kf, xside) || SqAtakd (kt, xside) || SqAtakd (rt, xside)) return (false); } else { if (iop == 1) { castld[side] = true; Mvboard[kf]++; Mvboard[rf]++; } else { castld[side] = false; Mvboard[kf]--; Mvboard[rf]--; t0 = kt; kt = kf; kf = t0; t0 = rt; rt = rf; rf = t0; } board[kt] = king; color[rt] = color[kt] = side; Pindex[kt] = 0; board[kf] = no_piece; color[rf] = color[kf] = neutral; board[rt] = rook; Pindex[rt] = Pindex[rf]; board[rf] = no_piece; PieceList[side][Pindex[kt]] = kt; PieceList[side][Pindex[rt]] = rt; UpdateHashbd (side, king, kf, kt); UpdateHashbd (side, rook, rf, rt); } return (true); } void EnPassant (SHORT xside, SHORT f, SHORT t, SHORT iop) /* * Make or unmake an en passant move. */ { register SHORT l; l = t + ((t > f) ? -8 : 8); if (iop == 1) { board[l] = no_piece; color[l] = neutral; } else { board[l] = pawn; color[l] = xside; } InitializeStats (); } void UpdatePieceList (SHORT side, SHORT sq, SHORT iop,short piece) /* * Update the PieceList and Pindex arrays when a piece is captured or when a * capture is unmade. */ { register SHORT i; if( iop == 1 ) { i = Pindex[ sq ]; if( i < PieceCnt[ side ] ) { PieceList[ side ][ i ] = PieceList[ side ][ PieceCnt[ side ] ]; Pindex[ PieceList[ side ][ i ] ] = i; } PieceCnt[ side ]--; } else { if(piece != king){ PieceCnt[side]++; PieceList[side][PieceCnt[side]] = sq; Pindex[sq] = PieceCnt[side]; } else { PieceCnt[side]++; for (i = PieceCnt[side]; i > 0; i--) { PieceList[side][i] = PieceList[side][i - 1]; Pindex[PieceList[side][i]] = i; } PieceList[side][0] = sq; Pindex[sq] = 0; } } } void MakeMove (SHORT side, struct leaf *node, SHORT *tempb, /* color of to square */ SHORT *tempc, /* piece at to square */ SHORT *tempsf, /* static value of piece on from */ SHORT *tempst, /* static value of piece on to */ SHORT *INCscore) /* score increment for pawn structure change */ /* * Update Arrays board[], color[], and Pindex[] to reflect the new board * position obtained after making the move pointed to by node. Also update * miscellaneous stuff that changes when a move is made. */ { register SHORT f, t, xside, ct, cf; register struct GameRec *g; xside = side ^ 1; g = &GameList[++GameCnt]; g->hashkey = hashkey; g->hashbd = hashbd; g->epssq = epsquare; f = node->f; t = node->t; epsquare = -1; /* FROMsquare = f;*/ TOsquare = t; *INCscore = 0; g->Game50 = Game50; g->gmove = (f << 8) | t; g->flags = node->flags; if (node->flags & cstlmask) { g->piece = no_piece; g->color = side; (void) castle (side, f, t, 1); Game50 = GameCnt; } else { if (!(node->flags & capture) && (board[f] != pawn)) { IncrementRPThash(side,hashkey); } else Game50 = GameCnt; *tempsf = svalue[f]; *tempst = svalue[t]; g->piece = *tempb = board[t]; g->color = *tempc = color[t]; if (*tempc != neutral) { UpdatePieceList (*tempc, t, 1,*tempb); /* if capture decrement pawn count */ if (*tempb == pawn) { --PawnCnt[*tempc][column (t)]; } if (board[f] == pawn) { cf = column (f); ct = column (t); /* move count from from to to */ --PawnCnt[side][cf]; ++PawnCnt[side][ct]; /* * calculate increment for pawn structure * changes */ /* doubled or more - */ if (PawnCnt[side][ct] > (1 + PawnCnt[side][cf])) *INCscore -= 15; /* went to empty column + */ else if (PawnCnt[side][ct] < 1 + PawnCnt[side][cf]) *INCscore += 15; /* * went to outside col or empty col on one * side ???????? */ else if (ct == 0 || ct == 7 || PawnCnt[side][ct + ct - cf] == 0) *INCscore -= 15; } mtl[xside] -= value[*tempb]; if (*tempb == pawn) pmtl[xside] -= valueP; UpdateHashbd (xside, *tempb, -1, t); *INCscore += *tempst; Mvboard[t]++; } color[t] = color[f]; board[t] = board[f]; svalue[t] = svalue[f]; Pindex[t] = Pindex[f]; PieceList[side][Pindex[t]] = t; color[f] = neutral; board[f] = no_piece; if (board[t] == pawn) if (t - f == 16) epsquare = f + 8; else if (f - t == 16) epsquare = f - 8; if (node->flags & promote) { board[t] = node->flags & pmask; if (board[t] == queen) HasQueen[side]++; else if (board[t] == rook) HasRook[side]++; else if (board[t] == bishop) HasBishop[side]++; else if (board[t] == knight) HasKnight[side]++; --PawnCnt[side][column (t)]; mtl[side] += value[board[t]] - valueP; pmtl[side] -= valueP; UpdateHashbd (side, pawn, f, -1); UpdateHashbd (side, board[t], f, -1); *INCscore -= *tempsf; } if (node->flags & epmask) EnPassant (xside, f, t, 1); else UpdateHashbd (side, board[t], f, t); Mvboard[f]++; } } void UnmakeMove (SHORT side, struct leaf *node, SHORT *tempb, /* -> piece */ SHORT *tempc, /* -> side */ SHORT *tempsf, SHORT *tempst) /* * Take back a move. */ { register SHORT f, t, xside; xside = side ^ 1; f = node->f; t = node->t; Game50 = GameList[GameCnt].Game50; if (node->flags & cstlmask) (void) castle (side, f, t, 2); else { color[f] = color[t]; board[f] = board[t]; svalue[f] = *tempsf; Pindex[f] = Pindex[t]; PieceList[side][Pindex[f]] = f; color[t] = *tempc; board[t] = *tempb; svalue[t] = *tempst; if (node->flags & promote) { board[f] = pawn; ++PawnCnt[side][column (t)]; mtl[side] += valueP - value[node->flags & pmask]; pmtl[side] += valueP; UpdateHashbd (side, (SHORT) node->flags & pmask, -1, t); UpdateHashbd (side, pawn, -1, t); } if (*tempc != neutral) { UpdatePieceList (*tempc, t, 2,*tempb); if (*tempb == pawn) { ++PawnCnt[*tempc][column (t)]; } if (board[f] == pawn) { --PawnCnt[side][column (t)]; ++PawnCnt[side][column (f)]; } mtl[xside] += value[*tempb]; if (*tempb == pawn) pmtl[xside] += valueP; UpdateHashbd (xside, *tempb, -1, t); Mvboard[t]--; } if (node->flags & epmask) { EnPassant (xside, f, t, 2); } else UpdateHashbd (side, board[f], f, t); Mvboard[f]--; if (!(node->flags & capture) && (board[f] != pawn)) { DecrementRPThash(side,hashkey); } } epsquare = GameList[GameCnt--].epssq; } void InitializeStats (void) /* * Scan thru the board seeing what's on each square. If a piece is found, * update the variables PieceCnt, PawnCnt, Pindex and PieceList. Also * determine the material for each side and set the hashkey and hashbd * variables to represent the current board position. Array * PieceList[side][indx] contains the location of all the pieces of either * side. Array Pindex[sq] contains the indx into PieceList for a given * square. */ { register SHORT i, sq; epsquare = -1; for (i = 0; i < 8; i++) { PawnCnt[white][i] = PawnCnt[black][i] = 0; } mtl[white] = mtl[black] = pmtl[white] = pmtl[black] = 0; PieceCnt[white] = PieceCnt[black] = 0; hashbd = hashkey = 0; for (sq = 0; sq < 64; sq++) if (color[sq] != neutral) { mtl[color[sq]] += value[board[sq]]; if (board[sq] == pawn) { pmtl[color[sq]] += valueP; ++PawnCnt[color[sq]][column (sq)]; } Pindex[sq] = ((board[sq] == king) ? 0 : ++PieceCnt[color[sq]]); PieceList[color[sq]][Pindex[sq]] = sq; UpdateHashbd(color[sq], board[sq], -1, sq); } } gnuchess-4.0.pl70/src/ttable.c100444 21542 13 43357 5563700647 15247 0ustar cracraftuser/* ttable.c -- Transposition table code to be included in search.c */ /* #include "gnuchess.h" /* already included, see search.c */ /* #include "ttable.h" /* dito */ /* NOTE: The static evaluation cache "EETable" belongs to eval.c and cannot*/ /* be moved to ttable.c */ /* Privae types and data */ struct hashentry { unsigned long hashbd; UCHAR flags, depth; /* CHAR saves some space */ tshort score; utshort mv; #ifdef HASHTEST UCHAR bd[32]; #endif /* HASHTEST */ #ifdef NEWAGE utshort age; /* age of last use */ #endif }; struct hashentry *ttable[2]; unsigned long ttblsize; /* unsigned */ SHORT rehash; /* -1 is used as a flag --tpm */ #ifdef NEWAGE utshort TTage; /* Current ttable age */ UTSHORT TTageClock, /* Count till next age tick */ TTageRate; /* new entry counts per age tick */ UTSHORT TTdepthage[MAXDEPTH+1]; /* Depth bonus for aging*/ UTSHORT newage = NEWAGE; /* Initialization tuning parameter */ #else unsigned int ttbllimit; unsigned int TTadd = 1; #endif #ifdef HASHSTATS unsigned long ttdepthin[MAXDEPTH+1], ttdepthout[MAXDEPTH+1]; unsigned long ttrehash[MAXrehash+1]; unsigned long ttprobe[MAXDEPTH+1]; unsigned long HashCnt, HashAdd, FHashCnt, FHashAdd, HashCol, THashCol; #endif /* hashtable flags */ #define truescore 0x0001 #define lowerbound 0x0002 #define upperbound 0x0004 #define kingcastle 0x0008 #define queencastle 0x0010 #define evalflag 0x0020 void Initialize_ttable () { int doit = true; if (rehash < 0) rehash = MAXrehash; while(doit && ttblsize > MINTTABLE){ ttable[0] = (struct hashentry *)malloc(sizeof(struct hashentry)*(ttblsize+rehash)); ttable[1] = (struct hashentry *)malloc(sizeof(struct hashentry)*(ttblsize+rehash)); if(ttable[0] == NULL || ttable[1] == NULL){ if(ttable[0] != NULL)free(ttable[0]); ttblsize = ttblsize>>1; } else doit = false; } if(ttable[0] == NULL || ttable[1] == NULL){ perror("can't alloc ttable");exit(1);} else { int j; #ifdef notdef printf("transposition table is %ld\n",ttblsize); #endif #ifdef NEWAGE TTageRate = ttblsize / 1024; TTdepthage[0] = TTdepthage[1] = newage; for (j=2; j<=MAXDEPTH; j++) TTdepthage[j] = TTdepthage[j-1]/2; /* ZeroTTable(0); -- called in NewGame() */ #else ttbllimit = ttblsize<<1 - ttblsize>>2; #endif } } #define CB(i) (UCHAR) ((color[2 * (i)] ? 0x80 : 0)\ | (board[2 * (i)] << 4)\ | (color[2 * (i) + 1] ? 0x8 : 0)\ | (board[2 * (i) + 1])) inline int ProbeTTable (SHORT side, SHORT depth, SHORT ply, SHORT *alpha, SHORT *beta, SHORT *score) /* * Look for the current board position in the transposition table. */ { register struct hashentry *ptbl; register /*unsigned*/ SHORT i = 0; /*to match new type of rehash --tpm*/ #ifdef HASHSTATS ttprobe[depth]++; #endif ptbl = &ttable[side][hashkey % ttblsize]; while (true) { if (ptbl->depth == 0) return false; if (ptbl->hashbd == hashbd) break; if (++i > rehash) return false; ptbl++; } PV = SwagHt = ptbl->mv; if ((ptbl->depth >= (SHORT) depth)) { #ifdef HASHTEST for (i = 0; i < 32; i++) { if (ptbl->bd[i] != CB (i)) { #ifdef HASHSTATS HashCol++; ShowMessage (CP[199]); /*ttable collision detected*/ #endif break; } } #endif /* HASHTEST */ #ifdef HASHSTATS ttdepthout[ptbl->depth]++; HashCnt++; #endif #ifdef NEWAGE /* Find entry within rehash window or return failure */ for (i=rehash, ptbl = &ttable[side][hashkey % ttblsize]; ptbl->hashbd != hashbd; ptbl++) if (--i == 0) return false; /* Update age of rediscovered node */ ptbl->age = TTage - TTdepthage[ptbl->depth]; #endif if (ptbl->flags & truescore) { *score = ptbl->score; /* adjust *score so moves to mate is from root */ if (*score > 9000) *score -= ply; else if (*score < -9000) *score += ply; *beta = -20000; } else if (ptbl->flags & lowerbound) { if (ptbl->score > *alpha) #ifdef notdef *alpha = ptbl->score - 1; #endif *alpha = ptbl->score; } return (true); } return (false); } inline int PutInTTable (SHORT side, SHORT score, SHORT depth, SHORT ply, SHORT alpha, SHORT beta, UTSHORT mv) /* * Store the current board position in the transposition table. */ { register struct hashentry *ptbl; register /*unsigned*/ SHORT i = 0; /*to match new type of rehash --tpm*/ ptbl = &ttable[side][hashkey % ttblsize]; while (true) { if (ptbl->depth == 0 #ifdef NEWAGE || TTage - ptbl->age > newage #endif ) break; if((ptbl->hashbd) == hashbd)if(ptbl->depth > (UCHAR)depth)return false; else break; if (++i > rehash) { #ifdef HASHSTATS THashCol++; #endif ptbl -= rehash; /* Hey! it's already randomized. use the original location. */ /* There is some discussion about thrashing.... */ break; } ptbl++; } #ifdef NEWAGE { /* Look for match or oldest entry to reuse */ int i; SHORT old = 0; struct hashentry * oldest = (struct hashentry *)NULL; for (i=rehash, ptbl = &ttable[side][hashkey % ttblsize]; i > 0 && ptbl->hashbd != hashbd; i--, ptbl++) if ((TTage - ptbl->age) > old) { old = TTage - ptbl->age; oldest = ptbl; } if (i == 0) { ptbl = oldest; /* reuse oldest entry */ if (--TTageClock == 0) { TTageClock = TTageRate; TTage++; /* Everyone is now just a little older */ } } ptbl->age = TTage - TTdepthage[ptbl->depth]; /* Set age of this node */ } #else TTadd++; #endif #ifdef HASHSTATS HashAdd++; #endif if(ptbl->depth > (UCHAR)depth) return false; /* adjust score so moves to mate is from this ply */ if (score > 9000) score += ply; else if (score < -9000) score -= ply; ptbl->hashbd = hashbd; ptbl->depth = (UCHAR) depth; ptbl->score = score; ptbl->mv = mv; #ifdef DEBUG if (debuglevel & 32) { algbr (mv >> 8, mv & 0xff, 0); printf ("-add-> h=%lx d=%d s=%d p=%d a=%d b=%d %s\n", hashbd, depth, score, ply, alpha, beta, mvstr); } #endif if (score > beta) { ptbl->flags = lowerbound; ptbl->score = beta + 1; } else ptbl->flags = truescore; #ifdef HASHSTATS ttdepthin[ptbl->depth]++; ttrehash[i]++; #endif #ifdef HASHTEST for (i = 0; i < 32; i++) { ptbl->bd[i] = CB (i); } #endif /* HASHTEST */ return true; } void ZeroTTable (int iop) /* iop: 0= clear any, 1= clear agged */ { #ifdef NEWAGE if(iop==0) { TTageClock = TTageRate; TTage = newage+1; /* Zero entries are pre-expired. */ TTageRate = ttblsize/(newage/2); /* Average 1/2 of table will be expired */ /* zero the age of all ttable entries */ memset(ttable[white],0,sizeof(struct hashentry)*(unsigned)(ttblsize+rehash)); memset(ttable[black],0,sizeof(struct hashentry)*(unsigned)(ttblsize+rehash)); } else /* Just add a major increment to TTage */ TTage += newage/5; /* Just a guess */ #else /* not NEWAGE */ if ((iop==0 && TTadd) || TTadd > ttbllimit) { memset(ttable[white],0,sizeof(struct hashentry)*(unsigned)(ttblsize+rehash)); memset(ttable[black],0,sizeof(struct hashentry)*(unsigned)(ttblsize+rehash)); TTadd = 0; } #endif /* NEWAGE */ } /************************* Hash table statistics ****************************/ #ifdef HASHSTATS long EADD,EGET; /* Eval cache stats */ void ClearHashStats() /* initialize the stats */ { memset ((CHAR *) ttdepthin, 0, sizeof (ttdepthin)); memset ((CHAR *) ttdepthout, 0, sizeof (ttdepthout)); memset ((CHAR *) ttrehash, 0, sizeof (ttrehash)); memset ((CHAR *) ttprobe, 0, sizeof (ttprobe)); HashAdd = HashCnt = THashCol = HashCol = FHashCnt = FHashAdd = 0; EADD = EGET = 0; } void ShowHashStats() /* print the stats */ { int ii; printf("Probe: "); for(ii=0;ii MAXDEPTH){printf("ERROR\n");exit(1);} if (n.depth) { nr[n.depth]++; nr[0]++; } } printf (CP[109], nr[0], HFileSize); for (i = 1; i <= MAXDEPTH; i++) if (nr[i]) printf (" %d:%ld", i,nr[i]); printf ("\n"); if (iopendit) CloseHashFile(); } } int Fbdcmp(UCHAR *a,UCHAR *b) { register int i; for(i = 0;i<32;i++) if(a[i] != b[i]) return false; return true; } int ProbeFTable (SHORT side, SHORT depth, SHORT ply, SHORT *alpha, SHORT *beta, SHORT *score) /* * Look for the current board position in the persistent transposition table. */ { register SHORT i; register unsigned long hashix; struct fileentry new, t; hashix = ((side == white) ? (hashkey & 0xFFFFFFFE) : (hashkey | 1)) % HFileSize; for (i = 0; i < 32; i++) new.bd[i] = CB (i); new.flags = 0; if (Mvboard[kingP[side]] == 0) { if (Mvboard[qrook[side]] == 0) new.flags |= queencastle; if (Mvboard[krook[side]] == 0) new.flags |= kingcastle; } for (i = 0; i < frehash; i++) { fseek (hashfile, sizeof (struct fileentry) * ((hashix + 2 * i) % (HFileSize)), SEEK_SET); fread (&t, sizeof (struct fileentry), 1, hashfile); if (!t.depth) break; if(!Fbdcmp(t.bd, new.bd)) continue; if (((SHORT) t.depth >= depth) && (new.flags == (UTSHORT)(t.flags & (kingcastle | queencastle)))) { #ifdef HASHSTATS FHashCnt++; #endif PV = (t.f << 8) | t.t; *score = (t.sh << 8) | t.sl; /* adjust *score so moves to mate is from root */ if (*score > 9000) *score -= ply; else if (*score < -9000) *score += ply; if (t.flags & truescore) { *beta = -20000; } else if (t.flags & lowerbound) { if (*score > *alpha) *alpha = *score - 1; } else if (t.flags & upperbound) { if (*score < *beta) *beta = *score + 1; } return (true); } } return (false); } void PutInFTable (SHORT side, SHORT score, SHORT depth, SHORT ply, SHORT alpha, SHORT beta, UTSHORT f, UTSHORT t) /* * Store the current board position in the persistent transposition table. */ { register UTSHORT i; register unsigned long hashix; struct fileentry new, tmp; hashix = ((side == white) ? (hashkey & 0xFFFFFFFE) : (hashkey | 1)) % HFileSize; for (i = 0; i < 32; i++) new.bd[i] = CB (i); new.f = (UCHAR) f; new.t = (UCHAR) t; if (score < alpha) new.flags = upperbound; else new.flags = ((score > beta) ? lowerbound : truescore); if (Mvboard[kingP[side]] == 0) { if (Mvboard[qrook[side]] == 0) new.flags |= queencastle; if (Mvboard[krook[side]] == 0) new.flags |= kingcastle; } new.depth = (UCHAR) depth; /* adjust *score so moves to mate is from root */ if (score > 9000) score += ply; else if (score < -9000) score -= ply; new.sh = (UCHAR) (score >> 8); new.sl = (UCHAR) (score & 0xFF); for (i = 0; i < frehash; i++) { fseek (hashfile, sizeof (struct fileentry) * ((hashix + 2 * i) % (HFileSize)), SEEK_SET); if(fread (&tmp, sizeof (struct fileentry), 1, hashfile) == 0){perror("hashfile");exit(1);} if (tmp.depth && !Fbdcmp(tmp.bd,new.bd))continue; if ((SHORT) tmp.depth < new.depth) { fseek (hashfile, sizeof (struct fileentry) * ((hashix + 2 * i) % (HFileSize)), SEEK_SET); fwrite (&new, sizeof (struct fileentry), 1, hashfile); #ifdef HASHSTATS FHashAdd++; #endif } break; } } #endif /* HASHFILE */ /********************** Repitition cache ***********************/ SHORT rpthash[2][256]; SHORT ISZERO = 1; void ZeroRPT (void) { if(ISZERO){memset ((CHAR *) rpthash, 0, sizeof (rpthash));ISZERO=0;} } /********************** Hash code stuff ***********************/ /* * In a networked enviroment gnuchess might be compiled on different hosts * with different random number generators, that is not acceptable if they * are going to share the same transposition table. */ unsigned long int next = 1; #if defined NEWURAND /* This code copied from: G. Wiesenekker. ZZZZZZ a chess program. Copyright (C) 1993 G. Wiesenekker E-mail: wiesenecker@sara.nl A 32 bit random number generator. An implementation in C of the algorithm given by Knuth, the art of computer programming, vol. 2, pp. 26-27. We use e=32, so we have to evaluate y(n) = y(n - 24) + y(n - 55) mod 2^32, which is implicitly done by unsigned arithmetic. */ unsigned int urand(void) { /* random numbers from Mathematica 2.0. SeedRandom = 1; Table[Random[Integer, {0, 2^32 - 1}] */ static unsigned long x[55] = { 1410651636UL, 3012776752UL, 3497475623UL, 2892145026UL, 1571949714UL, 3253082284UL, 3489895018UL, 387949491UL, 2597396737UL, 1981903553UL, 3160251843UL, 129444464UL, 1851443344UL, 4156445905UL, 224604922UL, 1455067070UL, 3953493484UL, 1460937157UL, 2528362617UL, 317430674UL, 3229354360UL, 117491133UL, 832845075UL, 1961600170UL, 1321557429UL, 747750121UL, 545747446UL, 810476036UL, 503334515UL, 4088144633UL, 2824216555UL, 3738252341UL, 3493754131UL, 3672533954UL, 29494241UL, 1180928407UL, 4213624418UL, 33062851UL, 3221315737UL, 1145213552UL, 2957984897UL, 4078668503UL, 2262661702UL, 65478801UL, 2527208841UL, 1960622036UL, 315685891UL, 1196037864UL, 804614524UL, 1421733266UL, 2017105031UL, 3882325900UL, 810735053UL, 384606609UL, 2393861397UL }; static int init = TRUE; static unsigned long y[55]; static int j, k; unsigned long ul; if (init) { int i; init = FALSE; for (i = 0; i < 55; i++) y[i] = x[i]; j = 24 - 1; k = 55 - 1; } ul = (y[k] += y[j]); if (--j < 0) j = 55 - 1; if (--k < 0) k = 55 - 1; return((unsigned int)ul); } #else unsigned int urand (void) { next *= 1103515245; next += 12345; return ((unsigned int) (next >> 16) & 0xFFFF); } #endif void gsrand (unsigned int seed) { next = seed; } unsigned long hashkey, hashbd; struct hashval hashcode[2][7][64]; #if !defined NOXRAND unsigned int xrand (int a, unsigned int b[]) { unsigned int i, r, loop; unsigned int j, c; unsigned int msk; if (!a) { for (i = 0; i < 4000; i++) b[i] = 0; return 0; } loop = true; while (loop) { r = urand (); msk = 1; c = 0; for (j = 0; j < 16; j++) { if (r & msk) c++; msk = msk << 1; } if (c < 8) continue; loop = false; for (i = 0; i < a; i++) if (r == b[i]) { loop = true; break; } if (!loop) { b[a] = r; return r; } } return 0; } #else #define xrand(a,b) urand() #endif void InitHashCode(unsigned int seed) { SHORT l, c, p; unsigned int t[4000]; int cnt = 0; xrand(cnt++,t); gsrand (seed); /* idealy we would preserve the old seed but... */ for (c = white; c <= black; c++) for (p = pawn; p <= king; p++) for (l = 0; l < 64; l++) { hashcode[c][p][l].key = (((unsigned long) xrand (cnt++,t))); hashcode[c][p][l].key += (((unsigned long) xrand (cnt++,t)) << 16); hashcode[c][p][l].bd = (((unsigned long) xrand (cnt++,t))); hashcode[c][p][l].bd += (((unsigned long) xrand (cnt++,t)) << 16); #ifdef LONG64 hashcode[c][p][l].key += (((unsigned long) xrand (cnt++,t)) << 32); hashcode[c][p][l].key += (((unsigned long) xrand (cnt++,t)) << 48); hashcode[c][p][l].bd += (((unsigned long) xrand (cnt++,t)) << 32); hashcode[c][p][l].bd += (((unsigned long) xrand (cnt++,t)) << 48); #endif } } gnuchess-4.0.pl70/src/ttable.h100444 21542 13 10201 5567302421 15222 0ustar cracraftuser/************************* Tuning parameters ****************************/ /* * ttblsz can be a any size. Setting ttblsz 0 removes the transposition * tables. */ #ifdef MSDOS #define ttblsz 8001 #else #define ttblsz 150001 #endif /* MSDOS */ #define MINTTABLE (8000) /* min ttable size -1 */ #define MAXrehash (7) #if defined MORESTATS #if !defined HASHSTATS #define HASHSTATS /* Enable hash statistics */ #endif #endif #if defined AGING #define NEWAGE (8) #endif #ifdef BAREBONES /* Remove all stats for RAW speed */ #undef HASHSTATS #endif /* BAREBONES */ /************************* Hash table stuf ****************************/ extern /*unsigned*/ SHORT rehash; /* main.c */ /* -1 is used as a flag --tpm */ extern unsigned long ttblsize; /* main.c */ extern UTSHORT newage; #if ttblsz extern void Initialize_ttable (void); extern void ZeroTTable (int iop); /* iop: 0= clear any, 1= clear agged */ extern int ProbeTTable (SHORT side, SHORT depth, SHORT ply, SHORT *alpha, SHORT *beta, SHORT *score); extern int PutInTTable (SHORT side, SHORT score, SHORT depth, SHORT ply, SHORT alpha, SHORT beta, UTSHORT mv); #else #define Initialize_ttable(void) #define ZeroTTable(iop) #define ProbeTTable(side,depth,ply,alpha,beta,score) (false) #define PutInTTable(side,score,depth,ply,alpha,beta,mv) (false) #endif /* ttblsz */ /************************* Hash File Stuf ****************************/ #ifdef HASHFILE extern FILE *hashfile; /* search.c: test if hashfile is opened */ extern int ProbeFTable (SHORT side, SHORT depth, SHORT ply, SHORT *alpha, SHORT *beta, SHORT *score); extern void PutInFTable (SHORT side, SHORT score, SHORT depth, SHORT ply, SHORT alpha, SHORT beta, UTSHORT f, UTSHORT t); extern void TestHashFile(); extern void CreateHashFile(long sz); extern void OpenHashFile(); extern void CloseHashFile(); #else /* Define null ops so we dont need ifdefs */ #define hashfile (NULL) #define OpenHashFile() #define CloseHashFile() #define ProbeFTable(side,depth,ply,alpha,beta,score) (0) #define PutInFTable(side,score,depth,ply,alpha,beta,f,t) #endif /* HASHFILE */ /************************hash code stuff **************************/ struct hashval { unsigned long key, bd; }; extern struct hashval hashcode[2][7][64]; extern void InitHashCode(unsigned int seed); /* * hashbd contains a 32 bit "signature" of the board position. hashkey * contains a 16 bit code used to address the hash table. When a move is * made, XOR'ing the hashcode of moved piece on the from and to squares with * the hashbd and hashkey values keeps things current. */ extern unsigned long hashkey, hashbd; #define UpdateHashbd(side, piece, f, t) \ {\ if ((f) >= 0)\ {\ hashbd ^= hashcode[side][piece][f].bd;\ hashkey ^= hashcode[side][piece][f].key;\ }\ if ((t) >= 0)\ {\ hashbd ^= hashcode[side][piece][t].bd;\ hashkey ^= hashcode[side][piece][t].key;\ }\ } extern void gsrand (unsigned int); extern unsigned int urand (void); /************************* Repitition hash table ****************************/ extern SHORT ISZERO; extern SHORT rpthash[2][256]; extern void ZeroRPT (void); #define ProbeRPThash(side,hashkey) (rpthash[side][hashkey & 0xFF] > 0) #define IncrementRPThash(side,hashkey) {rpthash[side][hashkey & 0xFF]++;ISZERO++;} #define DecrementRPThash(side,hashkey) {rpthash[side][hashkey & 0xFF]--;ISZERO--;} /************************* Evaluation cache ********************************/ #ifdef CACHE struct etable { unsigned long ehashbd; tshort escore[2]; tshort sscore[64]; tshort score; tshort hung[2]; } ; extern struct etable *etab[2]; extern UTSHORT ETABLE; #endif /************************* Hash table statistice ****************************/ #ifdef HASHSTATS void ClearHashStats(); /* initialize the stats */ void ShowHashStats(); /* print the stats */ extern long EADD, EGET; /* Evaluation cache stats counters */ extern unsigned long HashCnt, HashAdd, FHashCnt, FHashAdd, HashCol, THashCol; #else #define ClearHashStats() /* stats calls ignored */ #define ShowHashStats() #endif gnuchess-4.0.pl70/src/util.c100444 21542 13 3774 5563700647 14730 0ustar cracraftuser/* * util.c - C source for GNU CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "gnuchess.h" int parse (FILE * fd, UTSHORT *mv, SHORT side, CHAR *opening) { register int c, i, r1, r2, c1, c2; CHAR s[128]; CHAR *p; while ((c = getc (fd)) == ' ' || c == '\n') ; i = 0; s[0] = (CHAR) c; if (c == '!') { p = opening; do { *p++ = c; c = getc (fd); if (c == '\n' || c == EOF) { *p = '\0'; return 0; } } while (true); } while (c != '?' && c != ' ' && c != '\t' && c != '\n' && c != EOF) s[++i] = (CHAR) (c = getc (fd)); s[++i] = '\0'; if (c == EOF) return (-1); if (s[0] == '!' || s[0] == ';' || i < 3) { while (c != '\n' && c != EOF) c = getc (fd); return (0); } if (s[4] == 'o') *mv = ((side == black) ? LONGBLACKCASTLE : LONGWHITECASTLE); else if (s[0] == 'o') *mv = ((side == black) ? BLACKCASTLE : WHITECASTLE); else { c1 = s[0] - 'a'; r1 = s[1] - '1'; c2 = s[2] - 'a'; r2 = s[3] - '1'; *mv = (locn (r1, c1) << 8) | locn (r2, c2); } if (c == '?') { /* Bad move, not for the program to play */ *mv |= 0x8000; /* Flag it ! */ c = getc (fd); } return (1); } gnuchess-4.0.pl70/src/uxdsp.c100444 21542 13 44516 5563700650 15127 0ustar cracraftuser/* * uxdsp.c - ALPHA interface for CHESS * * Copyright (c) 1988,1989,1990 John Stanback * Copyright (c) 1992 Free Software Foundation * * This file is part of GNU CHESS. * * GNU Chess is free software; you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by * the Free Software Foundation; either version 2, or (at your option) * any later version. * * GNU Chess is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with GNU Chess; see the file COPYING. If not, write to * the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #ifdef MSDOS #include /*#include */ #include #include #include #define ESC 0x1B #define refresh() fflush(stdout) static void param (SHORT n); #else #include #include #include #include #ifdef notdef #if defined(__STDC__) /* */ extern void *malloc (size_t); extern void exit (int); /* */ extern CHAR *strcat (CHAR *, const CHAR *); extern int strcmp (const CHAR *, const CHAR *); extern CHAR *strcpy (CHAR *, const CHAR *); /* */ extern long int time (long int *); #endif #endif #endif /* MSDOS */ int mycnt1, mycnt2; #include "gnuchess.h" extern SHORT pscore[2]; #define TAB (46) #define VIR_C(s) ((flag.reverse) ? 7-column(s) : column(s)) #define VIR_R(s) ((flag.reverse) ? 7-row(s) : row(s)) UTSHORT MV[MAXDEPTH]; int MSCORE; CHAR *DRAW; void TerminateSearch (int), Die (int); void Initialize (void) { signal (SIGINT, Die); #ifndef MSDOS signal (SIGQUIT, Die); initscr (); crmode (); #else mycnt1 = mycnt2 = 0; #endif /* MSDOS */ } void ExitChess (void) { ListGame (); gotoXY (1, 24); #ifndef MSDOS refresh(); nocrmode (); endwin (); #endif /* MSDOS */ exit (0); } void Die (int Sig) { CHAR s[80]; signal (SIGINT, SIG_IGN); #ifdef MSDOS Sig++; /* shut up the compiler */ #else signal (SIGQUIT, SIG_IGN); #endif /* MSDOS */ ShowMessage (CP[31]); /*Abort?*/ scanz ("%s", s); if (strcmp (s, CP[210]) == 0) /*yes*/ ExitChess (); signal (SIGINT, Die); #ifndef MSDOS signal (SIGQUIT, Die); #endif /* MSDOS */ } void TerminateSearch (int Sig) { signal (SIGINT, SIG_IGN); #ifdef MSDOS Sig++; /* shut up the compiler */ #else signal (SIGQUIT, SIG_IGN); #endif /* MSDOS */ if (!flag.timeout) flag.musttimeout = true; flag.bothsides = false; signal (SIGINT, Die); #ifndef MSDOS signal (SIGQUIT, Die); #endif /* MSDOS */ } void ShowLine (UTSHORT *bstline) { } void help (void) { ClrScreen (); /*printz ("CHESS command summary\n");*/ printz (CP[40]); printz ("----------------------------------------------------------------\n"); /*printz ("g1f3 move from g1 to f3 quit Exit Chess\n");*/ printz (CP[158]); /*printz ("Nf3 move knight to f3 cache turn %s\n", (flag.cache) ? "off" : "on");*/ printz (CP[86], (flag.cache) ? CP[92] : CP[93]); /*printz ("a7a8q promote pawn to queen\n");*/ printz (CP[128], (flag.material) ? CP[92] : CP[93]); /*printz ("o-o castle king side easy turn %s\n", (flag.easy) ? "off" : "on");*/ printz (CP[173], (flag.easy) ? CP[92] : CP[93]); /*printz ("o-o-o castle queen side hash turn %s\n", (flag.hash) ? "off" : "on");*/ printz (CP[174], (flag.hash) ? CP[92] : CP[93]); /*printz ("bd redraw board reverse board display\n");*/ printz (CP[130]); /*printz ("list game to chess.lst book turn %s used %d of %d\n", (Book) ? "off" : "on", book count, booksize);*/ printz (CP[170], (Book) ? CP[92] : CP[93], bookcount, BOOKSIZE); /*printz ("undo undo last ply remove take back a move\n");*/ printz (CP[200]); /*printz ("edit edit board force enter game moves\n");*/ printz (CP[153]); /*printz ("switch sides with computer both computer match\n");*/ printz (CP[194]); /*printz ("white computer plays white black computer plays black\n");*/ printz (CP[202]); /*printz ("depth set search depth clock set time control\n");*/ printz (CP[149]); /*printz ("hint suggest a move post turn %s principle variation\n", (flag.post) ? "off" : "on");*/ printz (CP[177], (flag.post) ? CP[92] : CP[93]); /*printz ("save game to file get game from file\n");*/ printz (CP[188]); /*printz ("random randomize play new start new game\n");*/ printz (CP[181]); gotoXY (10, 20); printz (CP[47], ColorStr[computer]); gotoXY (10, 21); printz (CP[97], ColorStr[opponent]); gotoXY (10, 22); printz (CP[79], MaxResponseTime/100); gotoXY (10, 23); printz (CP[59], (flag.easy) ? CP[93] : CP[92]); gotoXY (40, 20); printz (CP[52], MaxSearchDepth); gotoXY (40, 21); printz (CP[100], (dither) ? CP[93] : CP[92]); gotoXY (40, 22); printz (CP[112], (flag.hash) ? CP[93] : CP[92]); gotoXY (40, 23); printz (CP[73]); gotoXY (10, 24); if(flag.gamein) printz (CP[230], (TCflag) ? CP[93] : CP[92], TimeControl.clock[white] / 100, TCadd/100, MaxSearchDepth); else printz (CP[110], (TCflag) ? CP[93] : CP[92], TimeControl.moves[white], TimeControl.clock[white] / 100, TCadd/100, MaxSearchDepth); refresh (); #ifdef BOGUS fflush (stdin); /*what is this supposed to do??*/ #endif /*BOGUS*/ getchar (); ClrScreen (); UpdateDisplay (0, 0, 1, 0); } void EditBoard (void) /* * Set up a board position. Pieces are entered by typing the piece followed * by the location. For example, Nf3 will place a knight on square f3. */ { SHORT a, r, c, sq, i; CHAR s[80]; flag.regularstart = true; Book = BOOKFAIL; ClrScreen (); UpdateDisplay (0, 0, 1, 0); gotoXY (TAB, 3); printz (CP[29]); gotoXY (TAB, 4); printz (CP[28]); gotoXY (TAB, 5); printz (CP[136]); gotoXY (TAB, 7); printz (CP[64]); a = white; do { gotoXY (TAB, 6); printz (CP[60], ColorStr[a]); /*Editing %s*/ gotoXY (TAB + 24, 7); ClrEoln (); scanz ("%s", s); if (s[0] == CP[28][0]) /*#*/ { for (sq = 0; sq < 64; sq++) { board[sq] = no_piece; color[sq] = neutral; DrawPiece (sq); } } if (s[0] == CP[136][0]) /*c*/ a = otherside[a]; c = s[1] - 'a'; r = s[2] - '1'; if ((c >= 0) && (c < 8) && (r >= 0) && (r < 8)) { sq = locn (r, c); for (i = king; i > no_piece; i--) if ((s[0] == pxx[i]) || (s[0] == qxx[i])) break; board[sq] = i; color[sq] = ((board[sq] == no_piece) ? neutral : a); DrawPiece (sq); } } while (s[0] != CP[29][0]); /*.*/ for (sq = 0; sq < 64; sq++) Mvboard[sq] = ((board[sq] != Stboard[sq]) ? 10 : 0); GameCnt = 0; Game50 = 1; ZeroRPT (); Sdepth = 0; InitializeStats (); ClrScreen (); UpdateDisplay (0, 0, 1, 0); } void ShowPlayers (void) { gotoXY (5, ((flag.reverse) ? 23 : 2)); printz ("%s", (computer == black) ? CP[218] : CP[74]); gotoXY (5, ((flag.reverse) ? 2 : 23)); printz ("%s", (computer == white) ? CP[218] : CP[74]); } void ShowDepth (CHAR ch) { gotoXY (TAB, 4); printz (CP[53], Sdepth, ch); /*Depth= %d%c*/ ClrEoln (); } void ShowScore (SHORT score) { gotoXY (TAB, 5); printz (CP[104], score); ClrEoln (); } void ShowMessage (CHAR *s) { gotoXY (TAB, 6); printz ("%s", s); ClrEoln (); } void ClearMessage (void) { gotoXY (TAB, 6); ClrEoln (); } void ShowCurrentMove (SHORT pnt, SHORT f, SHORT t) { algbr (f, t, false); gotoXY (TAB, 7); printz ("(%2d) %4s", pnt, mvstr[0]); } void ShowHeader (void) { gotoXY (TAB, 2); printz (CP[69]); } void ShowSidetoMove (void) { gotoXY (TAB, 14); printz ("%2d: %s", 1 + GameCnt / 2, ColorStr[player]); ClrEoln (); } void ShowPrompt (void) { gotoXY (TAB, 19); printz (CP[121]); /*Your movwe is?*/ ClrEoln (); } void ShowNodeCnt (long int NodeCnt) { gotoXY (TAB, 21); printz (CP[90], NodeCnt, (et > 100) ? NodeCnt / (et / 100) : 0); ClrEoln (); } void ShowResults (SHORT score, UTSHORT *bstline, CHAR ch) { UCHAR d, ply; if (flag.post) { ShowDepth (ch); ShowScore (score); d = 7; for (ply = 1; bstline[ply] > 0; ply++) { if (ply % 4 == 1) { gotoXY (TAB, ++d); ClrEoln (); } algbr ((SHORT) bstline[ply] >> 8, (SHORT) bstline[ply] & 0xFF, false); printz ("%5s ", mvstr[0]); } ClrEoln (); while (d < 13) { gotoXY (TAB, ++d); ClrEoln (); } } } void SearchStartStuff (SHORT side) { SHORT i; signal (SIGINT, TerminateSearch); #ifdef MSDOS side++; /* shut up the compiler */ #else signal (SIGQUIT, TerminateSearch); #endif /* MSDOS */ for (i = 4; i < 14; i++) { gotoXY (TAB, i); ClrEoln (); } } void OutputMove (void) { UpdateDisplay (root->f, root->t, 0, (SHORT) root->flags); gotoXY (TAB, 17); if(flag.illegal){printz(CP[225]);return;} printz (CP[84], mvstr[0]); /*My move is %s*/ if (flag.beep) putchar (7); ClrEoln (); gotoXY (TAB, 24); if (root->flags & draw) printz (CP[58]); else if (root->score == -9999) printz (CP[95]); else if (root->score == 9998) printz (CP[44]); #ifdef VERYBUGGY else if (root->score < -9000) printz (CP[96]); else if (root->score > 9000) printz (CP[45]); #endif /*VERYBUGGY*/ ClrEoln (); if (flag.post) { register SHORT h, l, t; h = TREE; l = 0; t = TREE >> 1; while (l != t) { if (Tree[t].f || Tree[t].t) l = t; else h = t; t = (l + h) >> 1; } ShowNodeCnt (NodeCnt); gotoXY (TAB, 22); printz (CP[81], t); /*Max Tree=*/ ClrEoln (); } ShowSidetoMove (); } void UpdateClocks (void) { SHORT m, s; m = (SHORT) (et / 6000); s = (SHORT) (et - 6000 * (long) m) / 100; if (TCflag) { m = (SHORT) ((TimeControl.clock[player] - et) / 6000); s = (SHORT) ((TimeControl.clock[player] - et - 6000 * (long) m) / 100); } if (m < 0) m = 0; if (s < 0) s = 0; if (player == white) gotoXY (20, (flag.reverse) ? 2 : 23); else gotoXY (20, (flag.reverse) ? 23 : 2); printz ("%d:%02d ", m, s); if (flag.post) ShowNodeCnt (NodeCnt); refresh (); } void gotoXY (SHORT x, SHORT y) { #ifdef MSDOS putchar (ESC); putchar ('['); param (y); putchar (';'); param (x); putchar ('H'); #else move (y - 1, x - 1); #endif /* MSDOS */ } void ClrScreen (void) { #ifdef MSDOS putchar (ESC); putchar ('['); putchar ('2'); putchar ('J'); #else clear (); #endif /* MSDOS */ refresh (); } void ClrEoln (void) { #ifdef MSDOS putchar (ESC); putchar ('['); putchar ('K'); #else clrtoeol (); #endif /* MSDOS */ refresh (); } #ifdef MSDOS void param (SHORT n) { if (n >= 10) { register SHORT d, q; q = n / 10; d = n % 10; putchar (q + '0'); putchar (d + '0'); } else putchar (n + '0'); } #endif /* MSDOS */ void DrawPiece (SHORT sq) { register CHAR x; if (color[sq] == black) #if defined(MSDOS) && !defined(SEVENBIT) x = '7'; /* print WHITE boldface, */ else x = '1'; /* print BLACK inverted */ gotoXY (6 + 5 * VIR_C (sq), 5 + 2 * (7 - VIR_R (sq))); printz ("\033[%cm%c\033[0m", x, pxx[board[sq]]); #else x = '*'; else x = ' '; gotoXY (5 + 5 * VIR_C (sq), 5 + 2 * (7 - VIR_R (sq))); printz ("%c%c ", x, pxx[board[sq]]); #endif /* MSDOS && !SEVENBIT */ } void ShowPostnValue (SHORT sq) /* * must have called ExaminePosition() first */ { SHORT score; gotoXY (4 + 5 * VIR_C (sq), 5 + 2 * (7 - VIR_R (sq))); score = ScorePosition (color[sq]); if (color[sq] != neutral) printz ("%3d ", svalue[sq]); else printz (" "); } void ShowPostnValues (void) { SHORT sq, score; ExaminePosition (); for (sq = 0; sq < 64; sq++) ShowPostnValue (sq); score = ScorePosition (opponent); gotoXY (TAB, 5); printz (CP[103], score, mtl[computer], pscore[computer], mtl[opponent],pscore[opponent]); ClrEoln (); } void UpdateDisplay (SHORT f, SHORT t, SHORT redraw, SHORT isspec) { SHORT i, sq, z; if (redraw) { ShowHeader (); ShowPlayers (); i = 3; gotoXY (3, ++i); #if defined(MSDOS) && !defined(SEVENBIT) printz ("\332\304\304\304\304\302\304\304\304\304\302\304\304\304\304" \ "\302\304\304\304\304\302\304\304\304\304\302\304\304\304\304" \ "\302\304\304\304\304\302\304\304\304\304\277"); #else printz ("+----+----+----+----+----+----+----+----+"); #endif /* MSDOS && !SEVENBIT */ while (i < 19) { gotoXY (1, ++i); if (flag.reverse) z = (i / 2) - 1; else z = 10 - (i / 2); #if defined(MSDOS) && !defined(SEVENBIT) printz ("%d \263 \263 \263 \263 \263 \263 " \ "\263 \263 \263", z); #else printz ("%d | | | | | | | | |", z); #endif /* MSDOS && !SEVENBIT */ gotoXY (3, ++i); if (i < 19) #if defined(MSDOS) && !defined(SEVENBIT) printz ("\303\304\304\304\304\305\304\304\304\304\305\304\304" \ "\304\304\305\304\304\304\304\305\304\304\304\304\305" \ "\304\304\304\304\305\304\304\304\304\305\304\304\304" \ "\304\264"); #else printz ("+----+----+----+----+----+----+----+----+"); #endif /* MSDOS && !SEVENBIT */ } #if defined(MSDOS) && !defined(SEVENBIT) printz ("\300\304\304\304\304\301\304\304\304\304\301\304\304\304\304" \ "\301\304\304\304\304\301\304\304\304\304\301\304\304\304\304" \ "\301\304\304\304\304\301\304\304\304\304\331"); #else printz ("+----+----+----+----+----+----+----+----+"); #endif /* MSDOS && !SEVENBIT */ gotoXY (3, 21); if (flag.reverse) printz (CP[16]); else printz (CP[15]); for (sq = 0; sq < 64; sq++) DrawPiece (sq); } else { DrawPiece (f); DrawPiece (t); if (isspec & cstlmask) if (t > f) { DrawPiece (f + 3); DrawPiece (t - 1); } else { DrawPiece (f - 4); DrawPiece (t + 1); } else if (isspec & epmask) { DrawPiece (t - 8); DrawPiece (t + 8); } } refresh (); } extern CHAR *InPtr; void skip () { while (*InPtr != ' ') InPtr++; while (*InPtr == ' ') InPtr++; } void skipb () { while (*InPtr == ' ') InPtr++; } void ChangeAlphaWindow (void) { ShowMessage (CP[114]); scanz ("%hd", &WAwindow); ShowMessage (CP[34]); scanz ("%hd", &BAwindow); } void ChangeBetaWindow (void) { ShowMessage (CP[115]); scanz ("%hd", &WBwindow); ShowMessage (CP[35]); scanz ("%hd", &BBwindow); } void GiveHint (void) { CHAR s[40]; if (hint) { algbr ((SHORT) (hint >> 8), (SHORT) (hint & 0xFF), false); strcpy (s, CP[198]); /*try*/ strcat (s, mvstr[0]); ShowMessage (s); } else ShowMessage (CP[223]); } void ChangeHashDepth (void) { ShowMessage (CP[163]); scanz ("%hd", &HashDepth); ShowMessage (CP[82]); scanz ("%hd", &HashMoveLimit); } void ChangeSearchDepth (void) { ShowMessage (CP[150]); scanz ("%hd", &MaxSearchDepth); TCflag = !(MaxSearchDepth > 0); } void SetContempt (void) { ShowMessage (CP[142]); scanz ("%hd", &contempt); } void ChangeXwindow (void) { ShowMessage (CP[208]); scanz ("%hd", &xwndw); } void SelectLevel (CHAR *sx) { CHAR T[64], *p, *q; ClrScreen (); XC = XCmore =0; if ((p = strstr (sx, CP[169])) != NULL) p += strlen (CP[169]); else if ((p = strstr (sx, CP[217])) != NULL) p += strlen (CP[217]); strcat (sx, "XX"); q = T; *q = '\0'; for (; *p != 'X'; *q++ = *p++); *q = '\0'; /* line empty ask for input */ while(true){ if (!T[0]) { gotoXY(5,2); printz(CP[61]); refresh (); getstr (T); } strcat (T, "XX"); /* skip whitespace */ for (p = T; *p == ' '; p++); /* Input forms are: M m[:s] - M moves in m:s time m[:s] t - game in m:s time increment t m:[s] - game in m:s time M m[:s] t - for M moves m:s time increment t then reset */ /* could be moves or a incremental clock */ TCminutes = TCmoves = TCseconds = TCadd = 0; TCmoves = (SHORT) strtol (p, &q, 10); if (*q == ':') { /* its gamein form: m:s or m:s t */ TCminutes = TCmoves; TCmoves = 0; if(*(q+1) != ' ') TCseconds = (SHORT) strtol (q + 1, &q, 10); else {q++; } if(*q != 'X' && *q != '+'){ TCadd = (SHORT) strtol (q, &q, 10) * 100; } } else { /* m or m t or M m t*/ while (*q == ' ') q++; if (*q == 'X' || *q == '+') { /* m only 1 number must be gamein */ TCminutes = TCmoves; TCmoves = 0; } else { /* M m or M m[:s] t */ TCminutes = (SHORT) strtol (q, &q, 10); if (*q == ':') { /* M m[:s] t */ if(*(q+1) != ' ') TCseconds = (SHORT) strtol (q + 1, &q, 10); else {q++; } TCadd = (SHORT) strtol (q, &q, 10); }else{/* M m or M m t */ if(*q != 'X' && *q != '+')/* its M m t*/ TCadd = (SHORT) strtol (q, &q, 10)*100; } } } while(*q == ' ')q++; XCmoves[XC] = TCmoves; XCminutes[XC] = TCminutes; XCseconds[XC] = TCseconds; XCadd[XC] = TCadd; XC++; if(*q != '+' || XC == XCLIMIT) break; T[0]='\0'; } TimeControl.clock[white] = TimeControl.clock[black] = 0; SetTimeControl (); ClrScreen (); UpdateDisplay (0, 0, 1, 0); } void DoDebug (void) { SHORT c, p, sq, tp, tc, tsq, score; CHAR s[40]; ExaminePosition (); ShowMessage (CP[65]); scanz ("%s", s); c = neutral; if (s[0] == CP[9][0] || s[0] == CP[9][1]) /* w W*/ c = white; if (s[0] == CP[9][2] || s[0] == CP[9][3]) /*b B*/ c = black; for (p = king; p > no_piece; p--) if ((s[1] == pxx[p]) || (s[1] == qxx[p])) break; for (sq = 0; sq < 64; sq++) { tp = board[sq]; tc = color[sq]; board[sq] = p; color[sq] = c; tsq = PieceList[c][1]; PieceList[c][1] = sq; ShowPostnValue (sq); PieceList[c][1] = tsq; board[sq] = tp; color[sq] = tc; } score = ScorePosition (opponent); gotoXY (TAB, 5); printz (CP[103], score, mtl[computer], pscore[computer], mtl[opponent],pscore[opponent]); ClrEoln (); } void DoTable (SHORT table[64]) { SHORT sq; ExaminePosition (); for (sq=0;sq<64;sq++){ gotoXY (4 + 5 * VIR_C (sq), 5 + 2 * (7 - VIR_R (sq))); printz ("%3d ", table[sq]); } } gnuchess-4.0.pl70/src/version.h100644 21542 13 206 5563711763 15413 0ustar cracraftuser/* * This is GNU Chess. * Copyright (c) 1986-1992 Free Software Foundation. * */ CHAR *version = "4.00"; CHAR *patchlevel = "70"; gnuchess-4.0.pl70/src/gnuchess.lang100644 21542 13 50424 5552467300 16277 0ustar cracraftuser001:eng:{ pnbrqk} 001:ger:{ bsltdk} 001:swe:{ bsltdk} 002:eng:{ PNBRQK} 002:ger:{ BSLTDK} 002:swe:{ BSLTDK} 003:eng:{abcdefgh} 003:ger:{abcdefgh} 003:swe:{abcdefgh} 004:eng:{12345678} 004:ger:{12345678} 004:swe:{12345678} 005:eng:{o-o} 005:ger:{o-o} 005:swe:{o-o} 006:eng:{o-o-o} 006:ger:{o-o-o} 006:swe:{o-o-o} 007:eng:{0-0} 007:ger:{0-0} 007:swe:{0-0} 008:eng:{0-0-0} 008:ger:{0-0-0} 008:swe:{0-0-0} 009:eng:{wWbB} 009:ger:{wWsS} 009:swe:{vVsS} 010:eng:{ score depth nodes time } 010:ger:{ Bewert Tiefe Posit Zeit } 010:swe:{ eval djup noder tid } 011:eng:{ score depth nodes time\n} 011:ger:{ Bewert Tiefe Posit Zeit\n} 011:swe:{ eval djup noder tid\n} 012:eng:{ } 012:ger:{ } 012:swe:{ } 013:eng:{ } 013:ger:{ } 013:swe:{ } 014:eng:{ %s\n} 014:ger:{ %s\n} 014:swe:{ %s\n} 015:eng:{ a b c d e f g h} 015:ger:{ a b c d e f g h} 015:swe:{ a b c d e f g h} 016:eng:{ h g f e d c b a} 016:ger:{ h g f e d c b a} 016:swe:{ h g f e d c b a} 017:eng:{ -} 017:ger:{ -} 017:swe:{ -} 018:eng:{cache} 018:ger:{cache} 018:swe:{ } 019:eng:{nopost} 019:ger:{nohaupt} 019:swe:{novariant} 020:eng:{ } 020:ger:{ } 020:swe:{ } 021:eng:{ } 021:ger:{ } 021:swe:{ } 022:eng:{ } 022:ger:{ } 022:swe:{ } 023:eng:{ } 023:ger:{ } 023:swe:{ } 024:eng:{ } 024:ger:{ } 024:swe:{ } 025:eng:{ } 025:ger:{ } 025:swe:{ } 026:eng:{ } 026:ger:{ } 026:swe:{ } 027:eng:{ } 027:ger:{ } 027:swe:{ } 028:eng:{# Clear board\n} 028:ger:{# Loesche Brett\n} 028:swe:{# Rensa braedet\n} 029:eng:{. Exit to main\n} 029:ger:{. Zurueck ins Spiel\n} 029:swe:{. Tillbaka till spelet\n} 030:eng:{/usr/games/lib/gnuchess.book} 030:ger:{/usr/games/lib/gnuchess.book} 030:swe:{/usr/games/lib/gnuchess.book} 031:eng:{Abort? } 031:ger:{Abbruch? } 031:swe:{Avbryta? } 032:eng:{Ambiguous Move!} 032:ger:{Zug nicht eindeutig!} 032:swe:{Tvetydigt drag!} 033:eng:{Awindow} 033:ger:{Awindow} 033:swe:{Awindow} 034:eng:{BAwindow= } 034:ger:{BAwindow= } 034:swe:{BAwindow= } 035:eng:{BBwindow= } 035:ger:{BBwindow= } 035:swe:{BBwindow= } 036:eng:{Beep: %-12s Transposition file: %s\n} 036:ger:{Beep: %-12s Transposition file: %s\n} 036:swe:{Beep: %-12s Transposition file: %s\n} 037:eng:{Black %s White %s %d eps %d\n} 037:ger:{Schwarz %s Weiss %s %d eps %d\n} 037:swe:{Svart %s Vit %s %d\n} 038:eng:{Bwindow: } 038:ger:{Bwindow: } 038:swe:{Bwindow: } 039:eng:{Bwindow} 039:ger:{Bwindow} 039:swe:{Bwindow} 040:eng:{CHESS command summary\n} 040:ger:{CHESS Befehlsuebersicht\n} 040:swe:{CHESS kommandon\n} 041:eng:{CHESS} 041:ger:{CHESS} 041:swe:{CHESS} 042:eng:{Castled White %s Black %s\n} 042:ger:{Rochade Weiss %s Schwarz %s\n} 042:swe:{Vit Rockad %s Svart %s\n} 043:eng:{Chess\n} 043:ger:{Schach\n} 043:swe:{Schack\n} 044:eng:{Computer mates!} 044:ger:{Computer setzt matt!} 044:swe:{Datorn mattar!} 045:eng:{Computer will soon mate!} 045:ger:{Computer setzt bald matt!} 045:swe:{Datorn mattar snart!} 046:eng:{Computer: %-12s Opponent: %s\n} 046:ger:{Computer: %-12s Gegner: %s\n} 046:swe:{Datorn: %-12s Motstaandare: %s\n} 047:eng:{Computer: %s} 047:ger:{Computer: %s} 047:swe:{Datorn: %s} 048:eng:{Could not open file} 048:ger:{Konnte File nicht oeffnen} 048:swe:{Kunde inte oeppna filen} 049:eng:{Counting transposition file entries, wait!\n} 049:ger:{Zaehle transposition File Eintraege, warten!\n} 049:swe:{Raeknar posterna i transpositionsfilen, vaenta!\n} 050:eng:{Create failed for %s\n} 050:ger:{Erzeugung misslang wegen %s\n} 050:swe:{Skapa misslickades foer %s\n} 051:eng:{Depth: %-12d Response time: %d sec\n} 051:ger:{Tiefe: %-12d Antwortzeit: %d Sek\n} 051:swe:{Djup: %-12d Svarstid: %d sek\n} 052:eng:{Depth: %d} 052:ger:{Tiefe: %d} 052:swe:{Djup: %d} 053:eng:{Depth= %d%c } 053:ger:{Tiefe= %d%c } 053:swe:{Djup= %d%c } 054:eng:{Draw %s\n} 054:ger:{Zug %s\n} 054:swe:{Drag %s\n} 055:eng:{DrawPiece: color[sq] err} 055:ger:{DrawPiece: color[sq] err} 055:swe:{DrawPiece: color[sq] err} 056:eng:{Drawn game! %s} 056:ger:{Spiel unentschieden! %s} 056:swe:{Remi! %s} 057:eng:{Drawn game!\n} 057:ger:{Spiel unentschieden!\n} 057:swe:{Remi!\n} 058:eng:{Drawn game!} 058:ger:{Spiel unentschieden!} 058:swe:{Remi!} 059:eng:{Easy mode: %s} 059:ger:{Leichter Mode: %s} 059:swe:{Laett: %s} 060:eng:{Editing: %s} 060:ger:{Editieren: %s} 060:swe:{Editering: %s} 061:eng:{Enter [moves] minutes[:sec] [increment][+]: } 061:ger:{Eingabe [Zuege] Minuten[:Sek] [Inkrement][+]: } 061:swe:{Ange #drag #minuter: } 062:eng:{Enter Level: } 062:ger:{Eingabe Level: } 062:swe:{Ange Nivaa: } 063:eng:{Enter file name: } 063:ger:{Eingabe Filename: } 063:swe:{Ange Filnamn: } 064:eng:{Enter piece & location: } 064:ger:{Eingabe Figur & Ort: } 064:swe:{Ange pjaes & ruta: } 065:eng:{Enter piece: } 065:ger:{Eingabe Figur: } 065:swe:{Ange pjaes: } 066:eng:{Filling transposition file, wait!\n} 066:ger:{Erzeuge Transposition File, warten!\n} 066:swe:{Fyller transpositionsfilen, vaenta!\n} 067:eng:{GNU Chess display (MS-DOS, Mar 90)} 067:ger:{GNU Schach display (MS-DOS, Mar 90)} 067:swe:{GNU Schack display (MS-DOS, Mar 90)} 068:eng:{GNU Chess display (Nov 89)} 068:ger:{GNU Schach display (Nov 89)} 068:swe:{GNU Schack display (Nov 89)} 069:eng:{GNU Chess} 069:ger:{GNU Schach} 069:swe:{GNU Schack} 070:eng:{Game saved} 070:ger:{Spiel abgespeichert} 070:swe:{Partiet sparat} 071:eng:{Hin/Hout/Tcol/Coll/Fin/Fout = %ld/%ld/%ld/%ld/%ld/%ld\n} 071:ger:{Hin/Hout/Tcol/Coll/Fin/Fout = %ld/%ld/%ld/%ld/%ld/%ld\n} 071:swe:{Hin/Hout/Tcol/Coll/Fin/Fout = %ld/%ld/%ld/%ld/%ld/%ld\n} 072:eng:{Hint: %s\n} 072:ger:{Hinweis: %s\n} 072:swe:{Foerslag: %s\n} 073:eng:{Hit to return: } 073:ger:{Druecke fuer weiter: } 073:swe:{Tillbaks med : } 074:eng:{Human} 074:ger:{Mensch } 074:swe:{Maenniska } 075:eng:{Illegal move (no matching move)%s\n} 075:ger:{ungueltiger Zug (kein passender Zug)%s\n} 075:swe:{Felaktigt drag (inget matchande drag)%s\n} 076:eng:{Illegal move (no matching move)} 076:ger:{ungueltiger Zug (kein passender Zug)} 076:swe:{Felaktigt drag (inget matchande drag)} 077:eng:{Illegal move..(in check)} 077:ger:{ungueltiger Zug..(wird geprueft)} 077:swe:{Otillaatet drag..(i schack)} 078:eng:{Illegal move\n} 078:ger:{ungueltiger Zug\n} 078:swe:{Otillaatet drag\n} 079:eng:{Level: %ld} 079:ger:{Level: %ld} 079:swe:{Level: %ld} 080:eng:{Max Moves} 080:ger:{Max Zuege} 080:swe:{Max Drag} 081:eng:{Max Tree= %5d} 081:ger:{Max Verzw= %5d} 081:swe:{Max Traed= %5d} 082:eng:{MoveLimit= } 082:ger:{Zug Limit= } 082:swe:{Draggraens= } 083:eng:{My move is: %s\n} 083:ger:{Mein Zug ist: %s\n} 083:swe:{Mitt drag aer: %s\n} 084:eng:{My move is: %s} 084:ger:{Mein Zug ist: %s} 084:swe:{Mitt drag aer: %s} 085:eng:{Testing Eval Speed} 085:ger:{Teste Auswert.geschw.} 085:swe:{Testar Evalueringen} 086:eng:{Nf3 move knight to f3 cache turn %s\n} 086:ger:{Lf3 ziehe Laeufer nach f3 cache schalte %s\n} 086:swe:{Lf3 dra loeparen till f3 pip tur %s\n} 087:eng:{No moves} 087:ger:{keine Zuege} 087:swe:{Inga drag} 088:eng:{No pieces} 088:ger:{keine Figur} 088:swe:{Inga pjaeser} 089:eng:{Gen %ld Node %ld Tree %d Eval %ld Rate %ld EC %d/%d RS hi %ld lo %ld \n} 089:ger:{Zug %ld Posit %ld Verz %d Eval %ld Rate %ld EC %d/%d RS hi %ld lo %ld \n} 089:swe:{Drag %ld Nod %ld Traed %d Eval %ld Rate %ld EC %d/%d RS hi %ld lo %ld \n} 090:eng:{Nodes= %8ld, Nodes/Sec= %5ld} 090:ger:{Posit= %8ld, Posit/Sek= %5ld} 090:swe:{Noder= %8ld, Noder/Sek= %5ld} 091:eng:{Nodes= %ld Nodes/sec= %ld\n} 091:ger:{Posit= %ld Posit/Sek= %ld\n} 091:swe:{Noder= %ld Noder/Sek= %ld\n} 092:eng:{OFF} 092:ger:{AUS} 092:swe:{AV} 093:eng:{ON} 093:ger:{EIN} 093:swe:{PAA} 094:eng:{Operator time(hundredths)= } 094:ger:{Operator Zeit(hunderdstel)= } 094:swe:{Operatoertid(hundradelar)= } 095:eng:{Opponent mates!} 095:ger:{Gegner setzt matt!} 095:swe:{Motstaandaren mattar!} 096:eng:{Opponent will soon mate!} 096:ger:{Gegner setzt bald matt!} 096:swe:{Motstaandaren mattar snart!} 097:eng:{Opponent: %s} 097:ger:{Gegner: %s} 097:swe:{Motstaandare: %s} 098:eng:{Playing without hashfile} 098:ger:{Spiel ohne Hashfile} 098:swe:{Spelar utan hashfil} 099:eng:{Random: %-12s Easy mode: %s\n} 099:ger:{Random: %-12s Leichter Mode: %s\n} 099:swe:{Random: %-12s Laett Mode: %s\n} 100:eng:{Random: %s} 100:ger:{Random: %s} 100:swe:{Random: %s} 101:eng:{Repetition} 101:ger:{Wiederholung} 101:swe:{Upprepning} 102:eng:{Gnuchess version %s patchlevel %s\n} 102:ger:{Gnuchess Version %s Revision %s\n} 102:swe:{Gnuchess version %s revision %s\n} 103:eng:{S%d m%d ps%d m%d ps%d} 103:ger:{S%d m%d ps%d m%d ps%d} 103:swe:{S%d m%d ps%d m%d ps%d} 104:eng:{Score= %d} 104:ger:{Bewertung= %d} 104:swe:{Vaerdering= %d} 105:eng:{Score} 105:ger:{Bewertung} 105:swe:{Vaerdering} 106:eng:{Setup successful\n} 106:ger:{Aufstellung erfolgreich\n} 106:swe:{Upstaellning lyckad\n} 107:eng:{Testing CaptureList Speed} 107:ger:{Test Schlagliste Geschw} 107:swe:{Testar Slaglistans Hastighet} 108:eng:{Testing MoveList Speed} 108:ger:{Test Zugliste Geschw} 108:swe:{Testar Draglistans Hastighet} 109:eng:{The file contains %d entries out of max %d\n} 109:ger:{Das File enthaelt %d Eintraege von max. %d\n} 109:swe:{Filen innehaaller %d poster av max. %d\n} 110:eng:{Time Control %s %d moves in %d sec inc %d depth %d\n} 110:ger:{Zeitkontrolle %s %d Zuege in %d Sek Inc %d Tiefe %d\n} 110:swe:{Tidskontroll %s %d drag %d sek %d ink %d djup\n} 111:eng:{TimeControl %d Operator Time %d\n} 111:ger:{Zeitkontrolle %d Operator Zeit %d\n} 111:swe:{Tidskontroll %d Operatoerstid %d\n} 112:eng:{Transposition table: %s} 112:ger:{Transposition Tabelle: %s} 112:swe:{Transpositionstabell: %s} 113:eng:{Usage: Gnuchess [-a] [-t] [-c size] [-s savefile][-l listfile] [-x xwndw]\n} 113:ger:{Aufruf: Gnuchess [-a] [-t] [-c size] [-s savefile][-l listfile] [-x xwndw]\n} 113:swe:{Anvaend: Gnuchess\n [-L ]\n [<+,->a] Laett\n [-b ]\n [-B ]\n [<+,->h] Hashtabell\n [-s ]\n [-l ]\n [-S ]\n [-P ]\n [-r ]\n [-T ]\n [-t] testa hashfilen\n [-c skapa hashfilen x=1..23 betyder 2**x]\n [-x ] paaverkar evalueringen\n [-v] vilken version\n} 114:eng:{WAwindow= } 114:ger:{WAwindow= } 114:swe:{WAwindow= } 115:eng:{WBwindow= } 115:ger:{WBwindow= } 115:swe:{WBwindow= } 116:eng:{White %d:%02d Black %d:%02d\n} 116:ger:{Weiss %d:%02d Schwarz %d:%02d\n} 116:swe:{Vit %d:%02d Svart %d:%02d\n} 117:eng:{White Clock %ld Moves %ld\nBlack Clock %d Moves %d\n\n} 117:ger:{Weiss Uhr %ld Zuege %ld\nSchwarz Uhr %d Zuege %d\n\n} 117:swe:{Vit klocka %ld Drag %ld\nSvart klocka %d drag %d\n\n} 118:eng:{White} 118:ger:{Weiss} 118:swe:{Vit} 119:eng:{Black} 119:ger:{Schwarz} 119:swe:{Svart} 120:eng:{Wwindow: } 120:ger:{Wwindow: } 120:swe:{Wwindow: } 121:eng:{Your move is? } 121:ger:{Ihr Zug ist? } 121:swe:{Ditt drag? } 122:eng:{\n } 122:ger:{\n } 122:swe:{\n } 123:eng:{\nMove# %d Target= %ld Clock: %ld\n} 123:ger:{\nZug# %d Zeilzeit= %ld Uhr: %ld\n} 123:swe:{\nDrag# %d Maal= %ld Klocka: %ld\n} 124:eng:{\nYour move is? } 124:ger:{\nIhr Zug ist? } 124:swe:{\nDitt drag? } 125:eng:{\n\n} 125:ger:{\n\n} 125:swe:{\n\n} 126:eng:{\nmove score depth nodes time flags capture color\n} 126:ger:{\nZug BewertTiefe Posit Zeit flags capture Farbe\n} 126:swe:{\ndrag eval djup noder tid flags capture faerg\n} 127:eng:{\n} 127:ger:{\n} 127:swe:{\n} 128:eng:{a7a8q promote pawn to queen material turn %s\n} 128:ger:{a7a8d wandle Bauer in Dame material schalte %s\n} 128:swe:{a7a8d pronoverar till dam material tur %s\n} 129:eng:{alg} 129:ger:{alg} 129:swe:{alg} 130:eng:{bd redraw board reverse board display\n} 130:ger:{br zeichne Brett neu drehe drehe Brett\n} 130:swe:{br ritar om braedet invertera braedesvisning\n} 131:eng:{bd} 131:ger:{br} 131:swe:{br} 132:eng:{beep} 132:ger:{ton } 132:swe:{pip } 133:eng:{black} 133:ger:{schwarz} 133:swe:{svart} 134:eng:{book} 134:ger:{bibl} 134:swe:{bok} 135:eng:{both} 135:ger:{beide} 135:swe:{baada} 136:eng:{c Change sides\n} 136:ger:{c Wechsle Spieler\n} 136:swe:{c byt sida\n} 137:eng:{chess.000} 137:ger:{chess.000} 137:swe:{chess.000} 138:eng:{chess.lst.%d} 138:ger:{chess.lst.%d} 138:swe:{chess.lst.%d} 139:eng:{computer mates!\n} 139:ger:{Computer setzt matt!\n} 139:swe:{datorn saetter matt!\n} 140:eng:{computer will soon mate!\n} 140:ger:{Computer setzt bald matt!\n} 140:swe:{datorn saetter snart matt!\n} 141:eng:{computer} 141:ger:{Computer} 141:swe:{datorn} 142:eng:{contempt= } 142:ger:{contempt= } 142:swe:{contempt= } 143:eng:{contempt} 143:ger:{contempt} 143:swe:{contempt} 144:eng:{coords show coords rv reverse video\n} 144:ger:{Koord bezeichne Felder rv Farbumkehr\n} 144:swe:{koord visa koordinater rv negativ bild\n} 145:eng:{coords} 145:ger:{Koord} 145:swe:{koord} 146:eng:{debuglevel= } 146:ger:{debuglevel= } 146:swe:{debuglevel= } 147:eng:{debuglevel} 147:ger:{debuglevel} 147:swe:{debuglevel} 148:eng:{debug} 148:ger:{debug} 148:swe:{debug} 149:eng:{depth set search depth clock set time control\n} 149:ger:{tiefe setze Suchtiefe zeit setze Zeitkontrolle\n} 149:swe:{djup saett soekdjup tid saett tidskontroll\n} 150:eng:{depth= } 150:ger:{Tiefe= } 150:swe:{djup= } 151:eng:{depth} 151:ger:{tiefe} 151:swe:{djup} 152:eng:{easy} 152:ger:{leicht} 152:swe:{laett} 153:eng:{edit edit board force enter game moves\n} 153:ger:{edit editiere Brett selbst spiele .. beide Seiten\n} 153:swe:{edit editera braedet sjaelv spela baada sidorna\n} 154:eng:{edit} 154:ger:{edit} 154:swe:{edit} 155:eng:{enter piece & location: \n} 155:ger:{Eingabe Figur & Position: \n} 155:swe:{Ange pjaes & ruta: \n} 156:eng:{first} 156:ger:{first} 156:swe:{first} 157:eng:{force} 157:ger:{selbst} 157:swe:{sjaelv} 158:eng:{g1f3 move from g1 to f3 quit Exit Chess\n} 158:ger:{g1f3 ziehe von g1 nach f3 ende Verlasse Spiel\n} 158:swe:{g1f3 flytta g1 till f3 sluta Avsluta Chess\n} 159:eng:{game file= } 159:ger:{Spielfile= } 159:swe:{sparfil= } 160:eng:{get} 160:ger:{hole} 160:swe:{haemta} 161:eng:{gnuchess 4p%s game\n} 161:ger:{gnuchess 4p%s Spiel\n} 161:swe:{gnuchess 4p%s parti\n} 162:eng:{go} 162:ger:{ziehe} 162:swe:{dra} 163:eng:{hashdepth= } 163:ger:{Hashtiefe= } 163:swe:{hashdjup= } 164:eng:{hashdepth} 164:ger:{Hashtiefe} 164:swe:{hashdjup} 165:eng:{hash} 165:ger:{hash} 165:swe:{hash} 166:eng:{help} 166:ger:{hilfe} 166:swe:{hjaelp} 167:eng:{hint suggest a move post turn %s principle variation\n} 167:ger:{hinw schlage Zug vor haupt schalte Hauptvariante %s\n} 167:swe:{tips tipsa om drag variant visa huvudvariant %s\n} 168:eng:{hint} 168:ger:{hinw} 168:swe:{tips} 169:eng:{level} 169:ger:{Level} 169:swe:{level} 170:eng:{list game to chess.lst book turn %s used %d of %d\n} 170:ger:{doku mentiere in chess.lst bibl schalte %s benutzte %d von %d\n} 170:swe:{lista parti till chess.lst bok slaar %s anvaende %d av %d\n} 171:eng:{list} 171:ger:{doku} 171:swe:{lista} 172:eng:{new} 172:ger:{neu} 172:swe:{ny} 173:eng:{o-o castle king side easy turn %s\n} 173:ger:{o-o kurze Rochade leicht schalte %s\n} 173:swe:{o-o kort rockad laett saett %s\n} 174:eng:{o-o-o castle queen side hash turn %s\n} 174:ger:{o-o-o lange Rochade hash schalte %s\n} 174:swe:{o-o-o laang rockad hash slaar %s\n} 175:eng:{opponent mates!\n} 175:ger:{Gegner schlaegt Matt!\n} 175:swe:{Motstaandaren saetter matt!\n} 176:eng:{opponent will soon mate!\n} 176:ger:{Gegner schlaegt bald Matt!\n} 176:swe:{Motstaandaren mattar strax!\n} 177:eng:{post principle variation hint suggest a move\n} 177:ger:{haupt Hauptvariante hinw schlage Zug vor\n} 177:swe:{variant huvudvarianten hinw tipsa om ett drag\n} 178:eng:{post} 178:ger:{haupt} 178:swe:{variant} 179:eng:{p} 179:ger:{p} 179:swe:{p} 180:eng:{quit} 180:ger:{ende} 180:swe:{sluta} 181:eng:{random randomize play new start new game\n} 181:ger:{zufall variableres Spiel neu Starte neues Spiel\n} 181:swe:{slump varierar spelet ny startar nytt spel\n} 182:eng:{random} 182:ger:{zufall} 182:swe:{slump} 183:eng:{rcptr} 183:ger:{rcptr} 183:swe:{rcptr} 184:eng:{remove} 184:ger:{zur} 184:swe:{bort} 185:eng:{reverse} 185:ger:{drehe} 185:swe:{invertera} 186:eng:{rv} 186:ger:{rv} 186:swe:{rv} 187:eng:{r} 187:ger:{r} 187:swe:{r} 188:eng:{save game to file get game from file\n} 188:ger:{speich Spiel in File hole Spiel aus File\n} 188:swe:{spara parti i fil haemta parti fraan fil\n} 189:eng:{save} 189:ger:{speich} 189:swe:{spara} 190:eng:{setup} 190:ger:{setup} 190:swe:{setup} 191:eng:{set} 191:ger:{set} 191:swe:{set} 192:eng:{shade toggle shade black stars toggle stars\n} 192:ger:{Schatt aender Farbton schwarz stern Stern bei Schwarz\n} 192:swe:{skugga skuggning av svart asterisk Asterisker foer svart\n} 193:eng:{stars} 193:ger:{stern} 193:swe:{stern} 194:eng:{switch sides with computer both computer match\n} 194:ger:{wechs ele Seite mit computer beide Computer spielt ..\n} 194:swe:{byt sida med datorn baada datorn spelar sjaelv\n} 195:eng:{switch} 195:ger:{wechs} 195:swe:{byt} 196:eng:{test} 196:ger:{Test} 196:swe:{test} 197:eng:{time} 197:ger:{zeit} 197:swe:{tid} 198:eng:{try } 198:ger:{Versuch } 198:swe:{proeva } 199:eng:{ttable collision detected} 199:ger:{ttable collision detected} 199:swe:{ttable collision detected} 200:eng:{undo undo last ply remove take back a move\n} 200:ger:{hzur Halbzug zurueck zur nehme einen Zug zurueck\n} 200:swe:{aengra ta tillbaka halvdrag tillbaka ta tillbaka ett drag\n} 201:eng:{undo} 201:ger:{hzur} 201:swe:{hzur} 202:eng:{white computer plays white black computer plays black\n} 202:ger:{weiss Computer nimmt Weiss schwarz Computer nimmt Schwarz\n} 202:swe:{vit datorn spelar vit svart datorn spelar svart\n} 203:eng:{white} 203:ger:{weiss} 203:swe:{vit} 204:eng:{w} 204:ger:{w} 204:swe:{w} 205:eng:{xboard.position.read} 205:ger:{xboard.position.read} 205:swe:{xboard.position.read} 206:eng:{xboard} 206:ger:{xboard} 206:swe:{xboard} 207:eng:{xget} 207:ger:{xget} 207:swe:{xget} 208:eng:{xwndw= } 208:ger:{xwndw= } 208:swe:{xwndw= } 209:eng:{xwndw} 209:ger:{xwndw} 209:swe:{xwndw} 210:eng:{yes} 210:ger:{ja} 210:swe:{ja} 211:eng:{Illegal move in book %d %s %s} 211:ger:{Unerlaubter Zug in Bibl. %d %s %s} 211:swe:{Otillaatet drag i bok %d %s %s} 212:eng:{Warning can't find book.} 212:ger:{Warnung: kann Bibl. nicht finden.} 212:swe:{Varning, kan inte hitta boken.} 213:eng:{Book used %d of %d entries.} 213:ger:{Bibl. benutzte %d von %d Eintraegen.} 213:swe:{Boken anvaende %d av %d poster.} 214:eng:{true} 214:ger:{wahr} 214:swe:{sant} 215:eng:{false} 215:ger:{falsch} 215:swe:{falskt} 216:eng:{exit} 216:ger:{exit} 216:swe:{exit} 217:eng:{clock} 217:ger:{Uhr} 217:swe:{klocka} 218:eng:{Computer} 218:ger:{Computer} 218:swe:{Computer} 219:eng:{Open failure for file: %s} 219:ger:{Fehler beim Oeffnen des files: %s} 219:swe:{Fel vid filoeppning: %s} 220:eng:{Time Control Error} 220:ger:{Fehler Zeitkontrolle} 220:swe:{Tidskontrollsfel} 221:eng:{material} 221:ger:{material} 221:swe:{material} 222:eng:{time %d %d\n} 222:ger:{Zeit %d %d\n} 222:swe:{tid %d %d} 223:eng:{I have no idea\n} 223:ger:{Ich habe keine Ahnung\n} 223:swe:{Jag har inte en aning\n} 224:eng:{Not Enough Material} 224:ger:{Nicht genug Material} 224:swe:{Inte nog med material} 225:eng:{Illegal position} 225:ger:{Unerlaubter position} 225:swe:{otillaaten position} 226:eng:{beep} 226:ger:{beep} 226:swe:{beep} 227:eng:{gamein} 227:ger:{gamein} 227:swe:{gamein} 228:eng:{otim} 228:ger:{otim} 228:swe:{otim} 229:eng:{hard} 229:ger:{hart} 229:swe:{svaar} 230:eng:{Time Control %s Game in %d sec inc %d sec depth %d\n} 230:ger:{Zeitkontrolle %s Spiel in %d Sek Inc %d Sek Tiefe %d\n} 230:swe:{Time Control %s Game in %d sec inc %d sec depth %d\n} gnuchess-4.0.pl70/test/ 40755 21542 13 0 5554021256 13661 5ustar cracraftusergnuchess-4.0.pl70/test/CHESSTEST/ 40755 21542 13 0 5563711664 15237 5ustar cracraftusergnuchess-4.0.pl70/test/CHESSTEST/SUN.results100644 21542 13 1407 5527662450 17424 0ustar cracraftuser Sparc10 IPC test right #problems %right right %right diff bellin 8 33 24 8 24 0 ece3 835 1797 46 802 45 1 finecomb 11 50 22 8 16 3 gelfer 89 327 27 79 24 10 hardmid 321 878 37 269 31 52 hortjan 58 133 44 53 40 5 jenoban 115 202 57 110 54 5 kcmdm 38 148 26 38 26 0 kotov 41 115 36 40 35 1 larsen1 74 100 74 73 73 1 larsen2 17 48 35 15 31 2 larsen3 24 63 38 21 33 3 openings 17 114 15 16 14 1 positional 60 154 39 54 35 6 reinfeld 638 999 64 583 58 55 sherev 10 60 17 11 18 -1 speelman 65 167 39 62 37 3 winatchess 243 300 81 220 73 23 total 2664 5688 47 2462 43 202 total time 75 hours gnuchess-4.0.pl70/test/CHESSTEST/cmpr.c100644 21542 13 2041 5527662450 16434 0ustar cracraftuser#include FILE *A, *B; char a[100]; char b[100]; char *aa, *bb; char *aaa, *bbb; int i, fail, right, num; int loop = 1; main (argc, argv) int argc; char *argv[]; { A = fopen (argv[1], "r"); B = fopen (argv[2], "r"); num = 0; right = 0; while (fgets (a, 100, A) != NULL) { if (strlen (a) < 8) { printf ("bad file %s\n", argv[1]); exit (); } fail = 0; num++; fgets (b, 100, B); if (strlen (b) < 8) { printf ("bad file %s\n", argv[2]); exit (); } aa = a; bb = b; for (; *aa != ':'; aa++); for (; *bb != ':'; bb++); aa += 2; bb += 2; aaa = aa; bbb = bb; loop=1; while (loop) { fail = 0; for (i = 0; i < 4; i++) { if (!fail && *aa != *bb) { fail = 1; } aa++; bb++; } if (fail && *bb == ',') { aa -= 4; loop = 1; bb++; } else loop = 0; } /*printf("%s %s %c\n",aaa,bbb,fail?' ':'*');*/ if (!fail) right++; } printf ("%s %d RIGHT %d\n", argv[1], right, num); } gnuchess-4.0.pl70/test/CHESSTEST/score.c100644 21542 13 2203 5527662450 16606 0ustar cracraftuser#include char s[100]; FILE *I; char *p, *q, *r; int first = 1; int sco = 0; int cnt = 0; int ovs =0; int ovc = 0; char last[24]; main (argc, argv) int argc; char *argv[]; { I = fopen (argv[1], "r"); printf (" test right wrong total percent\n"); while (fgets (s, 100, I) != NULL) { /* p -> name */ p = s+8; for (; *p != '.'; p++); /* q -> right */ for (q = p; *q != ' ';q++); q++; /* r -> cnt */ for (r = q; *r != ' '; r++); r++; for (; *r != ' '; r++); r++; *p = '\0'; if (first) { strcpy (last, s+8); first = 0; } if (strcmp (s+8, last) == 0) { sco += atoi (q); cnt += atoi (r); } else { printf ("%9s\t%d\t%d\t%d\t%d\n", last, sco,cnt - sco, cnt, (int)(((float)sco/(float)cnt)*100.+.5)); strcpy (last, s+8); ovs += sco; ovc += cnt; cnt = atoi (r); sco = atoi (q); } } printf ("%9s\t%d\t%d\t%d\t%d\n", last, sco,cnt - sco, cnt, (int)(((float)sco/(float)cnt)*100.+.5)); ovs += sco; ovc += cnt; printf ("\ntotal \t%d\t%d\t%d\t%d\n", ovs, ovc - ovs,ovc,(int)(((float)ovs/(float)ovc)*100.+.5)); } gnuchess-4.0.pl70/test/CHESSTEST/testgen.c100644 21542 13 6105 5556702156 17151 0ustar cracraftuser#include #include /* convert fen notation to gnu save format */ char b[8][8]; char fn[12],*color, *colort; int i, j, k, l; int r, c; int eps; int timec,timem,times; char *p, *q; FILE *F, *O, *W, *R; int wq, wk, bq, bk; char in[512]; char move[512],*q; /* */ /* testgen file testx bk time-min moves time-sec */ /* */ int count = 0; int countx = 0; char name[100]; char namer[100]; main(argc,argv) int argc; char *argv[]; { k = 1; F = fopen(argv[1], "r"); /* W = fopen(argv[3], "w"); fprintf(W,"0 0\n"); */ timec = atoi(argv[4])*6000; timem = atoi(argv[5]); times = atoi(argv[6]); timec=timec+ ( times*100); count =100; while (fgets(in, 512, F) != NULL) { if(strncmp("begin",in,4) == 0)continue; if(strncmp(in,"\n",1) == 0)continue; if(strncmp(in,"#",1) == 0)continue; if(strncmp(in,"\t",1) == 0)continue; if (strncmp(" ", in, 1) != 0) { count++; if(count > 99){ count = 0; countx++; sprintf(name,"%s%02d",argv[3],countx); sprintf(namer,"%s.%s%02d.ANS",argv[1],argv[3],countx); if(countx > 1){ fprintf(W,"quit\n"); fclose(W);} W = fopen(name,"w"); R = fopen(namer,"w"); fprintf(W,"0 0\n"); } fprintf(W,"get\n"); wq = wk = bq = bk = 10; for (i = 0; i < 8; i++) { for (j = 0; j < 8; j++) { b[i][j] = '.'; } } p = in; r = 0; c = 0; while (r<8 && *p != ' ') { if (isdigit(*p)) { c += (*p - '0'); } else if (*p == '/') { r++; c = 0; } else { if(isupper(*p))*p = tolower(*p); else *p = toupper(*p); b[r][c] = *p; c++; } p++; } if(*p == 'w') {color = "White";colort = "white";} else {color = "Black";colort = "black";} p += 2; sprintf(fn, "%s%03d", argv[2],k); /* at Right move */ q = move; while(*p != ' '){ if(isupper(*p)){p++; continue;} if(*p == 'x'){ p++; continue;} if(*p == '+'){ p++; continue;} if(*p == '!'){ p++; continue;} if(*p == '?'){ p++; continue;} if(*p == '='){ p++; continue;} *q++ = *p++; } *q++ = '\0'; fprintf(R,"My move is: %s\n",move); k++; O = fopen(fn, "w"); fprintf(W, "%s\n",fn); fprintf(W, "level %d %d:%d\n",timem,timec/6000,timec%6000); fprintf(W,"%s\npost\ngo\n",colort); fprintf(O, "White computer Black Human 1 eps %d # To move %s correct %s\nCastled White false Black false # ep \nTimeControl 0 Operator Time 0\nWhite Clock %d Moves %d\nBlack Clock %d Moves %d\n\n", eps,color,move,timec,timem,timec,timem); for (r = 0; r < 8; r++) { fprintf(O, "%c ", '0' + r); for (c = 0; c < 8; c++) { fprintf(O, "%c", b[r][c]); } if (r == 0) fprintf(O, " %d 10 10 10 %d 10 10 %d\n", bq, ((bq + bk) > 10) ? 10 : 0, bk); else if (r == 7) fprintf(O, " %d 10 10 10 %d 10 10 %d\n", wq, ((wq + wk) > 10) ? 10 : 0, wk); else fprintf(O, " 10 10 10 10 10 10 10 10\n"); } fprintf(O, " abcdefgh\n\nmove score depth nodes time flags capture color\n"); fclose(O); } } fprintf(W, "quit\n"); fclose(W); fclose(R); } gnuchess-4.0.pl70/test/CHESSTEST/bellin.fin100644 21542 13 7144 5527662450 17303 0ustar cracraftuser#Test positions from IM Robert Bellin and Italian NM Pietro Ponzetto: #Test your positional play, Macmillan 1985. # #The examples "test 1-30" actually are "test" positions from a test #designed to predict your rating... according to a chart at the end of #the book, a perfect score on the 30 "test" positions is supposed to #prove that your FIDE Elo rating is >=2760, i.e. roughly the equal of #Kasparov. (And USCF=FIDE+50, they say.) A score of about 50% would #give you a FIDE rating of about 1550. Their precise scoring scheme is #quite complicated so I have omitted it. I also put another 3 positions #from the book (but which were not part of their "test") at the end of #this file. Total is 33 positions. # r1b1r1k1/3nq1pp/4p3/pp1p1p2/3P4/4PN2/PPQN1PPP/2R2RK1/w Nd2b3 (Bellin&Ponzetto) (test 1) r1b2rk1/ppp2p2/3b1q1p/2p1p1p1/4P3/3P1NB1/PPP2PPP/R2Q1RK1/b Bc8g4 (Bellin&Ponzetto) (test 2) rnb1k2r/ppp2pp1/5q1p/3p4/1b1P4/2N5/PPQ1PPPP/R3KBNR/w Pa2a3 (Bellin&Ponzetto) (test 3) 2kr1b1r/pp1n1p2/2q1pp1p/7P/2pP1B2/5NP1/PPP1QP2/2KR3R/w Pd4d5 (Bellin&Ponzetto) (test 4) r4rk1/1ppbqppp/2np1n2/4p3/p1P1N3/P1QPPP2/1P2B1PP/R1B2RK1/b Nf6e8 (Bellin&Ponzetto) (test 5) r2qr1k1/pp3ppp/2pbpnn1/8/2PP4/P2Q1NB1/1PB2PPP/3R1RK1/w Nf3e5 (Bellin&Ponzetto) (test 6) rq3rk1/1b1nbppp/pp1ppn2/8/2P1P3/1PN1QNP1/PB3PBP/R4RK1/w Nf3d4 (Bellin&Ponzetto) (test 7) r4r2/pp1bnk2/4pp1p/3p3P/P1pP4/2P2NR1/2P2PP1/R3KB2/b Rf8c8 (Bellin&Ponzetto) (test 8) r1q3k1/1b2bp1p/p3p1pB/1pnpP3/3N1P2/3BP3/PP4PP/3Q1RK1/w Pg2g4 (Bellin&Ponzetto) (test 9) r1b2rk1/1pp1qppp/2n2n2/p1b1p3/4P3/1BP2N1P/PPQN1PP1/R1B2RK1/b Nf6h5 (Bellin&Ponzetto) (test 10) rn1q1rk1/p3ppbp/2p1b1p1/1p1n4/3P1B2/2N1PN2/PPQ1BPPP/R3K2R/w Nc3xNd5 (Bellin&Ponzetto) (test 11) 2qr1bk1/p4pp1/1p5p/3pPP2/6P1/2PQ3P/P2B4/4R1K1/b Qc8c4 (Bellin&Ponzetto) (test 12) r1bq1rk1/pp3ppp/2n1p3/2b5/4P3/3B1N2/PP3PPP/R1BQ1RK1/w Pe4e5 (Bellin&Ponzetto) (test 13) r2qr1k1/1bn2pp1/1p3b1p/p1pPp2P/P3P3/1PN1B1P1/5PB1/2RQ1RK1/b Re8f8 (Bellin&Ponzetto) (test 14) 4r3/1bq1b1k1/p4ppp/1pp1p1n1/4P1N1/2P3BP/PPBRQPP1/6K1/w Ph3h4 (Bellin&Ponzetto) (test 15) rn1r2k1/pb2qpbp/5np1/2pp4/8/1PN1PN2/PB1QBPPP/2RR2K1/b Bg7h6 (Bellin&Ponzetto) (test 16) 1k1r3r/pp1n1ppp/2pqbn2/3p4/3P4/2NBPN1P/PPQ2PP1/1K1R3R/w Kb1a1 (Bellin&Ponzetto) (test 17) 2kr4/pp1r1pp1/1q2pn1p/2b4P/2P2BP1/5P2/PPQ1N3/1K1R3R/b Bc5e3 (Bellin&Ponzetto) (test 18) 2rqk2r/p2nbppp/1pb1p3/3n4/3P4/P1NB1N2/1P3PPP/R1BQR1K1/w Nc3xNd5 (Bellin&Ponzetto) (test 19) 1k1r1b1r/ppq2pp1/2p3p1/2P2n2/PP6/1Q4N1/1B3PPP/R4RK1/b Pa7a5 (Bellin&Ponzetto) (test 20) rn1q1rk1/pb4bp/1p2ppp1/1B6/Q2PP3/4BN2/P4PPP/2R1K2R/w Pd4d5 (Bellin&Ponzetto) (test 21) 2r2rk1/1p1qbppp/p1n1p3/3pP3/3P3P/5N2/PPRBQPP1/2R3K1/b Be7xPh4 (Bellin&Ponzetto) (test 22) r4rnk/1ppqbppp/2n1b3/p2pP3/3P4/PB2NN2/1PQ2PPP/R1B1R1K1/w Bb3a4 (Bellin&Ponzetto) (test 23) 3rq1k1/4rppp/2n3b1/pp2P3/2pP1QB1/P1P1R3/1B4PP/4R1K1/b Re7e6 (Bellin&Ponzetto) (test 24) 2rr2k1/p3qppp/1p2p1n1/8/2P5/1P4P1/PB2QPKP/2R2R2/w Rc1d1 (Bellin&Ponzetto) (test 25) rn1qk2r/p2bnppp/1p2p3/2ppP3/3P4/P1PB1N2/2P2PPP/R1BQK2R/b Bd7a4 (Bellin&Ponzetto) (test 26) 2kr3r/1bq1bppp/p2p4/2n1pPP1/1p2P2P/1N3QN1/PPP5/2KR1B1R/w Bf1c4 (Bellin&Ponzetto) (test 27) 1r3rk1/1p1nqpbp/p2p1np1/P1pP4/4PB2/2N2B1P/1PQ2PP1/R4RK1/b Nf6e8 (Bellin&Ponzetto) (test 28) r4rk1/3bqpbp/pn1p1np1/1p1Pp1B1/4P3/1PN2PN1/P2QB1PP/R4RK1/w Bg5e3 (Bellin&Ponzetto) (test 29) 2r1r1k1/pbqn1pp1/1p2pn1p/8/2PP4/3B1N2/P2BQPPP/2R1R1K1/b Bb7xNf3 (Bellin&Ponzetto) (test 30) rn2kb1r/ppp1qppp/8/4Pb2/4nB2/2N2N2/PPP3PP/R2QKB1R/w Bf1b5+! (Bellin&Ponzetto) (page 16, 8) r2qk2r/pppnpbb1/3p2pp/3n4/3PNB1P/3B1N2/PPP1QPP1/R3K2R/w Bf4xPd6 (Bellin&Ponzetto) (page 17, 10) r1q2rk1/1b2ppb1/ppnp1npp/8/2P2Q2/1PN2NP1/PB2PPBP/3R1RK1/w Qf4c1 (Bellin&Ponzetto) (page 22, 15) gnuchess-4.0.pl70/test/CHESSTEST/ece3.fin100644 21542 13 363435 5527662450 16725 0ustar cracraftuser#Here are boards 2-1746 from the big endgame book, Encyclopedia of #chess endings, by A. Adorjan et al, FIDE, Beograd 1986, volume 3 of 5: #(Namely Rook endings with Ps, Ns, and Bs, mostly) The moves with the !? #symbol are more complicated than the alternatives but are still #game-theoretically optimal. # #The following boards (5 7 26 51 53 54 96 100 140 611 1113) contained #special dot symbols that were supposed to indicate things like #equivalent positions for the king; we turned the dots into ordinary #empty squares. # R7/8/8/8/3K4/8/3kp3/8/w Ra8a2+ (Adorjan_EofCE3) #2 draw 3R4/8/8/8/8/8/4p1K1/4k3/w Rd8e8 (Adorjan_EofCE3) #3 white_wins 3R4/8/8/8/8/6K1/4p3/4k3/w Rd8e8 (Adorjan_EofCE3) #4 draw 6R1/8/8/8/8/6K1/4p3/4k3/w Kg3g2! (Adorjan_EofCE3) #5 white_wins 8/8/8/3R4/8/3K4/kp6/8/w Rd5a5+ (Adorjan_EofCE3) #6 draw 8/2K5/8/8/3R4/5k2/4p3/8/w Rd4d3+ (Adorjan_EofCE3) #7 draw 8/8/2K5/8/3R4/5k2/4p3/8/w Rd4d3+ (Adorjan_EofCE3) #8 black_wins 8/8/7K/8/6R1/4k3/5p2/8/w Rg4g3+ (Adorjan_EofCE3) #9 draw 8/2P5/1K6/3r4/8/8/8/k7/b Rd5d6+ (Adorjan_EofCE3) #10 white_wins 8/1K6/8/8/8/R7/1kp5/8/w Ra3a6! (Adorjan_EofCE3) #11 draw 8/2k2P2/4K3/2r5/8/8/8/8/b Rc5c6+ (Adorjan_EofCE3) #12 white_wins 8/3k2P1/5K2/3r4/8/8/8/8/b Rd5d6+ (Adorjan_EofCE3) #13 draw 8/8/8/8/8/3k4/2p2K2/R7/w Kf2e1 (Adorjan_EofCE3) #14 draw 1k6/R7/K7/8/8/8/2p5/8/w Ra7b7+ (Adorjan_EofCE3) #15 draw 8/8/8/8/8/3K1kp1/8/R7/w Ra1f1+ (Adorjan_EofCE3) #16 white_wins 1R6/8/8/8/8/3K2p1/6k1/8/b Kg2f2 (Adorjan_EofCE3) #17 draw 8/8/8/K7/4p3/8/5k2/7R/b Pe4e3 (Adorjan_EofCE3) #18a draw 8/8/8/K7/4p3/8/5k2/7R/w Ka5b4 (Adorjan_EofCE3) #18b white_wins 8/8/8/8/4p3/7K/5k2/R7/w Ra1a2+! (Adorjan_EofCE3) #19 white_wins 8/8/8/8/4p3/8/5k1K/R7/w Ra1a8 (Adorjan_EofCE3) #19 white_wins 8/8/8/8/4p3/8/K2k4/R7/w Ka2b1! (Adorjan_EofCE3) #20 white_wins R7/8/3K4/8/4p3/5k2/8/8/w Ra8f8+! (Adorjan_EofCE3) #21 white_wins 8/8/4K3/8/4p3/4k3/6R1/8/w Rg2g5! (Adorjan_EofCE3) #22 white_wins 8/8/7K/8/6p1/6k1/4R3/8/w Re2e8 (Adorjan_EofCE3) #23 white_wins 8/K7/8/8/4pk2/8/8/R7/b Pe4e3 (Adorjan_EofCE3) #24a draw 8/K7/8/8/4pk2/8/8/R7/w Ka7b6 (Adorjan_EofCE3) #24b white_wins 8/5K2/8/8/4pk2/8/8/R7/w Kf7e6! (Adorjan_EofCE3) #25 white_wins 8/6K1/8/8/4pk2/8/8/R7/w Kg7f6 (Adorjan_EofCE3) #26 draw 8/8/8/7K/3pk3/8/8/3R4/w Kh5g4 (Adorjan_EofCE3) #27 white_wins 7R/8/8/K2k4/4p3/8/8/8/b Kd5c4! (Adorjan_EofCE3) #28 draw 8/4K3/8/5k2/4p3/8/8/R7/b Pe4e3! (Adorjan_EofCE3) #29 draw 4R3/5K2/8/5k2/4p3/8/8/8/w Re8e7! (Adorjan_EofCE3) #30 white_wins 8/2K5/8/1k6/1p6/8/8/1R6/b Kb5c5! (Adorjan_EofCE3) #31a draw 8/2K5/8/1k6/1p6/8/8/1R6/w Kc7b7! (Adorjan_EofCE3) #31b white_wins K7/1R6/5k2/8/4p3/8/8/8/w Rb7b5! (Adorjan_EofCE3) #32 white_wins 8/8/8/6P1/8/6K1/3k4/4r3/w Kg3f4! (Adorjan_EofCE3) #33 draw 8/8/8/8/6P1/6K1/2r5/4k3/w Kg3f4 (Adorjan_EofCE3) #34 black_wins 7K/8/2k5/1p5R/8/8/8/8/b Kc6b6 (Adorjan_EofCE3) #35 white_wins 6K1/8/8/4p3/3k4/8/8/5R2/w Rf1d1+ (Adorjan_EofCE3) #36 white_wins 3K4/2R5/8/5p2/4k3/8/8/8/w Rc7e7+ (Adorjan_EofCE3) #37 draw 4K3/3R4/8/6p1/8/5k2/8/8/w Rd7f7+! (Adorjan_EofCE3) #38 white_wins 8/4K3/8/3pk3/3R4/8/8/8/w Rd4d2! (Adorjan_EofCE3) #39 white_wins 8/5K2/3R4/6p1/8/5k2/8/8/w Rd6f6+! (Adorjan_EofCE3) #40 white_wins 3R4/4K3/8/5kp1/8/8/8/8/w Rd8f8+ (Adorjan_EofCE3) #41 white_wins 8/3RK3/8/5kp1/8/8/8/8/w Ke7d6! (Adorjan_EofCE3) #42 white_wins 8/4K3/3R4/5kp1/8/8/8/8/w Rd6d5+ (Adorjan_EofCE3) #43 draw 8/4K3/8/5kp1/8/8/8/1R6/w Ke7d6 (Adorjan_EofCE3) #44 white_wins 8/4K3/8/5kp1/8/8/1R6/8/w Ke7d6 (Adorjan_EofCE3) #45 draw 8/8/1K6/1R2p3/3k4/8/8/8/w Rb5b4+! (Adorjan_EofCE3) #46 white_wins 4K3/6R1/2pk4/8/8/8/8/8/w Rg7g5! (Adorjan_EofCE3) #47 white_wins K7/1R6/5p2/8/4k3/8/8/8/w Rb7e7+! (Adorjan_EofCE3) #48 white_wins 8/2K5/5p2/5k2/8/8/6R1/8/b Kf5e4 (Adorjan_EofCE3) #49 white_wins 8/r7/8/8/5K2/8/6P1/1k6/b Ra7f7+! (Adorjan_EofCE3) #50 black_wins R7/8/8/8/6K1/8/6kp/8/w Ra8a2+ (Adorjan_EofCE3) #51 white_wins R7/8/8/8/5K2/8/6kp/8/w Ra8a2+ (Adorjan_EofCE3) #52 draw 6R1/8/8/8/5K2/8/7p/7k/w Kf4g3! (Adorjan_EofCE3) #53 white_wins 6R1/8/3K4/8/8/7p/7k/8/w Kd6e5 (Adorjan_EofCE3) #54 white_wins 8/8/6K1/2k4P/8/8/8/7r/b Kc5d6 (Adorjan_EofCE3) #55a black_wins 8/8/6K1/2k4P/8/8/8/7r/w Ph5h6 (Adorjan_EofCE3) #55b draw 8/8/8/2k2K1P/8/8/8/r7/w Ph5h6! (Adorjan_EofCE3) #56 draw 8/8/8/R7/7p/2K5/6k1/8/w Ra5g5+! (Adorjan_EofCE3) #57 white_wins 8/8/8/8/7p/8/3K2k1/R7/w Kd2e1 (Adorjan_EofCE3) #58 draw 8/6K1/R7/6k1/7p/8/8/8/w Ra6a5+ (Adorjan_EofCE3) #59 draw 8/8/8/7K/7P/8/2r5/1k6/b Rc2g2! (Adorjan_EofCE3) #60 black_wins 8/K7/8/pk6/8/8/8/R7/w Ra1b1+! (Adorjan_EofCE3) #61 white_wins 8/1K6/8/6kp/8/7R/8/8/w Kb7c6 (Adorjan_EofCE3) #62 draw 8/5K2/4R3/6kp/8/8/8/8/w Re6e5+ (Adorjan_EofCE3) #63 white_wins K7/R7/p7/1k6/8/8/8/8/w Ra7b7+! (Adorjan_EofCE3) #64 white_wins 6KR/8/pk6/8/8/8/8/8/b Kb6c5 (Adorjan_EofCE3) #65a draw 6KR/8/pk6/8/8/8/8/8/w Rh8h5 (Adorjan_EofCE3) #65b white_wins 1R6/7p/8/8/6k1/8/8/K7/b Ph7h5 (Adorjan_EofCE3) #66 white_wins 8/8/8/8/8/4p3/2Kpk3/R7/b Ke2f3 (Adorjan_EofCE3) #67a white_wins 8/8/8/8/8/4p3/2Kpk3/R7/w Ra1b1 (Adorjan_EofCE3) #67b white_wins 4R3/8/8/8/8/3p4/3kpK2/8/w Re8e7 (Adorjan_EofCE3) #68 draw 8/8/8/k1K5/3R4/4p3/3p4/8/w Rd4d6! (Adorjan_EofCE3) #69 white_wins 4R3/8/8/8/2K5/5p2/2k1p3/8/w Re8e3! (Adorjan_EofCE3) #70 draw 5R2/8/8/1K6/8/2k1p3/5p2/8/w Kb5c5! (Adorjan_EofCE3) #71 draw 2r5/2Pk4/1P6/8/2K5/8/8/8/w Kc4b5! (Adorjan_EofCE3) #72 draw 8/6P1/3K1P2/8/2k5/8/8/6r1/b Kc4d4 (Adorjan_EofCE3) #73 white_wins 8/6P1/4KP2/8/4k3/8/8/6r1/b Rg1g6! (Adorjan_EofCE3) #74a draw 8/6P1/4KP2/8/4k3/8/8/6r1/w Ke6d6! (Adorjan_EofCE3) #74b white_wins 8/5P2/8/4P3/8/7k/r7/6K1/b Ra2a8 (Adorjan_EofCE3) #75 white_wins 6r1/4P3/4K3/8/6k1/3P4/8/8/b Rg8a8 (Adorjan_EofCE3) #76 white_wins R7/8/8/8/6k1/5pp1/8/6K1/b Kg4f4 (Adorjan_EofCE3) #77 white_wins 8/8/8/3k4/8/5pp1/8/3KR3/w Re1f1! (Adorjan_EofCE3) #78 draw 8/8/8/7K/2k5/3pp3/8/5R2/w Kh5g4 (Adorjan_EofCE3) #79 draw 2R5/8/8/3K4/1k6/5pp1/8/8/w Rc8c4+! (Adorjan_EofCE3) #80 draw 5r2/8/3k1P2/6P1/5K2/8/8/8/w Pg5g6! (Adorjan_EofCE3) #81 draw 8/8/8/8/2p5/1p1k4/4R3/5K2/w Kf1e1 (Adorjan_EofCE3) #82 draw R7/8/8/3k1K2/1p6/2p5/8/8/b Pb4b3!?,Pc3c2? (Adorjan_EofCE3) #83 black_wins 8/3r4/5P2/6P1/2k1K3/8/8/8/b Rd7d4+!? (Adorjan_EofCE3) #84 draw 1R6/8/8/8/2pk2K1/1p6/8/8/b Kd4d3 (Adorjan_EofCE3) #85 draw 8/8/5KP1/5P2/8/2k4r/8/8/b Rh3f3!? (Adorjan_EofCE3) #86 draw 4k3/8/7K/8/6p1/2R2p2/8/8/w Rc3c8+!? (Adorjan_EofCE3) #87 draw 8/8/8/8/2p5/3pR3/K7/7k/b Pd3d2 (Adorjan_EofCE3) #88 black_wins 8/K1k5/R7/8/5p2/6p1/8/8/w Ra6g6 (Adorjan_EofCE3) #89 white_wins 8/K2k4/R7/8/5p2/6p1/8/8/w Ra6g6 (Adorjan_EofCE3) #90 draw 8/1r6/4P3/8/5P2/8/k2K4/8/b Ka2b3 (Adorjan_EofCE3) #91 draw 8/2r5/5P2/8/6P1/8/k6K/8/b Rc7c3 (Adorjan_EofCE3) #92 draw 1r6/8/1P6/8/1K1k4/8/2P5/8/w Kb4b5!? (Adorjan_EofCE3) #93 draw 4K3/8/8/8/1pp5/8/1k6/4R3/w Ke8d7 (Adorjan_EofCE3) #94 black_wins 4K3/8/8/8/1pp5/8/1k6/5R2/w Ke8d7 (Adorjan_EofCE3) #95 draw 4K3/8/8/8/1pp5/3k4/8/6R1/w Rg1g3+!? (Adorjan_EofCE3) #96 draw 8/8/8/4kPK1/6P1/8/8/2r5/w Kg5g6 (Adorjan_EofCE3) #97 black_wins 8/8/8/5P2/6P1/7K/3k4/5r2/w Pg4g5 (Adorjan_EofCE3) #98 black_wins 8/8/8/4rP2/4P3/5K2/8/4k3/w Kf3f4 (Adorjan_EofCE3) #99 white_wins 8/8/8/5rP1/5P2/6K1/8/5k2/w Kg3g4 (Adorjan_EofCE3) #100 draw 8/2R2K2/8/2p5/3pk3/8/8/8/b Pd4d3 (Adorjan_EofCE3) #101 draw 8/8/8/5P2/6P1/4K3/1k6/r7/w Pf5f6 (Adorjan_EofCE3) #102 draw 8/8/8/5P2/r5P1/4K3/1k6/8/w Pf5f6!? (Adorjan_EofCE3) #103 white_wins 8/8/8/1P6/2P3r1/8/1K5k/8/w Kb2c3 (Adorjan_EofCE3) #104 draw 8/8/8/5P2/8/6K1/3k2P1/4r3/w Kg3f4 (Adorjan_EofCE3) #105 black_wins 8/8/8/8/8/kpK5/p7/5R2/b Pb3b2 (Adorjan_EofCE3) #106 draw 6r1/1P6/P7/8/8/5k2/8/7K/w Pa6a7 (Adorjan_EofCE3) #107 draw 8/8/5K2/7k/8/p7/1p6/1R6/w Kf6f5 (Adorjan_EofCE3) #108 draw 8/P7/1P6/8/3k4/8/r7/2K5/b Kd4c3 (Adorjan_EofCE3) #109 draw 2R5/7k/5K2/8/p7/8/1p6/8/w Rc8c7+!? (Adorjan_EofCE3) #110 white_wins 6k1/4K3/3R4/8/p7/8/1p6/8/w Rd6g6+ (Adorjan_EofCE3) #111 white_wins 8/8/6PP/8/4k1K1/8/8/5r2/w Ph6h7!? (Adorjan_EofCE3) #112 white_wins 8/8/8/5R2/4K1k1/pp6/8/8/w Rf5f1!? (Adorjan_EofCE3) #113 draw 8/8/8/5K2/8/pp6/7k/5R2/w Kf5f4 (Adorjan_EofCE3) #114 draw 8/8/8/4R3/5K2/pp6/7k/8/w Re5e2+ (Adorjan_EofCE3) #115 white_wins 8/8/PP6/8/8/4k3/5r2/4K3/w Pb6b7 (Adorjan_EofCE3) #116 draw 4k3/8/PK6/1P6/8/r7/8/8/w Kb6a7!? (Adorjan_EofCE3) #117 white_wins 8/4k3/PK6/1P6/8/r7/8/8/w Kb6a7 (Adorjan_EofCE3) #118 draw 7R/8/8/2k5/p4K2/1p6/8/8/w Kf4e5!? (Adorjan_EofCE3) #119 draw 8/7r/7P/5KP1/2k5/8/8/8/b Kc4d4!? (Adorjan_EofCE3) #120 draw 8/7r/7P/6P1/2k5/5K2/8/8/w Kf3g4!? (Adorjan_EofCE3) #121 white_wins 8/3r4/6P1/8/7P/8/k4K2/8/b Rd7d2+ (Adorjan_EofCE3) #122 white_wins 8/4r3/7P/8/6P1/8/k4K2/8/b Re7f7+!? (Adorjan_EofCE3) #123 draw 8/6p1/8/8/8/7p/4K1k1/5R2/w Rf1f2+!? (Adorjan_EofCE3) #124 white_wins 8/8/P7/1K6/8/1P6/5kr1/8/w Pa6a7 (Adorjan_EofCE3) #125 draw 8/8/8/3K3R/pp6/2k5/8/8/w Rh5h3+ (Adorjan_EofCE3) #126 draw 8/2R5/6k1/1K6/6pp/8/8/8/w Rc7c8!? (Adorjan_EofCE3) #127 draw 6R1/7K/8/k7/pp6/8/8/8/w Kh7g6 (Adorjan_EofCE3) #128 draw 8/8/8/6PP/7K/8/1k6/r7/w Kh4g4 (Adorjan_EofCE3) #129 draw 8/8/8/PK6/1P6/8/7k/r7/w Kb5a6!? (Adorjan_EofCE3) #130 white_wins 7r/8/8/7P/5KP1/8/8/k7/w Kf4g5 (Adorjan_EofCE3) #131 draw 8/7R/1k6/1p4K1/p7/8/8/8/b Pb5b4 (Adorjan_EofCE3) #132 black_wins 8/K5p1/8/8/7p/7k/8/6R1/w Rg1g5!? (Adorjan_EofCE3) #133 white_wins 8/1p6/1k2K3/8/p7/8/8/2R5/b Kb6a5 (Adorjan_EofCE3) #134 white_wins 8/1K5p/7k/6p1/8/5R2/8/8/b Pg5g4 (Adorjan_EofCE3) #135 draw 7K/6p1/8/7p/8/8/R7/6k1/w Kh8h7!? (Adorjan_EofCE3) #136 white_wins 5R2/8/8/8/8/8/2p1p3/2K1k3/w Rf8h8 (Adorjan_EofCE3) #137 white_wins 1R6/8/8/8/8/8/2p1p3/2k1K3/w Rb8c8 (Adorjan_EofCE3) #138 draw 8/8/8/8/8/3k4/1Kp1p3/6R1/w Kb2c1 (Adorjan_EofCE3) #139 white_wins K7/4k3/8/8/8/8/1p1p4/7R/w Ka8b7 (Adorjan_EofCE3) #140 white_wins 8/4k1K1/8/8/8/8/p1p5/R7/b Ke7e6 (Adorjan_EofCE3) #141 draw 8/8/8/5K2/8/5k2/p1p5/R7/w Kf5e5 (Adorjan_EofCE3) #142 draw 6k1/8/7K/8/8/8/p1p5/R7/b Kg8f7 (Adorjan_EofCE3) #143 draw 4r2k/P1P5/8/8/8/5K2/8/8/w Kf3f4 (Adorjan_EofCE3) #144 draw 8/1k2P1K1/6P1/8/8/8/5r2/8/b Rf2e2 (Adorjan_EofCE3) #145 draw 6r1/1P6/8/2KP4/k7/8/8/8/w Kc5b6!? (Adorjan_EofCE3) #146 white_wins 1K6/1P6/8/3P4/8/8/5k2/3r4/w Pd5d6!? (Adorjan_EofCE3) #147 white_wins 1K6/1P6/8/3P4/8/5k2/8/3r4/w Pd5d6 (Adorjan_EofCE3) #148 draw 8/R7/8/8/p4K2/8/2p5/2k5/b Pa4a3 (Adorjan_EofCE3) #149 draw 8/8/4P1PK/5k2/5r2/8/8/8/w Pe6e7 (Adorjan_EofCE3) #150 draw 8/8/2K5/8/4k3/5p1p/8/6R1/w Rg1f1 (Adorjan_EofCE3) #151 black_wins 8/8/8/8/8/1p1p3K/7R/6k1/b Kg1f1 (Adorjan_EofCE3) #152 draw 3K4/8/2P5/P7/8/6k1/8/4r3/w Pa5a6 (Adorjan_EofCE3) #153 white_wins 8/3K1k2/3Pr3/8/5P2/8/8/8/w Kd7c7 (Adorjan_EofCE3) #154 black_wins 8/1K1k4/1P6/8/3P4/2r5/8/8/w Kb7a7 (Adorjan_EofCE3) #155 black_wins 8/8/pK6/3k4/8/2p5/8/7R/w Kb6a5 (Adorjan_EofCE3) #156 draw 8/3R4/8/8/2p1p3/8/2k5/6K1/w Kg1f2 (Adorjan_EofCE3) #157 draw 8/2R5/8/8/1p1p4/8/1k6/5K2/w Kf1e2 (Adorjan_EofCE3) #158 white_wins 4R3/8/8/4Kp2/6kp/8/8/8/w Ke5d4!? (Adorjan_EofCE3) #159 white_wins 8/6R1/8/2K1kp2/7p/8/8/8/w Kc5c4!? (Adorjan_EofCE3) #160 white_wins 7R/7p/1K1k4/8/5p2/8/8/8/w Rh8f8!? (Adorjan_EofCE3) #161 white_wins 2R5/8/1K6/5pkp/8/8/8/8/b Kg5f4 (Adorjan_EofCE3) #162 white_wins 1K6/2R5/p1p5/8/1k6/8/8/8/w Rc7b7+!? (Adorjan_EofCE3) #163 white_wins 7R/1K6/5p1p/8/6k1/8/8/8/b Ph6h5 (Adorjan_EofCE3) #164 white_wins 8/8/8/8/8/2KP4/5P1r/1k6/w Pf2f3 (Adorjan_EofCE3) #165 black_wins 3k4/2r5/2PK1P2/8/8/8/8/8/w Kd6d5!? (Adorjan_EofCE3) #166 draw K2R4/8/8/8/8/p2p4/3k4/8/w Rd8d4!? (Adorjan_EofCE3) #167 draw 8/8/R7/8/7p/4pk2/8/6K1/b Ph4h3!? (Adorjan_EofCE3) #168 draw 4k1r1/8/4K3/8/2P2P2/8/8/8/b Rg8g1 (Adorjan_EofCE3) #169a black_wins 4k1r1/8/4K3/8/2P2P2/8/8/8/w Pf4f5 (Adorjan_EofCE3) #169b draw 8/8/8/1RKp2p1/4k3/8/8/8/w Rb5b4+ (Adorjan_EofCE3) #170 white_wins 8/8/8/8/4k3/8/2p1K1p1/2R5/b Ke4d4 (Adorjan_EofCE3) #171 white_wins 5r2/1P3P2/2K5/8/7k/8/8/8/b Kh4g5 (Adorjan_EofCE3) #172a draw 5r2/1P3P2/2K5/8/7k/8/8/8/w Kc6d6!? (Adorjan_EofCE3) #172b white_wins 7r/5P2/8/8/1PK5/8/1k6/8/b Rh8d8 (Adorjan_EofCE3) #173 draw 1R6/7K/8/8/2k5/1p3p2/8/8/w Rb8c8+!? (Adorjan_EofCE3) #174 draw 5K2/p7/8/8/8/k3p3/8/6R1/w Rg1b1!? (Adorjan_EofCE3) #175 white_wins 8/8/8/8/1K6/P7/k1r1P3/8/w Pa3a4 (Adorjan_EofCE3) #176 draw 6r1/1P4P1/8/2K5/8/8/8/3k4/w Kc5d6 (Adorjan_EofCE3) #177 draw 6R1/8/8/8/1k1K4/8/1p4p1/8/w Kd4d5!? (Adorjan_EofCE3) #178 draw 8/7K/8/p3R3/8/3k1p2/8/8/b Pf3f2 (Adorjan_EofCE3) #179 draw 8/8/8/8/2P2K1P/2k5/8/r7/w Ph4h5 (Adorjan_EofCE3) #180 black_wins 8/8/8/8/1k6/1p1K4/7p/5R2/w Rf1h1 (Adorjan_EofCE3) #181 white_wins 3R4/8/6p1/8/1k6/p3K3/8/8/w Ke3d3!? (Adorjan_EofCE3) #182 white_wins 1K6/8/R5pk/8/8/p7/8/8/b Kh6g5 (Adorjan_EofCE3) #183 white_wins 8/8/2r5/5K2/1P5P/4k3/8/8/b Ke3d4 (Adorjan_EofCE3) #184 black_wins 3R4/8/8/8/3K4/p6p/4k3/8/w Kd4e4!? (Adorjan_EofCE3) #185 white_wins 5KR1/p7/8/8/8/7p/8/7k/w Kf8e7 (Adorjan_EofCE3) #186 white_wins 6k1/3KP3/4P3/8/8/8/6r1/8/b Rg2d2+ (Adorjan_EofCE3) #187 white_wins 8/5R2/8/8/8/2kp4/3p1K2/8/w Rf7c7+ (Adorjan_EofCE3) #188 draw 8/5R2/8/8/8/2kp4/3p3K/8/w Rf7c7+ (Adorjan_EofCE3) #189 draw 8/5R2/8/8/8/2kp3K/3p4/8/w Rf7c7+ (Adorjan_EofCE3) #190 black_wins 8/5R2/8/8/8/1kp5/2p4K/8/w Rf7b7+ (Adorjan_EofCE3) #191 black_wins 8/8/3R4/8/5K2/7p/7p/6k1/w Rd6d1+!? (Adorjan_EofCE3) #192 white_wins 8/8/8/8/3p4/4k3/3p4/R4K2/b Ke3d3!? (Adorjan_EofCE3) #193a draw 8/8/8/8/3p4/4k3/3p4/R4K2/w Ra1a3+!? (Adorjan_EofCE3) #193b white_wins 5r2/3P4/k1K5/3P4/8/8/8/8/b Ka6a5!? (Adorjan_EofCE3) #194a draw 5r2/3P4/k1K5/3P4/8/8/8/8/w Pd5d6!? (Adorjan_EofCE3) #194b white_wins 8/P6K/8/1k4r1/8/8/P7/8/b Rg5h5+ (Adorjan_EofCE3) #195 white_wins 8/8/8/6p1/8/4K1p1/1R6/5k2/b Pg5g4 (Adorjan_EofCE3) #196 white_wins 8/8/3KPr2/8/4P3/8/8/1k6/w Kd6d7!? (Adorjan_EofCE3) #197 white_wins K6R/p7/8/8/p7/8/k7/8/w Rh8b8 (Adorjan_EofCE3) #198 white_wins 8/1R6/6p1/6p1/K5k1/8/8/8/w Ka4b3 (Adorjan_EofCE3) #199 white_wins K7/8/6kp/1R5p/8/8/8/8/b Ph5h4 (Adorjan_EofCE3) #200 draw 1k6/8/2K5/8/8/6p1/5p1p/R7/w Ra1b1+ (Adorjan_EofCE3) #201 black_wins 4R3/8/8/8/8/4ppk1/3p4/3K4/b Pf3f2 (Adorjan_EofCE3) #202 draw 4R3/8/8/2K5/k7/3pp3/5p2/8/w Kc5c4 (Adorjan_EofCE3) #203 draw 8/8/8/8/3pk3/4p3/4Kp2/3R4/b Pd4d3+ (Adorjan_EofCE3) #204a black_wins 8/8/8/8/3pk3/4p3/4Kp2/3R4/w Rd1h1!? (Adorjan_EofCE3) #204b draw 8/8/8/8/4pk2/5p2/5Kp1/4R3/b Pe4e3+ (Adorjan_EofCE3) #205a black_wins 8/8/8/8/4pk2/5p2/5Kp1/4R3/w Kf2g1 (Adorjan_EofCE3) #205b black_wins 8/8/8/8/5pk1/6p1/6Kp/5R2/b Pf4f3+ (Adorjan_EofCE3) #206a black_wins 8/8/8/8/5pk1/6p1/6Kp/5R2/w Kg2h1!? (Adorjan_EofCE3) #206b draw 8/8/8/1k6/2p5/1pR5/pK6/8/b Kb5b4 (Adorjan_EofCE3) #207 black_wins 8/8/8/8/2p5/kpK5/p7/7R/b Pb3b2 (Adorjan_EofCE3) #208 draw 6R1/8/8/8/4p3/5p1k/5Kp1/8/b Kh3h4 (Adorjan_EofCE3) #209a white_wins 6R1/8/8/8/4p3/5p1k/5Kp1/8/w Rg8e8 (Adorjan_EofCE3) #209b white_wins 6k1/6P1/5P2/4P3/K7/7r/8/8/w Pe5e6 (Adorjan_EofCE3) #210 draw 4r3/7P/5kPK/8/8/8/5P2/8/b Re8a8 (Adorjan_EofCE3) #211a draw 4r3/7P/5kPK/8/8/8/5P2/8/w Pg6g7 (Adorjan_EofCE3) #211b white_wins 3k4/7p/4K3/8/8/6p1/5p2/1R6/w Ke6d6 (Adorjan_EofCE3) loses; the reply is Kc8. No good move for white. #212 draw 8/8/8/8/6p1/4kp1p/8/5K1R/w Kf1e1!? (Adorjan_EofCE3) #213 draw 8/8/8/8/6p1/5pkp/1R6/6K1/w Rb2b8 (Adorjan_EofCE3) #214 draw 3r4/8/3PK1k1/4P3/5P2/8/8/8/b Rd8e8+ (Adorjan_EofCE3) #215a draw 3r4/8/3PK1k1/4P3/5P2/8/8/8/w Pd6d7 (Adorjan_EofCE3) #215b white_wins 2r5/8/2PK1k2/3P4/4P3/8/8/8/b Rc8d8+ (Adorjan_EofCE3) #216 white_wins 1r6/8/1PK1k3/2P5/3P4/8/8/8/b Rb8c8+ (Adorjan_EofCE3) #217a white_wins 1r6/8/1PK1k3/2P5/3P4/8/8/8/w Kc6c7 (Adorjan_EofCE3) #217b white_wins r7/8/PK1k4/1P6/2P5/8/8/8/b Ra8b8+!? (Adorjan_EofCE3) #218a draw r7/8/PK1k4/1P6/2P5/8/8/8/w Pa6a7 (Adorjan_EofCE3) #218b white_wins 8/8/8/5pk1/6p1/6Kp/8/5R2/w Rf1f2 (Adorjan_EofCE3) #219 draw R7/8/6k1/7p/6p1/5p2/5K2/8/w Ra8h8 (Adorjan_EofCE3) #220 white_wins 4R3/8/5k2/4p3/4Kp2/6p1/8/8/b Kf6g6 (Adorjan_EofCE3) #221a white_wins 4R3/8/5k2/4p3/4Kp2/6p1/8/8/w Ke4f3 (Adorjan_EofCE3) #221b white_wins 5R2/8/6k1/5p2/5Kp1/7p/8/8/b Kg6h6 (Adorjan_EofCE3) #222a white_wins 5R2/8/6k1/5p2/5Kp1/7p/8/8/w Kf4g3!? (Adorjan_EofCE3) #222b white_wins 4R3/8/5k2/3p4/4p3/2K2p2/8/8/b Kf6f5 (Adorjan_EofCE3) #223a white_wins 4R3/8/5k2/3p4/4p3/2K2p2/8/8/w Kc3d2!? (Adorjan_EofCE3) #223b white_wins 6R1/8/7k/5p2/6p1/4K2p/8/8/b Kh6h5 (Adorjan_EofCE3) #224a white_wins 6R1/8/7k/5p2/6p1/4K2p/8/8/w Ke3e2!? (Adorjan_EofCE3) #224b white_wins 6R1/8/8/7k/5ppp/8/5K2/8/b Ph4h3 (Adorjan_EofCE3) #225a white_wins 6R1/8/8/7k/5ppp/8/5K2/8/w Rg8f8 (Adorjan_EofCE3) #225b white_wins k7/8/8/8/5ppp/8/K7/2R5/w Ka2b3 (Adorjan_EofCE3) #226 black_wins k7/8/8/8/5ppp/8/K7/1R6/w Ka2b3 (Adorjan_EofCE3) #227 draw 5R2/4K1k1/8/8/ppp5/8/8/8/b Pa4a3 (Adorjan_EofCE3) #228a draw 5R2/4K1k1/8/8/ppp5/8/8/8/w Rf8f1 (Adorjan_EofCE3) #228b white_wins 8/8/6k1/5p1p/6p1/8/R5K1/8/b Ph5h4 (Adorjan_EofCE3) #229a draw 8/8/6k1/5p1p/6p1/8/R5K1/8/w Ra2a8 (Adorjan_EofCE3) #229b white_wins 8/3r4/8/3PK1k1/4P3/5P2/8/8/w Ke5e6 (Adorjan_EofCE3) #230 draw 8/8/2p5/3p4/1K1kp3/8/8/4R3/b Pe4e3 (Adorjan_EofCE3) #231a draw 8/8/2p5/3p4/1K1kp3/8/8/4R3/w Re1d1+ (Adorjan_EofCE3) #231b white_wins 8/2r5/8/2PK1k2/3P4/4P3/8/8/w Kd5d6 (Adorjan_EofCE3) #232 white_wins 8/8/3p4/4p3/2K1kp2/8/8/5R2/w Rf1e1+ (Adorjan_EofCE3) #233 draw 8/8/3p4/4pk2/5p2/3K4/8/4R3/b Pd6d5 (Adorjan_EofCE3) #234 white_wins 8/8/4p3/5pk1/6p1/4K3/8/5R2/b Pe6e5!? (Adorjan_EofCE3) #235a draw 8/8/4p3/5pk1/6p1/4K3/8/5R2/w Rf1a1 (Adorjan_EofCE3) #235b white_wins 8/8/5pk1/6p1/6Kp/8/8/5R2/w Rf1f3 (Adorjan_EofCE3) #236 white_wins 8/8/8/6P1/4KP2/2k1P3/8/1r6/w Pg5g6 (Adorjan_EofCE3) #237 white_wins 8/8/8/3P4/2P5/2K1k3/1P6/5r2/b Ke3e4 (Adorjan_EofCE3) #238 black_wins 8/R7/5k2/2K2ppp/8/8/8/8/w Kc5d4 (Adorjan_EofCE3) #239 white_wins 8/8/8/1K6/1PP5/P4k2/8/6r1/w Pc4c5 (Adorjan_EofCE3) #240 draw R7/8/6p1/2K2pkp/8/8/8/8/b Ph5h4 (Adorjan_EofCE3) #241 draw 1r6/8/8/8/1PK1k3/2P5/3P4/8/b Rb8c8+ (Adorjan_EofCE3) #242a black_wins 1r6/8/8/8/1PK1k3/2P5/3P4/8/w Kc4c5 (Adorjan_EofCE3) #242b black_wins 8/p7/1p4R1/2p5/1k6/3K4/8/8/w Rg6g1 (Adorjan_EofCE3) b5 #243 white_wins 3R4/8/8/4k3/5p2/6p1/4Kp2/8/b Ke5e4 (Adorjan_EofCE3) #244a draw 3R4/8/8/4k3/5p2/6p1/4Kp2/8/w Ke2f1 (Adorjan_EofCE3) #244b draw k1K5/2R5/6p1/8/8/6pp/8/8/b Pg3g2 (Adorjan_EofCE3) #245 black_wins 3R4/8/4k3/5p2/6p1/4Kp2/8/8/b Ke6e5 (Adorjan_EofCE3) #246 white_wins 8/6p1/8/8/7p/5Kp1/R7/6k1/w Kf3g4 (Adorjan_EofCE3) #247 draw 8/6p1/8/6p1/4K2p/7k/5R2/8/w Rf2d2!? (Adorjan_EofCE3) #248 white_wins 8/8/8/2k5/1p1pp3/7R/4K3/8/w Rh3h8 (Adorjan_EofCE3) #249 draw 8/8/3K4/4P1r1/8/3P2k1/6P1/8/w Pe5e6!? (Adorjan_EofCE3) #250 white_wins 2R5/8/8/8/1p3p2/1kpK4/8/8/w Rc8h8 (Adorjan_EofCE3) #251 draw 2R5/8/8/8/1p4p1/1kpK4/8/8/w Rc8e8!? (Adorjan_EofCE3) #252 white_wins 3R4/8/8/1pk5/5pp1/8/8/1K6/w Rd8f8!? (Adorjan_EofCE3) #253 white_wins 3R3K/8/8/1pk5/5pp1/8/8/8/w Rd8g8!? (Adorjan_EofCE3) #254 draw 8/8/8/5P2/6PK/2r5/P3k3/8/w Pf5f6 (Adorjan_EofCE3) #255 draw r7/7P/5kPK/8/8/8/P7/8/b Kf6f5 (Adorjan_EofCE3) #256 white_wins 8/8/P6P/r1k4K/8/8/1P6/8/w Ph6h7 (Adorjan_EofCE3) #257 white_wins 6r1/8/P7/1P6/8/k7/7P/2K5/w Pb5b6!? (Adorjan_EofCE3) #258 white_wins 8/8/8/5k2/8/8/2p1p1p1/2R3K1/w Kg1f2!? (Adorjan_EofCE3) #259 white_wins 8/8/8/k7/6R1/1p6/4p1p1/4K3/w Rg4g5+!? (Adorjan_EofCE3) #260 draw 1r6/2k2P2/8/8/P1P4K/8/8/8/w Kh4g5 (Adorjan_EofCE3) Kd7 #261 black_wins 8/8/8/1R6/3p2pK/1p1k4/8/8/b Kd3c4 (Adorjan_EofCE3) #262 draw 8/8/8/7R/3p2p1/1p4K1/8/1k6/b Pd4d3 (Adorjan_EofCE3) #263 black_wins 8/8/8/7R/3p2p1/1p4K1/1k6/8/b Pd4d3 (Adorjan_EofCE3) #264 draw 8/8/2k5/8/1K6/8/p1p3p1/2R5/w Kb4c4!? (Adorjan_EofCE3) #265 white_wins 8/8/8/1R6/3p2Kp/1p1k4/8/8/b Kd3c4 (Adorjan_EofCE3) #266 black_wins 1k6/8/K7/8/8/8/p1p4p/2R5/w Ka6b6!? (Adorjan_EofCE3) #267 white_wins 2R5/8/8/p4p1p/8/3K1k2/8/8/w Kd3d2 (Adorjan_EofCE3) #268 white_wins 7R/8/3pK1p1/8/p7/8/2k5/8/w Ke6d5!? (Adorjan_EofCE3) #269 white_wins 8/pKR5/8/p7/8/8/2p5/2k5/w Kb7b8!? (Adorjan_EofCE3) #270 draw 1R6/8/K4p2/5p1p/5k2/8/8/8/w Ka6b5 (Adorjan_EofCE3) #271 draw 8/R4p2/3K3p/5p2/6k1/8/8/8/b Ph6h5 (Adorjan_EofCE3) #272 draw 8/1K6/8/8/p5p1/6p1/R7/3k4/b Pa4a3!? (Adorjan_EofCE3) #275a draw 8/1K6/8/8/p5p1/6p1/R7/3k4/w Kb7c6!? (Adorjan_EofCE3) #275b white_wins 3r4/P7/P3k2P/6K1/8/8/8/8/w Pa7a8=Q!? (Adorjan_EofCE3) #276 draw 8/8/8/8/6p1/2k2pK1/4p2p/R7/w Kg3f2!? (Adorjan_EofCE3) #277 draw 5R2/8/8/2p5/3p4/4p1k1/4Kp2/8/w Rf8d8 (Adorjan_EofCE3) #278 black_wins 6R1/8/8/3p4/4p3/5p1k/5Kp1/8/b Pd5d4 (Adorjan_EofCE3) #279 draw 8/2k5/8/3P4/PPPK4/7r/8/8/w Kd4c5 (Adorjan_EofCE3) Rh8 #280 white_wins 8/8/5K2/8/4PP2/2k5/6PP/r7/b Ra1a6+!? (Adorjan_EofCE3) #281 draw 7R/8/8/8/5pkp/6p1/5pK1/8/b Ph4h3+ (Adorjan_EofCE3) #282 draw 8/1p1K2k1/1R6/2p5/6pp/8/8/8/w Kd7e6 (Adorjan_EofCE3) #283 black_wins 8/8/8/2R4p/3p2p1/1p4K1/1k6/8/w Rc5xPh5!?,Rc5d5? (Adorjan_EofCE3) #284 draw 4R3/8/8/1p6/1p6/1K2p3/7p/3k4/w Re8d8+ (Adorjan_EofCE3) #285 draw 8/k3p1R1/2K5/2p5/3p4/4p3/5p2/8/w Rg7f7!? (Adorjan_EofCE3) #286 draw 8/R7/8/p7/4K2k/1p1pp3/6p1/8/w Ke4f4 (Adorjan_EofCE3) #287 draw 7K/8/8/8/3p4/1R1P4/3k4/8/b Kd2c2 (Adorjan_EofCE3) #288 draw K7/8/R7/8/3p4/3P4/1k6/8/b Kb2c3 (Adorjan_EofCE3) #289 white_wins K5R1/8/8/8/8/8/pP5k/8/w Rg8h8+ (Adorjan_EofCE3) #290 draw 8/1P2k3/1Kp5/6r1/8/8/8/8/b Ke7d7 (Adorjan_EofCE3) #291 draw 8/K4k2/1Pp4r/8/8/8/8/8/w Pb6b7 (Adorjan_EofCE3) #292 draw R7/8/2K5/8/4k1pp/8/7P/8/b Ke4f3 (Adorjan_EofCE3) #293 white_wins K7/8/8/5pp1/5k2/R7/6P1/8/b Kf4e4 (Adorjan_EofCE3) #294 white_wins 8/6K1/8/pp6/8/kP2R3/8/8/b Ka3b4!? (Adorjan_EofCE3) #295 draw 1K6/8/5p2/5P2/R5pk/8/8/8/w Ra4f4!? (Adorjan_EofCE3) #296 white_wins 4K3/4P1p1/k5P1/8/8/8/3r4/8/b Ka6b7!? (Adorjan_EofCE3) #297 draw 8/8/8/7R/K3k3/4p1p1/6P1/8/w Ka4b4!? (Adorjan_EofCE3) #298 white_wins 1R6/7p/8/2K5/5p2/4k3/7P/8/b Pf4f3 (Adorjan_EofCE3) #299 draw 4r3/8/1P6/3Kp3/8/3P4/5k2/8/w Kd5e4 (Adorjan_EofCE3) #300 black_wins 8/p7/8/1P6/8/3K4/p3R3/1k6/w Re2e1+ (Adorjan_EofCE3) #301 white_wins 8/8/8/8/3p2K1/2p5/6Pk/3R4/b Pc3c2 (Adorjan_EofCE3) #302 draw R7/8/8/5K2/1k6/pp6/6P1/8/w Pg2g4 (Adorjan_EofCE3) #303 black_wins 6R1/8/8/K4p2/P7/5kp1/8/8/b Pf5f4 (Adorjan_EofCE3) #304 white_wins 8/2K5/4k3/8/4P3/5p1p/8/6R1/b Ke6e5!? (Adorjan_EofCE3) #305 black_wins 8/8/Pp1k3P/6K1/8/8/8/3r4/w Ph6h7!? (Adorjan_EofCE3) #306 draw 7K/7P/7P/8/p7/8/8/r6k/w Kh8g7 (Adorjan_EofCE3) #307 white_wins 4k3/7R/p6P/8/8/8/p5K1/8/w Rh7b7!? (Adorjan_EofCE3) #308 white_wins 8/2p3K1/7P/8/8/7P/2r5/5k2/w Ph6h7 (Adorjan_EofCE3) #309 white_wins 8/6K1/8/1p2R3/p7/1p6/1P6/5k2/b Pb5b4 (Adorjan_EofCE3) #310 draw 8/8/8/8/5pp1/3K1k1p/4R2P/8/w Kd3d2 (Adorjan_EofCE3) #311 black_wins 8/K7/6p1/1R3pk1/7p/7P/8/8/w Rb5b4!? (Adorjan_EofCE3) #312 white_wins 8/8/7p/8/5PP1/8/rk3K1P/8/w Kf2e3 (Adorjan_EofCE3) #313 black_wins 8/8/4p3/4p3/4P3/4Rpk1/2K5/8/w Re3d3!? (Adorjan_EofCE3) #314 draw 8/8/6p1/7p/7P/8/pk1K4/2R5/w Rc1a1!? (Adorjan_EofCE3) #315 white_wins 8/8/3P4/2p5/3r4/1PK5/1P6/4k3/w Pb3b4!? (Adorjan_EofCE3) #316 draw 8/1K6/3R4/4p1p1/6P1/5p2/7k/8/w Kb7c6 (Adorjan_EofCE3) #317 draw 8/8/8/5r1p/5P2/5KP1/4P3/5k2/w Pe2e4 (Adorjan_EofCE3) #318 black_wins 2R5/1p6/8/1Pp5/7K/1p6/8/k7/w Pb5b6!? (Adorjan_EofCE3) #319 draw 3k1r2/3p4/4P1P1/3PK3/8/8/8/8/w Pe6e7+!? (Adorjan_EofCE3) #320 white_wins 4k1r1/4p3/5P1P/4PK2/8/8/8/8/w Pf6f7+ (Adorjan_EofCE3) #321 draw 8/8/5K1k/7p/4p2P/8/5p2/R7/w Kf6e5!? (Adorjan_EofCE3) #322 draw 8/8/1K3k2/p7/P4p2/6p1/8/6R1/w Kb6c5 (Adorjan_EofCE3) #323 draw 8/p7/7P/4K1P1/P4r2/4k3/8/8/w Ph6h7 (Adorjan_EofCE3) #324 draw 8/3p4/8/2P5/8/2pK4/p6R/1k6/w Pc5c6!? (Adorjan_EofCE3) #325 white_wins r7/P4P1p/2k1K3/8/8/8/7P/8/w Ke6e7!? (Adorjan_EofCE3) #326 draw 8/2p1K3/8/p7/Pkp5/8/8/4R3/w Re1a1!? (Adorjan_EofCE3) #327 white_wins 4R3/2p2K2/8/p2k4/P1p5/8/8/8/b Pc4c3 (Adorjan_EofCE3) #328 draw 8/8/8/4k3/6R1/4pp2/2Pp4/3K4/w Rg4h4 (Adorjan_EofCE3) #329 draw 8/k7/P2R4/8/8/2p5/1pKp4/8/b Ka7b8 (Adorjan_EofCE3) #330a white_wins 8/k7/P2R4/8/8/2p5/1pKp4/8/w Kc2b1 (Adorjan_EofCE3) #330b white_wins 8/5k2/1R3P2/8/8/2p5/1pKp4/8/b Kf7g6!? (Adorjan_EofCE3) #331 draw 8/6k1/1R4P1/8/8/2p5/1pKp4/8/w Rb6b8 (Adorjan_EofCE3) #332 white_wins 8/8/8/4p3/1P3p2/5Rp1/8/5K1k/w Rf3f2!? (Adorjan_EofCE3) #333 white_wins 8/8/8/4k3/2ppp3/6RP/4K3/8/w Rg3g5+ (Adorjan_EofCE3) Kf4 #334 white_wins 8/8/6PP/5p2/2P5/5k2/4r3/5K2/w Pg6g7!? (Adorjan_EofCE3) #335 white_wins 3R4/8/2K5/k6p/6p1/pP6/8/8/b Ka5b4 (Adorjan_EofCE3) #336 draw 2R5/8/3p4/2p1pK2/1k2P3/1p6/8/8/w Kf5e6 (Adorjan_EofCE3) #337 white_wins 4R3/7p/6p1/6K1/5p2/8/2p4P/2k5/b Pf4f3 (Adorjan_EofCE3) #338 black_wins 8/8/8/8/3p1pp1/5k1p/3KR2P/8/w Kd2e1!? (Adorjan_EofCE3) #339 draw 8/8/8/pp5R/k6p/2K5/1P4p1/8/w Rh5g5!? (Adorjan_EofCE3) #340 white_wins 8/8/7R/2k1pp2/3p4/2p5/4K1P1/8/w Ke2d3 (Adorjan_EofCE3) #341 draw 8/1R6/p7/3k4/P1p1p3/3p4/5K2/8/w Rb7d7+ (Adorjan_EofCE3) #342 draw 5k2/p4P1P/6Pr/P7/8/1K6/8/8/w Pa5a6!? (Adorjan_EofCE3) #343 white_wins 6k1/8/8/1K4p1/3p2P1/2pp4/8/1R6/w Kb5c6 (Adorjan_EofCE3) #344 draw 8/4p3/1p2K3/2p5/5p2/2R5/P5k1/8/w Rc3c2+ (Adorjan_EofCE3) #345 draw 8/8/2p4k/2K5/5p2/p3R1p1/P7/8/w Re3e1!? (Adorjan_EofCE3) #346 draw 8/7k/1p6/1P2p2K/8/1R2p3/2p5/8/w Rb3c3 (Adorjan_EofCE3) #347 draw 8/3K2k1/3pR1P1/8/ppp5/8/8/8/w Re6e1 (Adorjan_EofCE3) #348 white_wins 8/8/4rk2/1P3p2/3K4/5PP1/P5P1/8/b Kf6e7 (Adorjan_EofCE3) #349 black_wins 8/1k1K4/8/1p4p1/1p3p2/1P2p3/8/4R3/w Re1c1!? (Adorjan_EofCE3) #350 draw 8/8/3PR3/8/1k3p2/5P2/3p2K1/8/w Re6e4+ (Adorjan_EofCE3) #351 white_wins 8/7p/5Kp1/6P1/1r3P2/1k4P1/8/8/w Kf6g7 (Adorjan_EofCE3) #352 black_wins R7/1K6/7p/5p2/4p3/4k3/6PP/8/b Ke3f2 (Adorjan_EofCE3) #353 white_wins K7/1R6/8/6p1/4pkPp/7P/8/8/w Rb7b4 (Adorjan_EofCE3) #354 white_wins 8/K7/1p6/k7/p3P3/P1R5/1p6/8/w Rc3g3!? (Adorjan_EofCE3) #355 white_wins 8/3K2p1/1k6/8/pp5P/4R1P1/8/8/w Kd7d6 (Adorjan_EofCE3) #356 draw 8/7k/4K3/4P2p/3p4/8/2p4P/6R1/w Ke6f6!? (Adorjan_EofCE3) #357 white_wins 1K6/7p/4k1p1/4pp2/R6P/6P1/8/8/b Pe5e4 (Adorjan_EofCE3) #358 white_wins 8/p1K5/P4k2/7p/6p1/5p2/7P/4R3/b Ph5h4 (Adorjan_EofCE3) #359 white_wins 8/1k6/4K3/1p6/7p/PpR3p1/1P6/8/w Ke6d7!? (Adorjan_EofCE3) #360 draw r7/ppK2P1P/8/2P5/3k4/8/P7/8/w Kc7d7!? (Adorjan_EofCE3) #361 white_wins 8/1p6/7p/5p1P/5P2/1p6/6RK/k7/w Rg2g5!? (Adorjan_EofCE3) #362 white_wins 6k1/6p1/7p/1P2r3/P7/8/2P2PK1/8/w Pb5b6 (Adorjan_EofCE3) #363 draw 8/8/P1k5/6p1/1p4Pp/5R1K/2p5/8/w Rf3f6+!? (Adorjan_EofCE3) #364 draw 8/1k1K4/8/1p5p/6p1/Pp3p2/1P6/5R2/b Ph5h4 (Adorjan_EofCE3) #365a black_wins 8/1k1K4/8/1p5p/6p1/Pp3p2/1P6/5R2/w Rf1c1 (Adorjan_EofCE3) #365b draw 8/1k1K4/8/7p/Pp4p1/1p3p2/1P6/5R2/b Pg4g3 (Adorjan_EofCE3) #366 draw 5R2/7p/2k5/6p1/5p2/4p2P/2PpK3/8/w Ke2d1 (Adorjan_EofCE3) #367 draw 8/1kp3p1/6P1/3p4/pp5P/2pKR3/8/8/b Pc7c5!? (Adorjan_EofCE3) #368 draw 6r1/p1P2p2/3P3p/8/P7/5k2/8/7K/b Kf3f2!? (Adorjan_EofCE3) #369 black_wins K1k5/2r3pp/P4p2/1P6/8/5P1P/8/8/b Rc7c6!? (Adorjan_EofCE3) #370 black_wins 8/5k2/1R3P2/7p/7P/2p4P/1pKp4/8/b Kf7g6!? (Adorjan_EofCE3) #371 draw 8/p5R1/8/3p4/3K3p/1P3Pp1/P5k1/8/w Kd4e3 (Adorjan_EofCE3) #372 black_wins 1K6/8/k2p4/p7/P1p3p1/5p2/2PP4/1R6/w Pc2c3!? (Adorjan_EofCE3) #373 white_wins 3R4/p4k2/8/4p1p1/2P2p2/1P3p1K/P7/8/b Pe5e4 (Adorjan_EofCE3) #374 draw 8/5ppp/1p6/p1p2P2/R7/3k4/5KPP/8/w Kf2e1 (Adorjan_EofCE3) #375 white_wins 1r6/3k1p2/5P2/2P1P3/p1KP2p1/2P3P1/8/8/w Pd4d5 (Adorjan_EofCE3) #376 black_wins 5k2/1p4pP/p7/1p1p4/6K1/2r5/6PP/8/b Rc3c4+ (Adorjan_EofCE3) #377 black_wins r7/8/5p1K/p4p1P/6pk/5Pp1/P5P1/8/w Pf3f4 (Adorjan_EofCE3) #378 draw 8/1p1p2p1/3P1p2/4P2p/P4P1k/8/1rPP2P1/6K1/w Pe5e6 (Adorjan_EofCE3) #379 white_wins 3nk3/2R5/8/4K3/8/8/8/8/w Ke5d6 (Adorjan_EofCE3) #380 draw 1nk5/6R1/3K4/8/8/8/8/8/b Nb8a6 (Adorjan_EofCE3) #381a draw 1nk5/6R1/3K4/8/8/8/8/8/w Rg7c7+ (Adorjan_EofCE3) #381b draw 5k2/7n/8/5K2/8/8/8/6R1/w Kf5g6 (Adorjan_EofCE3) #382 white_wins 5K2/8/4k3/8/7r/4N3/8/8/b Rh4e4!? (Adorjan_EofCE3) #383 black_wins 5nk1/4R3/8/6K1/8/8/8/8/w Kg5f6 (Adorjan_EofCE3) #384 draw 6k1/3R4/6K1/7n/8/8/8/8/b Nh5f4+ (Adorjan_EofCE3) #385 white_wins 6k1/5n2/6K1/8/8/3R4/8/8/w Rd3d5 (Adorjan_EofCE3) #386 white_wins 8/8/8/8/6K1/8/R7/6kn/b Nh1f2+ (Adorjan_EofCE3) #387 white_wins 8/8/8/8/8/2K1n3/4R3/1k6/b Ne3d1+ (Adorjan_EofCE3) #388 white_wins 8/8/3n4/7R/8/4K3/8/6k1/b Nd6c4+ (Adorjan_EofCE3) #389 white_wins 8/kn6/8/1K6/8/8/8/7R/w Rh1d1!? (Adorjan_EofCE3) #390 white_wins 7R/kn6/2K5/8/8/8/8/8/b Nb7a5+ (Adorjan_EofCE3) #391 white_wins 8/knK5/6R1/8/8/8/8/8/w Kc7c6 (Adorjan_EofCE3) #392 white_wins 8/8/8/8/6k1/3r4/6NK/8/b Rd3h3+ (Adorjan_EofCE3) #393 black_wins 8/k7/2K5/7R/2n5/8/8/8/w Rh5c5!? (Adorjan_EofCE3) #394 white_wins 6nk/R7/8/7K/8/8/8/8/b Ng8f6+ (Adorjan_EofCE3) #395 white_wins 5n1k/R7/8/6K1/8/8/8/8/w Kg5f6!? (Adorjan_EofCE3) #396 white_wins k7/n7/K7/8/8/8/8/1R6/b Na7c8 (Adorjan_EofCE3) #397a draw k7/n7/K7/8/8/8/8/1R6/w Ka6b6!? (Adorjan_EofCE3) #397b white_wins 8/6k1/3R4/8/5K1n/8/8/8/w Kf4g5 (Adorjan_EofCE3) #398 white_wins 8/1k6/6n1/2KR4/8/8/8/8/w Kc5d6 (Adorjan_EofCE3) #399 white_wins 8/1k6/8/2KR4/6n1/8/8/8/w Kc5d6 (Adorjan_EofCE3) #400 white_wins 8/1k6/8/2KR4/8/5n2/8/8/w Rd5f5!? (Adorjan_EofCE3) #401 white_wins 8/8/8/1k1K4/8/2R5/3n4/8/w Rc3d3 (Adorjan_EofCE3) #402 white_wins 8/3K1k2/8/8/4R3/3n4/8/8/w Re4e3!? (Adorjan_EofCE3) #403 white_wins 5R2/8/8/8/4K1n1/8/3k4/8/w Ke4f4 (Adorjan_EofCE3) #404 white_wins 8/8/5R2/6n1/8/2k1K3/8/8/w Ke3f4 (Adorjan_EofCE3) #405 white_wins 8/8/8/2k1K3/8/3R4/4n3/8/w Rd3e3 (Adorjan_EofCE3) #406 white_wins 8/8/8/3k4/2R5/3K4/n7/8/b Kd5e5 (Adorjan_EofCE3) #407a white_wins 8/8/8/3k4/2R5/3K4/n7/8/w Rc4a4 (Adorjan_EofCE3) #407b draw 8/8/5k2/8/3R4/2K5/1n6/8/b Kf6e5!? (Adorjan_EofCE3) #408 draw 2n5/2Pk4/8/4K3/8/8/8/2R5/w Rc1c5 (Adorjan_EofCE3) #409 draw n7/Pk6/8/2K5/R7/8/8/8/w Ra4b4+ (Adorjan_EofCE3) #410 white_wins 4r3/8/6k1/8/8/8/p1N5/2K5/w Kc1b2 (Adorjan_EofCE3) #411 draw 8/3n4/3Pk3/8/5K2/8/8/3R4/w Rd1d4 (Adorjan_EofCE3) #412 draw 8/8/8/8/1K3k2/1p4r1/1N6/8/b Kf4e4 (Adorjan_EofCE3) #413 draw 8/1n6/1Pk5/8/3K4/1R6/8/8/w Kd4e5,Rb3b4! (Adorjan_EofCE3) #414 both lead to draw, but latter is more complex 8/8/8/8/5k2/7p/r6N/6K1/w Nh2f1 (Adorjan_EofCE3) #415 black_wins 8/n7/Pk6/8/2K5/R7/8/8/w Ra3a4!! (Adorjan_EofCE3) #416 white_wins 8/4n3/4k3/4P3/4K3/8/8/R7/w Ra1a6+ (Adorjan_EofCE3) #417 white_wins 8/8/1n6/1Pk5/8/3K4/1R6/8/w Rb2b3 (Adorjan_EofCE3) #418 draw 8/8/n7/Pk6/8/2K5/8/R7/w Ra1a3 (Adorjan_EofCE3) #419 white_wins 1k6/8/8/3N4/5K1p/7r/8/8/w Nd5e3!! (Adorjan_EofCE3) #420 draw 8/8/3n4/8/1P3R2/2k1K3/8/8/b Nd6b5 (Adorjan_EofCE3) #421 draw 8/8/2n5/8/P3R3/1k1K4/8/8/b Nc6a5 (Adorjan_EofCE3) #422 white_wins 8/8/8/n7/Pk6/8/2K5/R7/w Ra1a2!! (Adorjan_EofCE3) #423 white_wins k2N4/8/4p3/8/8/4r3/2K5/8/b Re3e5 (Adorjan_EofCE3) #424 draw 5r2/8/2k2p2/5K2/8/8/6N1/8/b Kc6d7 (Adorjan_EofCE3) #425 draw 2K5/2p4r/2N5/8/8/8/8/7k/w Kc8b7 (Adorjan_EofCE3) #426 black_wins 1K5k/1p5r/1N6/8/8/8/8/8/w Kb8a7 (Adorjan_EofCE3) #427 black_wins 8/8/8/6PR/6P1/5nk1/8/3K4/b Nf3e5 (Adorjan_EofCE3) #428 white_wins 1k3K2/5P2/8/8/3r2N1/8/8/8/w Kf8e7!! (Adorjan_EofCE3) #429 white_wins 8/6R1/8/8/8/8/K1pn3k/8/b Nd2c4 (Adorjan_EofCE3) #430 draw 7N/6P1/2k3K1/8/8/4r3/8/8/w Kg6h5!! (Adorjan_EofCE3) #431 white_wins 8/n7/8/8/R7/8/p7/1k1K4/w Ra4b4+ (Adorjan_EofCE3) Ka1 #432 white_wins 8/8/k1r1NPK1/8/8/8/8/8/w Pf6f7!! (Adorjan_EofCE3) #433 white_wins 8/7N/1k2PK2/7r/8/8/8/8/w Pe6e7 (Adorjan_EofCE3) #434 white_wins K7/8/3P3k/8/1r6/6N1/8/8/w Ng3f5+ (Adorjan_EofCE3) #435 white_wins 8/8/1KP1N3/7r/8/8/8/k7/w Pc6c7 (Adorjan_EofCE3) #436 white_wins 4N3/8/1P6/K7/3rk3/8/8/8/w Pb6b7 (Adorjan_EofCE3) #437 white_wins 7k/8/8/8/6p1/8/4K2n/R7/w Ra1h1 (Adorjan_EofCE3) #438 white_wins 8/8/8/1p6/1K6/8/5R2/nk6/w Kb4c3!! (Adorjan_EofCE3) #439 white_wins 6k1/3R4/5Kp1/8/5n2/8/8/8/b Kg8h8 (Adorjan_EofCE3) #440 white_wins 8/k1K5/pR6/n7/8/8/8/8/b Na5c4 (Adorjan_EofCE3) #441 white_wins 8/8/p7/8/1K6/8/4R3/nk6/b Na1c2+ (Adorjan_EofCE3) #442 white_wins 8/7p/8/6n1/8/4K3/2R5/3k4/w Rc2c6 (Adorjan_EofCE3) #443 white_wins 4K1k1/2p5/8/5R2/8/2n5/1p6/8/w Rf5g5+ (Adorjan_EofCE3) #444 black_wins 3R4/8/8/3n4/3k4/3pp3/8/3K4/w Kd1e1 (Adorjan_EofCE3) #445 draw 8/8/8/3n4/3k4/3pp3/R7/3K4/w Kd1c1 (Adorjan_EofCE3) #446 black_wins 5k2/8/4PP2/6K1/5N2/7r/8/8/b Rh3g3+ (Adorjan_EofCE3) #447 draw 8/8/8/6n1/6k1/6pp/R7/6K1/b Ng5f3+ (Adorjan_EofCE3) #448a black_wins 8/8/8/6n1/6k1/6pp/R7/6K1/w Ra2a4+ (Adorjan_EofCE3) #448b draw 8/8/2P5/1Pr5/8/8/N7/k2K4/w Na2c1!! (Adorjan_EofCE3) #449 white_wins 4K2k/1R6/2n5/5p2/8/6p1/8/8/w Rb7b3!! (Adorjan_EofCE3) #450 draw 2k2N2/8/3rPK2/8/8/3P4/8/8/w Pd3d4!! (Adorjan_EofCE3) #451 white_wins 8/5k2/8/4PPK1/6N1/6r1/8/8/b Rg3g1 (Adorjan_EofCE3) #452 draw 8/8/kp6/2n5/p7/8/6K1/R7/b Ka6b5 (Adorjan_EofCE3) #453 black_wins 1r6/4P1P1/8/7k/8/7N/8/4K3/w Nh3f4+!! (Adorjan_EofCE3) #454 white_wins 8/5Pk1/3P4/2N1K3/8/8/8/5r2/w Pd6d7 (Adorjan_EofCE3) #455 white_wins 8/8/7R/8/7K/1n2kp2/7p/8/w Kh4g3 (Adorjan_EofCE3) #456 draw 1K6/1P6/8/6k1/3P4/8/3r2N1/8/w Ng2e1!! (Adorjan_EofCE3) #457 white_wins 8/3P3N/8/7r/k1K5/8/1P6/8/b Rh5h4+ (Adorjan_EofCE3) #458 white_wins 6N1/5k1P/7K/8/8/8/5P2/r7/w Ng8f6 (Adorjan_EofCE3) #459 draw 3R4/8/8/3n4/3k4/2p1p3/8/3K4/w Rd8d7 (Adorjan_EofCE3) #460 draw 8/8/8/3n4/3k4/2p1p3/7R/3K4/b Nd5f4 (Adorjan_EofCE3) #461a black_wins 8/8/8/3n4/3k4/2p1p3/7R/3K4/w Rh2h8 (Adorjan_EofCE3) #461b draw 8/8/8/4pkp1/5n2/4KR2/8/8/b Pg5g4 (Adorjan_EofCE3) #462 draw 3R4/8/8/3n4/3k4/2p2p2/8/4K3/w Rd8c8 (Adorjan_EofCE3) #463 draw 8/4k3/8/2P1KP2/4N3/8/8/6r1/b Rg1c1 (Adorjan_EofCE3) #464 draw 6K1/1kP3P1/8/3N4/8/8/8/5r2/w Kg8h7 (Adorjan_EofCE3) #465 white_wins 8/1N6/1P6/5P2/7k/8/3r4/K7/w Pf5f6 (Adorjan_EofCE3) #466 white_wins 3N2K1/1Pk3P1/8/8/8/3r4/8/8/w Nd8e6+!! (Adorjan_EofCE3) #467 white_wins 8/8/8/5R2/8/3p1K2/3pn3/7k/w Kf3f2 (Adorjan_EofCE3) #468 draw 8/8/8/8/5K2/5n1p/5k1p/7R/w Kf4g4 (Adorjan_EofCE3) #469 draw 8/8/8/6p1/2n3p1/8/5K1k/R7/w Ra1g1 (Adorjan_EofCE3) #470 draw 8/6p1/8/6p1/8/5K2/3R4/6kn/b Pg7g6 (Adorjan_EofCE3) #471 white_wins 8/8/8/1k6/1pp5/2n4R/pK6/8/b Pb4b3!! (Adorjan_EofCE3) #472a black_wins 8/8/8/1k6/1pp5/2n4R/pK6/8/w Rh3h5+!! (Adorjan_EofCE3) #472b draw 7K/2k4P/P6P/8/8/8/8/1N5r/w Pa6a7!! (Adorjan_EofCE3) #473 white_wins 6k1/8/8/3p1n2/3p2K1/8/3p4/2R5/w Rc1g1 (Adorjan_EofCE3) #474 black_wins 5k2/8/7K/1P6/8/1P1N4/1P6/1r6/w Pb5b6 (Adorjan_EofCE3) #475 white_wins 4r2k/7P/2N4P/PK6/8/4P3/8/8/w Pa5a6 (Adorjan_EofCE3) #476 white_wins 8/2rk4/1p4P1/8/p7/4N3/5K2/8/w Pg6g7 (Adorjan_EofCE3) #477 draw 8/8/p1Pr2k1/N6p/5K2/8/8/8/w Pc6c7 (Adorjan_EofCE3) #478 white_wins 8/3kn3/3p4/3P3R/4K3/8/8/8/w Ke4f4 (Adorjan_EofCE3) #479 white_wins 8/kn6/p7/P6R/1K6/8/8/8/w Rh5h6 (Adorjan_EofCE3) #480 white_wins 8/8/3kn3/3p4/3P3R/4K3/8/8/w Rh4h6 (Adorjan_EofCE3) #481 draw 8/8/5k2/r4p2/5P2/4NK2/8/8/b Ra5a3 (Adorjan_EofCE3) #482 draw 8/8/8/5pN1/3k1P2/r7/5K2/8/b Kd4d3 (Adorjan_EofCE3) #483 black_wins 8/6k1/R7/5p1n/5P2/4K3/8/8/w Ra6b6 (Adorjan_EofCE3) #484 white_wins 8/8/kn6/p7/P6R/1K6/8/8/w Rh4h5 (Adorjan_EofCE3) #485 draw 8/8/8/3kn3/3p3R/3P4/4K3/8/w Rh4h5 (Adorjan_EofCE3) #486 draw 8/8/8/kn6/p7/P6R/1K6/8/w Rh3h6 (Adorjan_EofCE3) #487 white_wins 8/8/8/8/3kn3/3p4/3P3R/4K3/w Rh2h4 (Adorjan_EofCE3) #488 white_wins 6n1/8/6k1/4K1p1/R7/8/6P1/8/b Ng8h6 (Adorjan_EofCE3) #489 white_wins 8/6kp/8/8/5N1P/6K1/1r6/8/b Kg7f6 (Adorjan_EofCE3) #490 black_wins 4k3/R3p3/2K2n2/3P4/8/8/8/8/w Ra7a8+ (Adorjan_EofCE3) #491 white_wins 3n4/2kp4/6R1/2PK4/8/8/8/8/w Rg6a6 (Adorjan_EofCE3) #492 draw 8/4k3/R3p3/2K2n2/3P4/8/8/8/w Ra6a7+ (Adorjan_EofCE3) #493 draw 5n2/8/4pk2/4R3/5PK1/8/8/8/w Re5h5 (Adorjan_EofCE3) #494 draw 8/3n4/2kp4/7R/2PK4/8/8/8/w Rh5a5 (Adorjan_EofCE3) #495 draw 8/6k1/R5p1/4K2n/5P2/8/8/8/w Ra6a7+ (Adorjan_EofCE3) #496 white_wins 8/8/4k3/R3p3/2K2n2/3P4/8/8/w Ra5a6+ (Adorjan_EofCE3) #497 draw 8/4k3/R7/5p2/3K2n1/4P3/8/8/w Ra6g6 (Adorjan_EofCE3) #498 draw 8/8/8/5pk1/8/4NKP1/1r6/8/b Rb2b3 (Adorjan_EofCE3) #499 black_wins 8/8/8/3n4/3kp3/R7/2KP4/8/w Ra3a4+ (Adorjan_EofCE3) #500 draw 8/8/8/5n2/5kp1/R7/4KP2/8/w Ra3a4+ (Adorjan_EofCE3) #501 white_wins 8/8/8/5nk1/4Rp2/8/5KP1/8/w Re4e5 (Adorjan_EofCE3) #502 draw 8/8/8/n7/kp6/7R/PK6/8/w Kb2c2 (Adorjan_EofCE3) #503 draw 8/7p/5k2/r7/5NK1/6P1/8/8/w Nf4h3!! (Adorjan_EofCE3) #504 draw 8/8/8/8/1N4K1/P7/p5k1/r7/w Kg4g5 (Adorjan_EofCE3) #505 draw 8/8/4K3/7R/6pP/6k1/5n2/8/w Rh5h8 (Adorjan_EofCE3) #506 white_wins 5k2/N7/pP6/8/1K6/3r4/8/8/w Pb6b7 (Adorjan_EofCE3) #507 white_wins 8/8/1p1Pr2k/8/2N5/8/8/5K2/w Pd6d7 (Adorjan_EofCE3) #508 white_wins 8/8/1Rn5/p5K1/2k5/2P5/8/8/b Nc6e7 (Adorjan_EofCE3) #509 draw 8/k7/3P4/8/4K3/6r1/5N1p/8/w Pd6d7 (Adorjan_EofCE3) #510 draw 6r1/3P4/8/1N5p/7k/5K2/8/8/w Nb5d4!! (Adorjan_EofCE3) #511 draw 1R6/8/8/8/3k4/3n4/1P3p2/5K2/w Rb8b7 (Adorjan_EofCE3) #512 draw 8/8/1P6/8/2N1k3/2K3p1/6r1/8/w Pb6b7 (Adorjan_EofCE3) #513 white_wins 8/k7/P4p2/1R6/4K3/8/2n5/8/w Rb5b2!! (Adorjan_EofCE3) #514 white_wins 8/1R3pk1/6p1/4KnP1/5P2/8/8/8/w Rb7b8 (Adorjan_EofCE3) #515 white_wins 8/R5pk/5n1p/5K1P/6P1/8/8/8/w Ra7e7 (Adorjan_EofCE3) #516 white_wins 8/R5p1/7p/8/6P1/4kn1P/8/3K4/b Pg7g5 (Adorjan_EofCE3) #517 white_wins 8/8/6pk/8/5p1P/6n1/6PK/R7/b Kh6h5 (Adorjan_EofCE3) #518 draw 8/8/4kp2/6p1/6P1/r3PKN1/8/8/b Ke6d5 (Adorjan_EofCE3) #519 black_wins 8/r2k4/7p/7p/8/1K1N4/5PP1/8/w Nd3f4 (Adorjan_EofCE3) #520 black_wins 8/7p/8/k3P1p1/8/6P1/3KN3/7r/w Pe5e6 (Adorjan_EofCE3) #521 white_wins 7r/5P2/p1k2K2/5N2/p7/8/P7/8/w Nf5e7+ (Adorjan_EofCE3) #522 white_wins 8/8/8/5R2/4k1P1/4pp1P/3n4/6K1/w Ph3h4 (Adorjan_EofCE3) #523 black_wins 8/7k/8/3p4/4pn2/6RP/7P/2K5/w Rg3g4!! (Adorjan_EofCE3) #524 white_wins 8/7k/2P5/2p4p/P3N2K/8/8/5r2/w Ne4g5+!! (Adorjan_EofCE3) #525 white_wins 8/8/8/p1k2K1R/5P1P/8/4p1n1/8/w Kf5e6+!! (Adorjan_EofCE3) #526 draw 8/4p3/3p1k2/3P1p2/5N2/4P1K1/3r1P2/8/b Rd2c2!! (Adorjan_EofCE3) #527 black_wins 8/2n5/5pkp/6p1/4K3/R4PP1/7P/8/b Nc7b5 (Adorjan_EofCE3) #528 white_wins 8/2R2pk1/5npp/8/5K2/7P/5PP1/8/w Kf4e5 (Adorjan_EofCE3) #529 white_wins 8/8/R7/4pk1p/2K1n1pP/6P1/5P2/8/w Kc4d5 (Adorjan_EofCE3) #530 white_wins 8/7p/5p2/3k4/4Np2/4rP1K/6PP/8/b Kd5e5 (Adorjan_EofCE3) #531 black_wins 8/6p1/5pk1/R5p1/5n2/5P2/5P1P/5K2/w Ra5a8 (Adorjan_EofCE3) #532 white_stands_better 6r1/3P3N/p1p5/k7/P7/K4p2/5P2/8/w Nh7g5 (Adorjan_EofCE3) #533 white_wins 8/4k3/3pP1p1/P2P3p/1K1N4/8/r7/8/w Nd4c6+ (Adorjan_EofCE3) #534 black_wins 8/1r3N2/8/P1pkp2p/2p3p1/4P3/2KP1P1P/8/w Pe3e4+!! (Adorjan_EofCE3) #535 white_wins 8/R4n2/5kp1/5p2/8/4KP2/8/8/w Ke3d4 (Adorjan_EofCE3) #536 draw 8/8/4N2p/5r1P/4k1K1/8/6P1/8/w Pg2g3 (Adorjan_EofCE3) #537 black_wins 8/5k1p/6p1/2n5/8/5K2/3R3P/8/b Kf7f6 (Adorjan_EofCE3) #538 draw 8/6kp/R7/6K1/5nP1/8/7p/8/w Ra6a7+ (Adorjan_EofCE3) #539 white_wins 8/8/2N5/3P4/k2p2r1/8/2P5/3K4/w Pd5d6 (Adorjan_EofCE3) #540 white_wins 8/7N/3P4/7r/k1p1K3/8/1P6/8/w Pd6d7 (Adorjan_EofCE3) #541 white_wins 8/1p1N4/8/4P3/1K6/1P2k3/8/1r6/w Pe5e6 (Adorjan_EofCE3) #542 draw 8/1p1N4/8/4P3/8/1K2k3/1P6/1r6/w Pe5e6 (Adorjan_EofCE3) #543 white_wins 8/4k3/4p1K1/7p/5P2/4n3/R7/8/w Ra2h2!,Kg6xPh5 (Adorjan_EofCE3) #544 draw (both draw but former is more complicated) 3k3K/p5P1/P3r3/8/1N6/8/8/8/w Kh8h7! (Adorjan_EofCE3) #545 white_wins 1R6/4n2p/4K2P/2k5/1p6/8/8/8/b Ne7c6 (Adorjan_EofCE3) #546 white_wins 8/p4N2/1k6/1P5P/1K6/8/8/r7/w Nf7d6! (Adorjan_EofCE3) #547 draw 8/7p/8/6R1/pk4P1/8/4K2n/8/w Ke2d3 (Adorjan_EofCE3) #548 draw K7/2p5/P5R1/8/4n3/8/1p5k/8/w Pa6a7 (Adorjan_EofCE3) #549 draw 8/3r4/1p5k/3PP3/2N5/8/8/5K2/w Pe5e6! (Adorjan_EofCE3) #550 white_wins 8/8/1R6/5kp1/7p/4P2n/4K3/8/b Pg5g4 (Adorjan_EofCE3) #551 draw 8/1k6/4R3/P1p5/4p3/2n3K1/8/8/b Pc5c4 (Adorjan_EofCE3) #552 draw 8/6k1/4P3/7P/8/8/p1NK4/1r6/w Ph5h6+! (Adorjan_EofCE3) #553 draw 5r2/4pP2/1P6/8/7k/N7/8/7K/w Pb6b7 (Adorjan_EofCE3) #554 white_wins 8/R7/8/8/6Pp/4k3/3pn1K1/8/w Ra7a3+ (Adorjan_EofCE3) #555 black_wins 8/5k2/5nR1/3p1P2/3K4/7p/8/8/w Rg6h6 (Adorjan_EofCE3) #556 white_wins 8/8/6R1/3k2P1/p2n4/2K1p3/8/8/b Pa4a3 (Adorjan_EofCE3) #557 draw 8/R7/1p6/3K2kp/8/4Pn2/8/8/w Kd5e4 (Adorjan_EofCE3) #558 white_wins 8/5pk1/5p2/7P/7n/8/8/3R1K2/w Kf1f2 (Adorjan_EofCE3) #559 white_wins 8/8/6pp/8/6PP/5PK1/r2k2N1/8/w Kg3f4 (Adorjan_EofCE3) #560 draw 8/6p1/7p/7P/5NP1/4kPK1/r7/8/w Nf4g2+ (Adorjan_EofCE3) #561 draw 8/6p1/2r4p/4k2P/8/5PKN/6P1/8/b Rc6c2 (Adorjan_EofCE3) #562 draw 8/6p1/7p/4k3/7P/r4PK1/4N1P1/8/w Ne2f4 (Adorjan_EofCE3) #563 draw r5N1/3P4/8/6p1/2k2p2/8/5PP1/4K3/w Ng8h6! (Adorjan_EofCE3) #564 white_wins 8/8/R7/3Kpk1p/6pP/6P1/5n2/8/w Ra6a1 (Adorjan_EofCE3) #565 white_wins 1R6/8/2n2pkp/4p3/4K1PP/8/8/8/w Ph4h5+ (Adorjan_EofCE3) #566 white_wins 6k1/5pp1/1p6/6P1/4n3/7P/3R4/7K/w Rd2d8+! (Adorjan_EofCE3) Kh7 #567 white_wins 8/8/p1npk3/2p5/P3P3/2K3R1/8/8/b Ke6e5 (Adorjan_EofCE3) #568 draw 3R4/8/8/p1p1k3/4p3/n1P5/P3K3/8/w Rd8b8 (Adorjan_EofCE3) #569 draw 8/7r/p1k5/1p1N4/1P2KPP1/8/8/8/b Rh7d7! (Adorjan_EofCE3) #570 black_wins 8/8/5p2/3P4/8/1P3n2/3PK1kp/2R5/w Rc1h1! (Adorjan_EofCE3) #571 draw 8/pp6/7k/2p3n1/2P5/3R4/PP1p4/7K/b Ng5f3! (Adorjan_EofCE3) #572 black_wins 8/5pp1/7p/2k5/1pn3PP/8/4KP2/1R6/w Pf2f4 (Adorjan_EofCE3) #573 draw 8/R7/4k1p1/1p5p/3n3P/6P1/1P2pK2/8/w Ra7a6+ (Adorjan_EofCE3) #574 white_wins 7k/N5pp/8/1P2p3/6P1/7P/1KP5/3r4/w Na7c6! (Adorjan_EofCE3) #575 draw r7/3P4/7p/PpN1k2p/8/8/5PP1/6K1/w Kg1f1 (Adorjan_EofCE3) #576 draw 2r5/5p2/5k1p/1p1P1p2/3K4/4N1PP/1P3P2/8/b Rc8c1 (Adorjan_EofCE3) #577 black_wins 8/1p1k4/p3p3/1n1p2pp/1P1P4/1P1K2P1/7P/2R5/w Rc1e1 (Adorjan_EofCE3) #578 white_wins 2r5/1p1k1p2/p5p1/P1PPKp1p/1P3N1P/5P2/6P1/8/b Rc8e8+ (Adorjan_EofCE3) #579 white_wins 8/8/8/2R1pk2/3n1p2/6p1/6P1/5K2/w Rc5c8 (Adorjan_EofCE3) #580 draw 7k/4NKp1/2P3P1/7P/8/8/8/2r5/w Kf7e6 (Adorjan_EofCE3) #581 white_wins 8/8/1K6/2r2p2/1k3P2/5P2/2P5/1N6/w Pc2c3+ (Adorjan_EofCE3) #582 white_wins 4R3/8/7k/8/1pK4n/1p4p1/1P6/8/b Pg3g2 (Adorjan_EofCE3) #583 draw 6r1/3P2pN/2k1P3/5P2/8/8/8/5K2/w Pf5f6! (Adorjan_EofCE3) #584 white_wins 8/8/1rP3k1/7p/7K/3P4/2N3P1/8/w Nc2d4! (Adorjan_EofCE3) #585 white_wins 8/8/2k5/2P2p2/1P4r1/2K3P1/4N3/8/b Kc6d5 (Adorjan_EofCE3) #586 draw 8/8/8/1n5p/p4R1P/kp6/3K4/8/w Rf4c4! (Adorjan_EofCE3) #587 draw 8/8/3P1k2/N6p/8/8/P4KPr/8/w Pd6d7 (Adorjan_EofCE3) #588 white_wins 8/p7/7k/4n3/8/2R1p3/1pP5/1K6/b Ne5f3! (Adorjan_EofCE3) #589 draw 4k3/4p1p1/8/3P3P/1p6/5PPr/1P2N3/6K1/w Ne2f4! (Adorjan_EofCE3) #590 white_wins 8/4n1pp/p2pk3/2p5/P3P3/2K3P1/8/R7/b Ph7h5! (Adorjan_EofCE3) #591 draw 8/4r3/3N1k2/p1P2P2/Pp6/8/KP6/8/w Pc5c6! (Adorjan_EofCE3) #592 white_wins 8/p6p/1p4p1/5k2/3Kn3/4P2P/2R5/8/w Rc2c7 (Adorjan_EofCE3) #593 white_wins 7k/8/pP1N4/3P1p2/5PpP/3r4/7P/6K1/w Nd6f7+! (Adorjan_EofCE3) #594 white_wins 3r4/6k1/6pp/4Pp2/p1N5/4P2P/PP4PK/8/w Kh2g3 (Adorjan_EofCE3) #595 black_wins 7k/p3r2p/1p6/2pPP1N1/2P5/8/PP5P/7K/b Kh8g7 (Adorjan_EofCE3) #596 white_wins 2r5/1pp5/p1p2k2/8/4PN2/1P5P/P1P2KP1/8/w Pg2g4 (Adorjan_EofCE3) #597 white_wins 8/8/5k2/3P1N2/4Pp1P/r7/5KP1/8/w Ph4h5 (Adorjan_EofCE3) #598 white_wins 4r3/2k4P/8/5K2/1P6/3P2P1/p1N5/8/b Kc7d6! (Adorjan_EofCE3) #599 draw 4r3/7P/2k5/5K2/1P6/1N1P2P1/p7/8/w Pg3g4 (Adorjan_EofCE3) #600 white_wins 8/2r5/1k3N1p/3Pp3/4P1P1/5P2/5K1P/8/w Ph2h4 (Adorjan_EofCE3) #601 white_wins 8/5p1p/1p6/p2Pk1p1/4n1P1/2p2K2/7P/1R6/w Kf3e3 (Adorjan_EofCE3) #602 black_wins 3r4/4k2p/6p1/2N5/P6P/1P1P1PP1/6K1/8/w Pa4a5! (Adorjan_EofCE3) #603 white_wins 7k/R7/7K/3b4/8/8/8/8/w Ra7d7 (Adorjan_EofCE3) #604 draw 5k2/6R1/5K2/8/8/5b2/8/8/b Kf8e8! (Adorjan_EofCE3) #605a draw 5k2/6R1/5K2/8/8/5b2/8/8/w Rg7g3 (Adorjan_EofCE3) #605b white_wins 7k/8/8/4R1K1/8/7b/8/8/w Re5e8+ (Adorjan_EofCE3) #606 white_wins 6k1/8/5K2/8/4R3/7b/8/8/w Re4d4! (Adorjan_EofCE3) #607 white_wins 6k1/5R2/6K1/8/3b4/8/8/8/b Bd4g1 (Adorjan_EofCE3) #608 white_wins 7k/R7/8/4K3/7b/8/8/8/w Ke5f5! (Adorjan_EofCE3) #609 white_wins 8/8/8/5b2/8/8/5K1k/5R2/w Rf1g1 (Adorjan_EofCE3) #610 white_wins 8/8/8/7b/8/8/5K1k/5R2/w Rf1g1 (Adorjan_EofCE3) #611 draw 8/k7/2K5/3R4/8/8/8/5b2/w Rd5d2! (Adorjan_EofCE3) #612 white_wins 8/k6b/8/1K6/8/1R6/8/8/w Rb3e3 (Adorjan_EofCE3) #613 draw 8/8/2R5/8/8/8/k2K4/6b1/w Kd2c3! (Adorjan_EofCE3) #614 white_wins 8/k7/b7/8/1K6/5R2/8/8/w Kb4a5 (Adorjan_EofCE3) #615 white_wins 1b6/7k/8/8/6K1/8/8/R7/w Kg4f5 (Adorjan_EofCE3) #616 white_wins 8/8/7k/8/4R1K1/8/7b/8/w Kg4f5 (Adorjan_EofCE3) #617 white_wins 4k3/3R4/1b1K4/8/8/8/8/8/b Ke8f8! (Adorjan_EofCE3) #618a draw 4k3/3R4/1b1K4/8/8/8/8/8/w Kd6e6! (Adorjan_EofCE3) #618b white_wins 8/8/8/8/8/B6r/3Kp3/1k6/w Ba3c5 (Adorjan_EofCE3) #619 draw 3k4/6R1/3P4/4K3/2b5/8/8/8/w Rg7g4 (Adorjan_EofCE3) #620 white_wins 8/8/2kP2R1/4K3/1b6/8/8/8/w Rg6h6 (Adorjan_EofCE3) #621 draw 8/3k4/3P4/4K3/8/b7/8/3R4/w Rd1d2 (Adorjan_EofCE3) #622 draw 2b5/K7/2kP3R/8/8/8/8/8/w Pd6d7+! (Adorjan_EofCE3) #623 white_wins 3R4/8/2bP4/4k3/8/2K5/8/8/b Ke5d5 (Adorjan_EofCE3) #624 draw 3R4/8/3Pb1K1/4k3/8/8/8/8/b Be6d5 (Adorjan_EofCE3) #625a draw 3R4/8/3Pb1K1/4k3/8/8/8/8/w Kg6g7 (Adorjan_EofCE3) #625b draw 8/2bk4/8/3P4/4K3/8/8/3R4/w Rd1a1 (Adorjan_EofCE3) #626 white_wins 5R2/8/3k4/8/3P4/1b1K4/8/8/w Rf8f6+ (Adorjan_EofCE3) #627 white_wins 8/8/3k4/1R6/3P4/4K2b/8/8/w Rb5g5 (Adorjan_EofCE3) #628 white_wins 8/2b5/4k3/8/3PK3/8/8/3R4/w Rd1a1! (Adorjan_EofCE3) #629 white_wins 8/8/5b2/3k4/4R3/3P4/3K4/8/w Re4b4 (Adorjan_EofCE3) #630 white_wins 8/BK6/3p4/8/8/8/k7/5r2/w Kb7c6 (Adorjan_EofCE3) #631 draw 8/8/8/5b2/3k4/1R6/3P4/3K4/w Rb3b8 (Adorjan_EofCE3) #632 white_wins k7/3p1r2/3K4/2B5/8/8/8/8/w Kd6c7 (Adorjan_EofCE3) #633 draw 5k2/5P2/5R2/3b2K1/8/8/8/8/w Rf6f2 (Adorjan_EofCE3) #634 white_wins 8/8/8/8/8/7k/r4p1B/5K2/w Bh2c7! (Adorjan_EofCE3) #635 draw 5k2/R7/5P2/6K1/2b5/8/8/8/w Ra7c7 (Adorjan_EofCE3) #636 draw 8/5k2/2R5/5P2/5K2/8/8/4b3/w Rc6c7+ (Adorjan_EofCE3) #637 white_wins 8/8/5k2/8/2b2P2/6K1/3R4/8/w Rd2d6+ (Adorjan_EofCE3) #638 white_wins 4K1k1/R5P1/8/8/8/2b5/8/8/b Bc3f6! (Adorjan_EofCE3) #639a draw 4K1k1/R5P1/8/8/8/2b5/8/8/w Ra7a3! (Adorjan_EofCE3) #639b white_wins 8/8/8/8/K3B3/8/k5p1/6r1/b Ka2b2 (Adorjan_EofCE3) #640a draw 8/8/8/8/K3B3/8/k5p1/6r1/w Be4f3! (Adorjan_EofCE3) #640b draw 8/8/2B5/8/6k1/6p1/r7/6K1/b Pg3g2! (Adorjan_EofCE3) #641 black_wins 8/8/6k1/6P1/5K2/8/2b5/6R1/w Rg1g2 (Adorjan_EofCE3) #642 white_wins 8/8/6k1/4R3/6P1/5K2/8/6b1/w Re5e6+ (Adorjan_EofCE3) #643 white_wins 8/8/5Kp1/8/6r1/5k2/8/2B5/b Rg4c4 (Adorjan_EofCE3) #644 draw 7k/7P/6K1/8/R7/8/8/7b/w Kg6g5! (Adorjan_EofCE3) #645 white_wins 8/8/8/8/8/4B2k/6rp/7K/w Be3f2! (Adorjan_EofCE3) #646 draw 8/8/8/8/6B1/1K6/p7/r5k1/b Kg1h2 (Adorjan_EofCE3) #647 draw 7k/R7/7P/6K1/8/3b4/8/8/w Ra7d7 (Adorjan_EofCE3) #648 draw 7k/4K1R1/2b4P/8/8/8/8/8/w Rg7g4! (Adorjan_EofCE3) #649 white_wins 7k/4K1R1/7P/1b6/8/8/8/8/w Rg7g3! (Adorjan_EofCE3) #650 white_wins 7k/4K1R1/7P/8/b7/8/8/8/w Rg7g2! (Adorjan_EofCE3) #651 white_wins 7k/4K1R1/7P/7b/8/8/8/8/w Ke7f6 (Adorjan_EofCE3) #652 white_wins 8/1B6/8/8/7r/4k2p/7K/8/w Bb7c8 (Adorjan_EofCE3) #653 draw 8/b7/P7/1k3K2/8/R7/8/8/w Kf5e6 (Adorjan_EofCE3) #654 white_wins 8/5k2/8/7r/2K5/p7/6B1/8/w Kc4b3 (Adorjan_EofCE3) #655 draw 1k6/8/7R/PK6/8/8/8/6b1/w Rh6h8+ (Adorjan_EofCE3) leads to a draw. drawn. #656 draw 7k/6R1/7K/7P/8/8/8/1b6/w Rg7b7! (Adorjan_EofCE3) #657 white_wins 8/8/7k/7P/7K/7R/3b4/8/w Kh4g4 (Adorjan_EofCE3) #658 white_wins 7k/R7/8/6K1/7P/3b4/8/8/w Kg5h6 (Adorjan_EofCE3) #659 white_wins 8/8/8/7p/6k1/8/r4B2/6K1/b Kg4h3! (Adorjan_EofCE3) #660 black_wins 8/4b3/8/7k/7P/6K1/8/7R/w Kg3f4! (Adorjan_EofCE3) #661 white_wins 3B4/8/8/1r5p/4k2K/8/8/8/w Bd8c7 (Adorjan_EofCE3) #662 black_wins 8/8/k7/8/P5b1/8/3K4/3R4/w Rd1e1 (Adorjan_EofCE3) #663 draw 7K/8/2b5/8/6kP/8/5R2/8/w Rf2f6 (Adorjan_EofCE3) #664 white_wins 8/8/1B6/8/5k2/5p2/r4p2/6K1/w Kg1f1 (Adorjan_EofCE3) #665 draw 1B6/8/8/8/7p/5k1p/3r4/7K/b Ph3h2 (Adorjan_EofCE3) #666 black_wins 8/k1K5/b7/8/8/4R3/3p4/8/w Re3b3! (Adorjan_EofCE3) #667 draw 3r4/1P6/4K3/8/1k3B2/8/8/8/w Bf4c7 (Adorjan_EofCE3) #668 white_wins K4kr1/1P6/8/8/8/8/8/7B/w Bh1d5 (Adorjan_EofCE3) #669 black_wins 8/8/4P3/8/1r6/7B/5k1K/8/w Bh3f5 (Adorjan_EofCE3) or e7 both lead to a loss for white, tho it was drawn here. #670 black_wins 4K3/8/3P4/8/8/8/k5B1/2r5/w Bg2d5+ (Adorjan_EofCE3) #671 white_wins 8/7k/3P4/3K4/B6r/8/8/8/w Pd6d7 (Adorjan_EofCE3) #672 white_wins 8/k7/2P5/2KB4/r7/8/8/8/w Pc6c7 (Adorjan_EofCE3) #673 white_wins 5K2/8/1P6/4r3/8/8/k1B5/8/w Bc2d3! (Adorjan_EofCE3) #674 draw 8/8/P7/4k3/7B/8/1K6/6r1/w Pa6a7 (Adorjan_EofCE3) #675 white_wins 6k1/8/4K3/3R4/3p4/8/7b/8/w Rd5g5+! (Adorjan_EofCE3) #676 white_wins 5K2/1r6/3B4/2P5/8/4k3/8/8/w Pc5c6 (Adorjan_EofCE3) #677 white_wins 6k1/8/6K1/2p5/1b6/5R2/8/8/b Pc5c4 (Adorjan_EofCE3) #678a white_wins 6k1/8/6K1/2p5/1b6/5R2/8/8/w Rf3f5! (Adorjan_EofCE3) #678b white_wins 1k3b2/8/2K4p/8/8/8/8/2R5/w Rc1e1 (Adorjan_EofCE3) #679 white_wins 5R2/6p1/8/8/7k/7b/5K2/8/w Rf8h8+ (Adorjan_EofCE3) #680 white_wins 3R4/8/8/3b4/3k4/3pp3/8/3K4/w Kd1e1 (Adorjan_EofCE3) #681 black_wins 3R4/8/8/8/2k1b3/2pp4/8/3K4/b Be4d5 (Adorjan_EofCE3) #682 black_wins 2R5/8/8/8/1k1b4/1pp5/8/2K5/b Bd4c5 (Adorjan_EofCE3) #683 draw 1R6/8/8/1b6/1k6/pp6/8/K7/b Pb3b2+ (Adorjan_EofCE3) #684 draw 1R6/8/8/b7/k7/pp6/8/K7/w Rb8a8! (Adorjan_EofCE3) #685 draw 8/8/8/8/8/4ppk1/R4b2/5K2/b Bf2g1 (Adorjan_EofCE3) #686 draw 8/8/8/8/1k6/ppb5/7R/1K6/b Kb4c4 (Adorjan_EofCE3) #687 draw 8/8/8/5R2/2b5/2pp4/6k1/4K3/w Rf5f2+ (Adorjan_EofCE3) #688 draw 3r3k/8/5PP1/8/K7/1B6/8/8/w Bb3c4! (Adorjan_EofCE3) #689 white_wins 8/8/3PB3/4P3/K4k2/8/8/7r/w Pd6d7 (Adorjan_EofCE3) #690 white_wins 8/R7/8/6k1/4K1p1/7p/7b/8/b Bh2e5! (Adorjan_EofCE3) #691 black_wins 8/8/8/2p5/3b1R2/kp6/8/1K6/b Ka3b4 (Adorjan_EofCE3) #692 draw 7B/8/2r1P3/8/K7/5P2/8/5k2/w Pe6e7 (Adorjan_EofCE3) #693 white_wins 7k/7p/8/8/K2R4/6p1/6b1/8/w Rd4d8+! (Adorjan_EofCE3) #694 draw 3R4/8/3b4/3k4/3pp3/8/3K4/8/w Kd2e2 (Adorjan_EofCE3) #695 draw 4k3/K1R5/8/8/2pp4/8/8/5b2/w Ka7b6! (Adorjan_EofCE3) #696 draw 8/6k1/8/1P5r/2P5/8/7B/2K5/w Pb5b6 (Adorjan_EofCE3) #697 white_wins 4k3/6p1/3K4/8/6Rp/8/8/5b2/w Rg4e4+ (Adorjan_EofCE3) #698 white_wins 8/8/4k3/2bpp3/7R/3K4/8/8/b Bc5e7 (Adorjan_EofCE3) #699 draw 6b1/k4p2/2K5/5Rp1/8/8/8/8/w Rf5f1! (Adorjan_EofCE3) #700 white_wins 5b2/7k/4K3/8/8/4pR2/6p1/8/w Rf3h3+ (Adorjan_EofCE3) #701 draw 8/K7/P7/1B6/2P5/4k3/8/2r5/b Ke3d4 (Adorjan_EofCE3) #702 white_wins 8/8/6P1/8/1Br3k1/4P3/8/5K2/w Pg6g7 (Adorjan_EofCE3) #703 white_wins 2k5/8/2K5/1PBP4/8/8/8/r7/w Pb5b6 (Adorjan_EofCE3) #704 white_wins 8/8/8/8/1kb5/1p2R3/1K2p3/8/b Bc4d3 (Adorjan_EofCE3) #705 draw 4K3/4P3/7k/8/2B4P/8/8/7r/w Bc4e6! (Adorjan_EofCE3) #706 white_wins K2b4/8/8/p7/3p4/8/3k4/7R/w Rh1h5! (Adorjan_EofCE3) #707 draw 6R1/8/8/8/4b3/3k4/2p3p1/2K5/b Kd3e3 (Adorjan_EofCE3) #708 draw 2k3K1/6P1/2P5/8/5B1r/8/8/8/w Bf4e5 (Adorjan_EofCE3) #709 white_wins 4k1Br/7P/3PK3/8/8/8/8/8/w Bg8f7+ (Adorjan_EofCE3) #710 white_wins 8/5k1K/8/4R3/4p3/pb6/8/8/w Re5xPe4! (Adorjan_EofCE3) #711 draw 8/k7/4P3/4K3/5B2/P7/8/r7/w Bf4e3+ (Adorjan_EofCE3) #712 white_wins 7R/8/8/8/8/6k1/2pK3p/3b4/b Kg3g2 (Adorjan_EofCE3) #713 black_wins 6r1/kP6/8/8/6P1/5BK1/8/8/w Kg3h4 (Adorjan_EofCE3) #714 draw 8/6B1/7P/7r/6K1/k1P5/8/8/b Rh5h1 (Adorjan_EofCE3) #715 white_wins 8/8/8/2P4P/8/2K5/7B/k4r2/w Kc3b4! (Adorjan_EofCE3) #716 white_wins 8/8/2R5/8/k7/7p/1p6/6bK/w Rc6a6+! (Adorjan_EofCE3) #717 draw 6Br/7P/2k5/8/2K5/1P6/8/8/b Kc6b6 (Adorjan_EofCE3) #718a white_wins 6Br/7P/2k5/8/2K5/1P6/8/8/w Pb3b4 (Adorjan_EofCE3) #718b draw 4K3/Pk5P/8/8/2r5/8/8/3B4/w Pa7a8=Q+! (Adorjan_EofCE3) #719 white_wins K6k/8/3p4/8/8/2R5/3p4/3b4/w Rc3h3+! (Adorjan_EofCE3) #720 draw 2K3bk/8/1p6/8/8/3R4/1p6/8/w Rd3d1 (Adorjan_EofCE3) #721 draw 8/6R1/8/8/1b3p2/5p2/7K/3k4/w Rg7f7 (Adorjan_EofCE3) #722 black_wins 8/2r5/6P1/4K3/6Pk/8/B7/8/w Ba2f7 (Adorjan_EofCE3) #723 white_wins 8/8/6P1/3B2k1/8/2r3P1/8/K7/w Pg6g7 (Adorjan_EofCE3) #724 white_wins 8/3KPk2/3B1P2/6P1/8/8/8/4r3/w Bd6c5 (Adorjan_EofCE3) #725 white_wins 8/2K5/5r2/3B1P1P/6P1/7k/8/8/w Pg4g5! (Adorjan_EofCE3) #726 white_wins 5k2/3R4/5ppp/4b3/8/5K2/8/8/b Pf6f5 (Adorjan_EofCE3) #727 draw 2r5/8/8/2kPP3/8/8/3PK3/1B6/w Pd5d6 (Adorjan_EofCE3) #728 white_wins 2K5/k1P5/P7/3P4/8/8/8/B2r4/w Kc8d7 (Adorjan_EofCE3) #729 white_wins 8/3r4/4k3/2B1P3/3P3K/8/P7/8/b Rd7d5 (Adorjan_EofCE3) #730 draw 8/5k2/5P2/1K2P3/1B6/P6r/8/8/b Kf7e6 (Adorjan_EofCE3) #731 white_wins 3r4/1P1P2P1/6k1/8/8/8/4B3/2K5/w Be2a6! (Adorjan_EofCE3) #732 white_wins 8/6B1/2k4P/7r/2K5/P1P5/8/8/w Kc4d4 (Adorjan_EofCE3) #733 white_wins 4k3/B3P3/7P/rP6/8/8/8/4K3/w Ph6h7 (Adorjan_EofCE3) #734 white_wins 3R4/8/8/4b3/5pk1/5p1p/8/6K1/w Rd8g8+ (Adorjan_EofCE3) #735 black_wins 7k/7p/4K3/2p2p2/6R1/8/1b2p3/8/w Rg4g2! (Adorjan_EofCE3) #736 draw 8/6k1/R6p/7P/5KP1/8/2b5/8/w Kf4e5! (Adorjan_EofCE3) #737 white_wins 8/2r1kp2/5p2/7p/4BK2/5PP1/8/8/w Be4d5 (Adorjan_EofCE3) #738 black_wins r7/6Kp/B1P3p1/6p1/8/7P/6k1/8/w Ba6b7 (Adorjan_EofCE3) #739 white_wins 8/4k1K1/2r2p1P/4p3/p3P3/8/8/5B2/w Ph6h7 (Adorjan_EofCE3) #740 draw 5k2/4p3/2P1Bp2/5p1P/r7/8/4K3/8/w Pc6c7 (Adorjan_EofCE3) #741 white_wins 8/8/3b4/3P4/2R1pkp1/1P5p/1P5P/6K1/b Kf4f3 (Adorjan_EofCE3) #742 black_wins 8/1p6/pPb3R1/P2k1p2/5P1P/K3p3/6P1/8/w Rg6g7 (Adorjan_EofCE3) #743 draw 8/p4p2/7P/k1K5/3B3p/8/8/3r4/w Ph6h7 (Adorjan_EofCE3) #744 white_wins 8/4k1p1/1R4P1/8/5K2/8/2b5/8/w Kf4g5 (Adorjan_EofCE3) #745 white_wins k7/p4R2/P7/1K6/8/6b1/8/8/w Kb5c6 (Adorjan_EofCE3) #746 draw 8/pK2k3/P7/8/8/3R4/8/6b1/w Kb7c6 (Adorjan_EofCE3) #747 white_wins 4r3/8/8/8/6Bp/3K3P/5k2/8/b Re8e3+ (Adorjan_EofCE3) #748 black_wins 8/5k2/8/4r3/5p2/5B2/5PK1/8/w Bf3g4 (Adorjan_EofCE3) #749 draw 8/8/K7/8/Bp6/7r/1P1k4/8/w Ka6b5! (Adorjan_EofCE3) #750 draw 3R4/8/8/3p4/3Pbk2/8/5K2/8/w Rd8h8 (Adorjan_EofCE3) #751 white_wins r7/3B4/8/6p1/3k2P1/5K2/8/8/b Ra8a3+ (Adorjan_EofCE3) #752 black_wins 6r1/8/8/6p1/6P1/3k1K2/8/2B5/b Kd3d4 (Adorjan_EofCE3) #753 draw 5r2/8/8/6Bp/4k2P/6K1/8/8/b Ke4d3! (Adorjan_EofCE3) #754 black_wins 8/8/8/6Bp/7P/5k2/7r/3K4/w Kd1e1! (Adorjan_EofCE3) #755 draw 8/4K3/2k5/7p/7P/7b/3R4/8/w Rd2d6+ (Adorjan_EofCE3) Kc5! #756 draw 8/1B6/8/5p2/5k2/8/3r1PK1/8/b Rd2d3 (Adorjan_EofCE3) #757 draw 8/8/8/4k3/4p3/3bP3/3K3R/8/w Kd2c3 (Adorjan_EofCE3) #758 white_wins 5k2/1R6/4K3/8/5p2/4bP2/8/8/w Rb7f7+ (Adorjan_EofCE3) #759 white_wins 2r5/8/pB6/P7/1k6/8/K7/8/b Rc8c2+ (Adorjan_EofCE3) #760 black_wins 4R3/8/8/3kbp2/8/4KP2/8/8/w Re8a8 (Adorjan_EofCE3) #761 draw 8/8/8/8/4k3/4p3/3bP3/3K3R/w Kd1c2 (Adorjan_EofCE3) #762 white_wins 8/5Bp1/6P1/r7/5k2/7K/8/8/b Ra5h5+ (Adorjan_EofCE3) #763 black_wins 6k1/8/4K3/8/8/p4R2/Pb6/8/b Kg8g7 (Adorjan_EofCE3) #764a white_wins 6k1/8/4K3/8/8/p4R2/Pb6/8/w Ke6e7 (Adorjan_EofCE3) #764b white_wins 8/8/8/8/4pk2/8/r3BP2/4K3/b Ra2a1+ (Adorjan_EofCE3) #765a black_wins 8/8/8/8/4pk2/8/r3BP2/4K3/w Ke1f1! (Adorjan_EofCE3) #765b draw 8/8/8/r7/5pk1/8/5BP1/5K2/w Kf1e1! (Adorjan_EofCE3) #766 draw 2B5/8/8/6k1/7p/5K2/6P1/7r/b Rh1c1 (Adorjan_EofCE3) #767 black_wins 8/pk6/1b6/1P6/K7/8/8/5R2/w Rf1f7+ (Adorjan_EofCE3) #768 white_wins 8/B7/4k3/5p2/8/3r2P1/6K1/8/b Ke6d5 (Adorjan_EofCE3) #769 black_wins 8/8/4pk2/7r/2BP4/3K4/8/8/b Kf6f5 (Adorjan_EofCE3) leads to a draw #770 draw 8/4K3/4p3/3k4/3P1B2/8/8/4r3/w Bf4g5 (Adorjan_EofCE3) #771 black_wins 8/2b5/6R1/7p/7k/5K2/6P1/8/w Rg6c6 (Adorjan_EofCE3) #772 white_wins 8/8/5p2/4b3/4K1k1/5R2/6P1/8/w Rf3h3! (Adorjan_EofCE3) #773 white_wins 1b6/4p3/3P4/7R/8/5k2/7K/8/w Rh5f5+ (Adorjan_EofCE3) #774 white_wins 1k6/2R5/1P6/K7/8/8/2p5/3b4/w Ka5b4! (Adorjan_EofCE3) #775 white_wins k7/7P/4K3/8/6p1/8/8/r4B2/b Ra1e1+ (Adorjan_EofCE3) #776 white_wins 8/6P1/8/5p2/1B5K/8/8/2kr4/w Bb4d6! (Adorjan_EofCE3) #777 white_wins 5k2/8/8/2R5/6K1/8/3b2pP/8/w Rc5f5+! (Adorjan_EofCE3) #778 draw 1k2rB2/6Pp/8/8/8/8/7K/8/b Re8e2+ (Adorjan_EofCE3) #779 white_wins 8/8/8/8/5k1B/5p1P/2r5/5K2/w Bh4f6 (Adorjan_EofCE3) #780 draw 8/2k5/p1P5/3K4/4R3/8/3b4/8/b Bd2g5! (Adorjan_EofCE3) #781 draw 8/8/8/8/5kBp/1r3P2/6K1/8/b Rb3b2+ (Adorjan_EofCE3) #782 draw 8/8/6k1/7R/6P1/4p3/4Kb2/8/w Ke2f3 (Adorjan_EofCE3) #783 white_wins 8/8/1R6/3p4/1P1k1K2/1b6/8/8/w Rb6c6! (Adorjan_EofCE3) #784 white_wins 8/8/5bk1/1R5p/5P2/6K1/8/8/w Kg3f3 (Adorjan_EofCE3) #785 white_wins 8/8/1R6/2p5/P1k5/2b2K2/8/8/b Kc4d3! (Adorjan_EofCE3) #786 draw 5k2/7p/5P2/3r4/3B4/3K4/8/8/w Kd3e4 (Adorjan_EofCE3) #787 black_wins r7/7k/3P4/8/8/p2K4/2B5/8/w Pd6d7! (Adorjan_EofCE3) #788 draw 1R6/8/4b3/1P6/3k4/4p3/8/3K4/w Pb5b6! (Adorjan_EofCE3) #789 white_wins 8/3k4/R7/p2P4/1b1K4/8/8/8/w Kd4c4 (Adorjan_EofCE3) #790 draw 5r2/8/4k2P/4p1B1/6K1/8/8/8/b Rf8g8! (Adorjan_EofCE3) #791 black_wins 4k3/R7/4P3/p3K3/1b6/8/8/8/w Ra7a8+ (Adorjan_EofCE3) #792 draw 6kB/6P1/8/8/2p1r3/2K5/8/8/w Kc3b4 (Adorjan_EofCE3) #793 draw 8/8/4B3/3P4/5k1p/4r3/7K/8/b Re3e2+ (Adorjan_EofCE3) #794 black_wins 8/5k2/3P3B/1r5p/8/6K1/8/8/b Rb5b4! (Adorjan_EofCE3) #795 black_wins 8/4B3/3Pk3/7p/4r3/7K/8/8/b Re4d4 (Adorjan_EofCE3) #796 draw 8/3r4/8/2B1k3/1P6/8/4K1p1/8/w Ke2f3 (Adorjan_EofCE3) #797 black_wins 4B3/8/8/1P6/7k/6p1/1r6/6K1/w Be8c6! (Adorjan_EofCE3) #798 draw 8/2k5/6R1/1P6/2K5/5b2/6p1/8/b Bf3e4 (Adorjan_EofCE3) #799 white_wins 8/4K1k1/8/R2b1P2/8/8/p7/8/w Ra5a3 (Adorjan_EofCE3) #800 white_wins 8/1P6/5k2/6p1/1r6/6K1/6B1/8/b Kf6e5 (Adorjan_EofCE3) #801 draw 8/6k1/2B3p1/6r1/1P6/5K2/8/8/w Pb4b5 (Adorjan_EofCE3) #802 draw 7b/7P/6k1/8/8/8/1pK5/7R/w Kc2b1 (Adorjan_EofCE3) #803 white_wins 4B3/8/k7/P7/8/8/3r3p/7K/w Be8f7 (Adorjan_EofCE3) #804 draw 3B4/8/6k1/7p/P1K5/7r/8/8/w Pa4a5 (Adorjan_EofCE3) #805 draw 5k2/R7/3K1p2/5Pp1/6P1/1b6/8/8/w Ra7b7 (Adorjan_EofCE3) #806 white_wins 8/8/4B3/7p/6p1/4k1P1/3r3P/6K1/w Be6c8 (Adorjan_EofCE3) #807 draw 6k1/R7/4K1pp/6b1/6P1/7P/8/8/w Ra7a5 (Adorjan_EofCE3) #808 draw 8/6p1/7p/r7/7P/4kBK1/6P1/8/b Ra5a6! (Adorjan_EofCE3) #809 black_wins 8/5k2/R5p1/7p/3b4/6P1/6KP/8/w Kg2f3 (Adorjan_EofCE3) #810 draw 1k6/6R1/p1K5/1p6/8/1P2b3/P7/8/w Pb3b4 (Adorjan_EofCE3) #811 white_wins 8/1k6/p5R1/1p1K4/8/4b3/PP6/8/b Be3f2 (Adorjan_EofCE3) #812 draw 1k6/p5R1/1p1K4/8/4b3/8/PP6/8/w Pb2b4! (Adorjan_EofCE3) #813 white_wins 8/kp6/p1b5/2K5/8/7R/PP6/8/w Kc5d6 (Adorjan_EofCE3) #814 white_wins 2k5/pp6/3b4/8/8/8/PPK3R1/8/w Kc2c3 (Adorjan_EofCE3) #815 white_wins 8/2b5/5pk1/5R2/6Pp/7P/3K4/8/b Bc7d6 (Adorjan_EofCE3) #816 white_wins 8/5kp1/3R3p/4KP2/8/7b/7P/8/w Rd6d7+ (Adorjan_EofCE3) #817 white_wins 5r2/6k1/6p1/1p4P1/1P4K1/8/4B3/8/b Rf8f5! (Adorjan_EofCE3) #818 black_wins 8/8/4Kpk1/8/1p4P1/1PbR4/8/8/b Kg6g5 (Adorjan_EofCE3) #819 white_wins 8/8/1Pp5/1rBp4/3P1k2/3K4/8/8/b Kf4f5 (Adorjan_EofCE3) #820 black_wins 4k3/p7/4P3/1P6/8/5KpR/5b2/8/b Ke8e7 (Adorjan_EofCE3) #821 white_wins 8/6Kp/3P4/2Pr1kp1/8/8/8/5B2/w Bf1g2! (Adorjan_EofCE3) #822 draw 8/5p2/1p6/3k3P/7K/7P/4B3/7r/w Ph5h6! (Adorjan_EofCE3) #823 white_wins 6k1/3R4/6p1/3K1p1p/5P1P/6P1/1b6/8/w Kd5e6 (Adorjan_EofCE3) #824 white_wins 8/8/6p1/3k1p1p/5P1P/5KP1/1r6/5B2/b Rb2b3+ (Adorjan_EofCE3) #825 black_wins 8/7p/6p1/3k1p2/3r1P1P/6PK/2B5/8/b Rd4d2 (Adorjan_EofCE3) #826 black_wins 8/5p2/6pp/8/3k3P/5KP1/1r2BP2/8/b Rb2b3+ (Adorjan_EofCE3) #827 black_wins 8/5p1p/r5p1/8/2k4P/4B1P1/5PK1/8/b Kc4d3 (Adorjan_EofCE3) #828 black_wins 6k1/5ppp/8/8/1r6/5KP1/5P1P/5B2/b Pg7g5! (Adorjan_EofCE3) #829 black_wins 8/5p2/8/2B4p/r4p1P/3k1P2/6P1/5K2/w Bc5b6 (Adorjan_EofCE3) #830 draw 8/5p2/3k2p1/1p5P/4BKP1/rP6/8/8/w Pb3b4 (Adorjan_EofCE3) #831 black_wins 8/1p6/4p3/8/4b3/1P2Ppk1/P4R2/4K3/b Pb7b5! (Adorjan_EofCE3) #832a draw 8/1p6/4p3/8/4b3/1P2Ppk1/P4R2/4K3/w Pa2a4! (Adorjan_EofCE3) #832b white_wins 8/4kp2/5p2/2P4p/8/3BKPP1/7r/8/b Rh2g2 (Adorjan_EofCE3) #833 black_wins 2K5/6p1/rp2P3/3p4/8/6Pk/2BP4/8/w Kc8b8! (Adorjan_EofCE3) #834 white_wins 8/4k3/7p/6p1/6P1/pb2P2P/4RK2/8/b Pa3a2 (Adorjan_EofCE3) #835 black_wins 8/1pr2B2/p4K2/2k1P3/5P2/2p5/2P5/8/b Pb7b5 (Adorjan_EofCE3) #836 black_wins 8/7p/1Pk5/5p2/3BpK2/2P3P1/7r/8/b Rh2d2! (Adorjan_EofCE3) #837 black_wins 2k5/2b5/pp6/4p3/1P4P1/1KP2p2/1P1R4/8/w Rd2d5! (Adorjan_EofCE3) #838 white_wins 4R3/4b3/6kp/1P4p1/P2p4/4p1P1/7P/7K/b Be7c5! (Adorjan_EofCE3) #839 black_wins 8/8/1pk4p/p3p3/P1Pp1bP1/1P3P2/4K3/3R4/w Ke2d3 (Adorjan_EofCE3) #840 white_wins 3r1k2/p4p1p/1pB3p1/2p5/8/3P4/PPPK2PP/8/b Kf8e7 (Adorjan_EofCE3) #841 black_wins 8/5K1p/2k2B1P/6P1/8/5r2/8/8/b Kc6d7 (Adorjan_EofCE3) #842 draw 8/8/6pk/4Kbp1/8/6P1/5R2/8/w Rf2h2+ (Adorjan_EofCE3) #843 white_wins 8/8/2r3pP/6P1/8/K7/7k/3B4/w Bd1h5! (Adorjan_EofCE3) #844 white_wins 8/6k1/4R3/5pK1/4p1b1/6P1/8/8/w Re6e7+ (Adorjan_EofCE3) #845 white_wins 8/8/8/5P2/6Bp/4k2P/r7/5K2/b Ke3f4 (Adorjan_EofCE3) #846 black_wins 8/8/p7/P7/7B/5k1P/7K/3r4/b Rd1d5 (Adorjan_EofCE3) #847 black_wins 8/4bpk1/8/2p2KP1/8/8/8/R7/b Kg7f8 (Adorjan_EofCE3) #848 draw 3k4/8/5pb1/KR6/3P4/4p3/8/8/w Rb5b3 (Adorjan_EofCE3) #849 draw 8/5kBK/8/5pP1/7P/r7/8/8/w Pg5g6+ (Adorjan_EofCE3) #850 draw 8/5k1K/r6B/6Pp/5P2/8/8/8/w Pf4f5 (Adorjan_EofCE3) #851 draw 8/8/R7/P3k3/2ppb3/8/5K2/8/b Pc4c3 (Adorjan_EofCE3) #852 draw 8/8/1PkB4/2P5/4p1K1/5r2/8/8/w Bd6e5! (Adorjan_EofCE3) #853 draw 8/8/1P1Bp3/1rP5/3k4/8/3K4/8/w Kd2e2 (Adorjan_EofCE3) #854 draw 2R4b/7k/8/5KP1/3p4/2p5/8/8/b Bh8g7 (Adorjan_EofCE3) #855 white_wins 5b2/8/5P2/p3R3/kp6/8/5K2/8/w Kf2e2! (Adorjan_EofCE3) #856 white_wins 1b6/8/1P6/5K2/6pk/8/7p/4R3/w Re1e8 (Adorjan_EofCE3) #857 draw 8/p7/K5P1/8/2k1rP2/8/8/B7/w Ba1e5! (Adorjan_EofCE3) #858 white_wins 8/Kp6/1B1r2P1/8/1k6/7P/8/8/w Pg6g7 (Adorjan_EofCE3) #859 white_wins 8/8/8/3P4/6p1/K2R3b/3p4/4k3/w Pd5d6 (Adorjan_EofCE3) #860 draw 1kr5/4P1Pp/8/8/8/B7/7K/8/w Pe7e8=Q! (Adorjan_EofCE3) #861 white_wins 4k3/8/4K3/b7/8/4p3/6pP/2R5/w Ke6f5! (Adorjan_EofCE3) #862 draw 8/8/P2P1k1K/8/2p5/8/8/3r2B1/w Pa6a7 (Adorjan_EofCE3) #863 white_wins 8/8/2P5/2r5/4B1kp/8/5P2/6K1/b Rc5e5! (Adorjan_EofCE3) #864 black_wins 2R5/8/8/8/8/7k/P1p1Kp2/4b3/b Be1c3! (Adorjan_EofCE3) #865 black_wins 8/4r1k1/2K1P3/P2B4/1p6/8/8/8/b Kg7f6 (Adorjan_EofCE3) #866 draw 4k3/5R2/4P3/6p1/2p5/1bK5/8/8/w Kc3b4! (Adorjan_EofCE3) #867 white_wins 8/8/k7/P5B1/5p1P/4r3/2K5/8/b Re3e2+ (Adorjan_EofCE3) #868 draw 8/8/8/p1p1K3/P2r4/1PkB4/2P5/8/w Bd3g6 (Adorjan_EofCE3) #869 draw 8/3B4/3p1k2/3P4/4PP1p/4r3/6K1/8/w Bd7f5! (Adorjan_EofCE3) #870 draw r5k1/4Pp2/6p1/1K4P1/3B1P2/8/8/8/w Bd4f6! (Adorjan_EofCE3) #871 white_wins 8/8/6k1/R3K2p/2b3pP/6P1/p7/8/w Ra5a7 (Adorjan_EofCE3) #872 white_wins 8/6k1/8/P5pp/1K6/5B2/6PP/4r3/w Pa5a6! (Adorjan_EofCE3) #873 white_wins 8/4k3/R7/5p2/p4Kp1/6P1/2b4P/8/w Ra6c6 (Adorjan_EofCE3) #874 white_wins 8/8/R7/pp5p/2bK3k/2P5/6P1/8/w Ra6g6! (Adorjan_EofCE3) #875 white_wins 8/8/8/3p2p1/3b2P1/3P4/kpK5/1R6/w Rb1e1 (Adorjan_EofCE3) #876 black_wins 8/8/8/4p2p/4b2P/4P3/1kpK4/2R5/w Rc1e1 (Adorjan_EofCE3) #877 draw 8/1B6/2P5/5p2/3k3p/2r4P/3K1P2/8/w Pf2f4! (Adorjan_EofCE3) #878 draw 8/8/1B2k1p1/P2p2P1/3P2K1/8/8/r7/b Ke6d7 (Adorjan_EofCE3) #879 black_wins 8/8/5pk1/3R4/1p1pK1P1/1Pb5/8/8/w Ke4d3 (Adorjan_EofCE3) #880 white_wins R7/8/8/5p2/1k3KpP/p5P1/5b2/8/b Bf2e1! (Adorjan_EofCE3) #881 draw 8/6k1/7p/4ppb1/R7/P4K2/7P/8/b Pe5e4+ (Adorjan_EofCE3) #882 white_wins 8/8/5R2/8/1k6/2p3p1/PpP5/1K5b/w Rf6f4+ (Adorjan_EofCE3) #883 white_wins 8/pk6/6p1/4bp1p/KP6/7R/6PP/8/b Kb7c6 (Adorjan_EofCE3) #884 white_wins 8/8/2pk4/pppb2K1/6P1/1P1R4/P7/8/b Pc5c4 (Adorjan_EofCE3) #885 black_wins 8/5pk1/3R1p1p/8/4pPP1/3bK3/7P/8/w Pf4f5! (Adorjan_EofCE3) #886 white_wins 8/6k1/5p2/6p1/6Pp/2b2P1P/R2pK3/8/w Ra2c2 (Adorjan_EofCE3) #887 white_wins 8/5k2/5p2/6p1/5bPp/5P1P/R2pK3/8/w Ra2a3 (Adorjan_EofCE3) #888 draw 8/3k1p2/p5p1/2R4p/8/7P/b4PP1/6K1/w Pf2f3 (Adorjan_EofCE3) #889 white_wins 8/p4p1p/4k1p1/1R6/5P2/2b5/5PKP/8/b Pa7a5 (Adorjan_EofCE3) #890 draw 8/8/1p1p3p/2k3b1/2P5/2PKp1P1/8/1R6/w Rb1b2 (Adorjan_EofCE3) #891 white_wins 8/2B5/p2Pk3/P5pp/8/3r3P/5PK1/8/b Ke6f5 (Adorjan_EofCE3) #892 black_wins 5r2/7p/6p1/2k1p3/2B1P1KP/1P4P1/8/8/b Ph7h6 (Adorjan_EofCE3) #893 black_wins 5k2/2R5/5bpp/8/3p1PP1/2pK4/7P/8/w Ph2h4 (Adorjan_EofCE3) #894 white_wins 8/8/7p/8/p1p3P1/1pPb1KPk/3R4/8/w Rd2d1 (Adorjan_EofCE3) #895 draw 8/8/2pk4/R1p5/2Pp2p1/1P1b4/P4K2/8/w Ra5a7! (Adorjan_EofCE3) #896 white_wins 2r5/p6p/5k2/1P1B4/P1P5/8/4P2p/7K/w Pa4a5 (Adorjan_EofCE3) #897 white_wins 8/5p2/p2k2pr/1p6/7P/P2BK1P1/1PP5/8/w Pc2c4! (Adorjan_EofCE3) #898 draw 8/6p1/p4bk1/1p1R1p2/4p3/8/PP3P1P/1K6/w Kb1c2 (Adorjan_EofCE3) #899 white_wins 3k4/8/2KP1r2/5ppp/P1B5/1P2p3/6PP/8/b Rf6e6! (Adorjan_EofCE3) #900 draw 6k1/7p/6p1/3p2P1/p1pP4/P1B4P/1P4PK/5r2/b Ph7h5 (Adorjan_EofCE3) #901 draw 8/3k2p1/1p3p1p/p2KpP1P/Pb4P1/1P5R/8/8/w Pg4g5! (Adorjan_EofCE3) #902 white_wins 8/1bk2ppp/8/p2p4/P1pP4/2K2P2/6PP/2R5/w Rc1e1! (Adorjan_EofCE3) #903 white_wins r7/4k1Pp/4p1p1/p1P1P3/P1pB2PK/2P5/8/8/w Kh4g5 (Adorjan_EofCE3) #904 draw 8/5k1K/5rpB/8/5PPP/8/8/8/w Pg4g5! (Adorjan_EofCE3) #905 draw 1r6/8/6p1/2B2k2/1P3P2/5K2/7P/8/w Kf3e3! (Adorjan_EofCE3) #906 draw 8/p7/1b6/6k1/4K1pp/R7/7P/8/b Ph4h3! (Adorjan_EofCE3) #907 black_wins 1B6/3k1p2/r7/2PP4/5P2/2K5/8/8/b Ra6a4 (Adorjan_EofCE3) #908 white_wins 6b1/8/p7/P2pk3/2pR4/4K3/8/8/w Rd4h4 (Adorjan_EofCE3) #909 draw 8/2k5/4K3/1p6/1B2P2r/P4P2/8/8/w Pf3f4! (Adorjan_EofCE3) #910 white_wins 4k3/8/2pK4/2Pp1b2/7R/7p/8/8/w Rh4h5 (Adorjan_EofCE3) #911 white_wins 8/7B/2P5/pk6/6r1/P7/K1P5/8/w Pc6c7 (Adorjan_EofCE3) #912 white_wins 1k6/8/1PP5/8/3KB1p1/5P2/8/6r1/b Rg1d1+ (Adorjan_EofCE3) #913 white_wins 8/6kP/6P1/8/8/B2p4/4r1P1/6K1/w Ba3f8+ (Adorjan_EofCE3) #914 draw 8/8/8/6p1/RP5b/5p1k/5p2/5K2/w Pb4b5 (Adorjan_EofCE3) #915 white_wins 8/4k1K1/2P3P1/3B4/4P3/p7/8/7r/w Pe4e5 (Adorjan_EofCE3) #916 draw 8/8/4kP2/p5Pp/P6P/2K5/3B2r1/8/w Kc3d3! (Adorjan_EofCE3) #917 draw 8/4k1p1/R4b1p/3p1K2/4p1P1/8/6P1/8/b Pe4e3! (Adorjan_EofCE3) #918 black_wins 2R5/4ppk1/p6p/8/8/8/P2b2KP/8/w Pa2a3! (Adorjan_EofCE3) #919 white_wins 8/4kp1p/8/5P2/P1B5/1P3K2/r4P2/8/b Pf7f6 (Adorjan_EofCE3) #920 black_wins R7/pp3k2/1b6/1P2P1pp/8/3K4/8/8/w Ra8h8! (Adorjan_EofCE3) #921 white_wins 8/5kp1/7p/p6P/1p1bP3/1R6/4K3/8/w Rb3d3 (Adorjan_EofCE3) #922 draw 4R3/p7/8/2P2kp1/4b2p/6pK/P7/8/w Re8xBe4! (Adorjan_EofCE3) #923 draw 1k6/p4p2/P1p5/2B5/1PP2P2/2KP4/8/7r/w Pb4b5 (Adorjan_EofCE3) #924 white_wins 8/5pk1/3pp3/p3b1p1/P3P3/2P5/2R1K3/8/w Pc3c4 (Adorjan_EofCE3) #925 white_wins 8/7p/4k3/p4p1p/P2Rb3/3p2K1/1P4P1/8/w Kg3f4! (Adorjan_EofCE3) #926 draw 8/8/2pk2pp/pppb4/5KPP/1P1R4/P7/8/b Pg6g5+! (Adorjan_EofCE3) #927 draw 8/1p6/p1p2p2/2Ppbkp1/8/2P5/PP2R1K1/8/w Re2e1 (Adorjan_EofCE3) g4! #928 black_wins 8/4k1r1/ppp4p/3pPB2/PP1P4/2P2KP1/7P/8/w Kf3f4 (Adorjan_EofCE3) #929 white_wins 8/5kp1/8/4bp2/8/2p2P2/1pK5/7R/b Pg7g5 (Adorjan_EofCE3) #930 black_wins 1b6/1P2p1k1/8/5p2/6pp/R7/4K3/8/w Ra3a8 (Adorjan_EofCE3) #931 draw 8/4k1pp/4p3/1p1pP3/p1bK3P/6P1/8/2R5/w Rc1a1 (Adorjan_EofCE3) #932 black_wins 3b4/pK1Rp3/1p5p/k2p4/8/PP6/6p1/8/w Kb7c6! (Adorjan_EofCE3) #933 white_wins 7r/p3k3/2p5/1pPp4/3P4/PP4P1/3P1PB1/2K5/w Kc1d1! (Adorjan_EofCE3) #934 draw n7/8/8/8/8/2K5/7R/nk6/w Rh2b2+ (Adorjan_EofCE3) #935 white_wins 1r6/2k1PK2/8/8/8/8/1N1N4/8/w Nd2e4 (Adorjan_EofCE3) #936 white_wins 1K3N2/5P2/8/8/4k3/8/2r5/1N6/w Nb1c3+! (Adorjan_EofCE3) #937 white_wins 8/8/4P3/k1N4r/8/K3N3/8/8/w Pe6e7 (Adorjan_EofCE3) #938 white_wins 8/8/5P2/1k1r4/7K/8/2NN4/8/w Pf6f7 (Adorjan_EofCE3) #939 white_wins 3n4/8/n6R/3p4/8/K3p3/8/1k6/w Ka3b3 (Adorjan_EofCE3) #940 black_wins 8/8/1P6/8/1rN1k2K/7N/2P5/8/w Pc2c3! (Adorjan_EofCE3) #941 white_wins 8/1N6/1P6/8/2k5/r7/P7/4KN2/w Nb7d6+! (Adorjan_EofCE3) #942 white_wins 8/K6N/3k2P1/8/2P5/8/2N5/5r2/w Pc4c5+! (Adorjan_EofCE3) #943 draw 3k4/6n1/2KP1n2/8/8/8/8/7R/w Rh1h8+ (Adorjan_EofCE3) #944 draw 8/K7/1P3k2/2n5/1R6/1n6/8/8/w Rb4b5! (Adorjan_EofCE3) #945 white_wins 1n6/8/8/7k/8/n7/5RP1/7K/w Rf2f5+ (Adorjan_EofCE3) #946 white_wins 4n2k/8/5nP1/7P/8/4K3/3R4/8/w Ph5h6! (Adorjan_EofCE3) #947 white_wins 8/5nk1/R6n/5P1P/5K2/8/8/8/w Pf5f6+ (Adorjan_EofCE3) #948 draw 8/8/8/8/pnp5/1k1nR3/1P6/1K6/b Pa4a3! (Adorjan_EofCE3) #949 black_wins 8/3k1pp1/1n2p2p/8/3nP3/P4P2/5K2/2R5/w Pf3f4 (Adorjan_EofCE3) #950 black_wins 7n/RP6/8/pp6/1k6/8/2p5/K5n1/w Ka1b2 (Adorjan_EofCE3) #951 white_wins 4k3/8/8/P7/p3p3/p3K2R/n7/1n6/w Pa5a6 (Adorjan_EofCE3) #952 white_wins 4N3/8/3Nr3/4k3/3p4/3P4/5K2/8/w Nd6f7+ (Adorjan_EofCE3) #953 white_wins n2R4/k1nK4/1p6/1P6/8/8/8/8/w Rd8xNa8+! (Adorjan_EofCE3) #954 white_wins 7N/8/3P3N/6pK/8/8/8/1rk5/w Pd6d7 (Adorjan_EofCE3) #955 white_wins 3r4/2p4P/8/6K1/5N2/2k5/1N6/8/w Nb2a4+! (Adorjan_EofCE3) #956 white_wins 2N1r3/6KN/5P2/p2k4/8/8/8/8/w Pf6f7 (Adorjan_EofCE3) #957 white_wins 8/1N6/p7/5p2/3rk3/P7/4K1PN/8/w Nh2f3 (Adorjan_EofCE3) #958 white_wins 8/6pp/4nk2/1R6/5n2/5PK1/5P2/8/b Pg7g5 (Adorjan_EofCE3) #959 black_wins R5n1/4n2p/4K2P/2k3P1/1p6/8/8/8/w Ra8b8! (Adorjan_EofCE3) #960 white_wins 7k/r6p/5NpP/3KNpP1/5P2/8/8/8/w Nf6d7 (Adorjan_EofCE3) #961 draw 8/5n1k/R4Kn1/7p/7P/6P1/8/8/b Nf7h8! (Adorjan_EofCE3) #962 draw 7r/P3kpp1/8/4N3/K7/5N2/8/8/w Ne5c6+ (Adorjan_EofCE3) #963 white_wins 8/1N2kp1p/p4p2/P1N5/1r6/7P/6P1/7K/b Pf6f5 (Adorjan_EofCE3) #964 draw 1K6/5p2/5P2/n1P1P3/2P3n1/7R/1p6/2k5/w Rh3h1+ (Adorjan_EofCE3) #965 draw 6k1/5p2/p6p/4p1p1/4N3/4K1P1/P6P/3rN3/w Ke3f3 (Adorjan_EofCE3) #966 black_wins 8/8/8/3R4/8/3K4/n3p2b/1k6/w Kd3d2! (Adorjan_EofCE3) #967 draw 1k6/1P1r4/1K1N4/8/8/8/3B4/8/w Bd2f4 (Adorjan_EofCE3) #968 white_wins 8/6P1/4k3/6r1/3B4/3KN3/8/8/w Kd3e4 (Adorjan_EofCE3) #969 white_wins 8/8/7b/5k2/5n1K/6R1/6p1/8/w Rg3xPg2! (Adorjan_EofCE3) #970 draw 8/8/8/8/3bn1k1/7p/R7/7K/w Ra2c2 (Adorjan_EofCE3) #971 draw 8/8/8/7b/8/R4nkp/8/7K/b Bh5e8 (Adorjan_EofCE3) #972 black_wins 6k1/8/r2BK2P/6N1/8/8/8/8/w Ke6e5 (Adorjan_EofCE3) #973 white_wins 8/8/4R3/5K2/8/4b2p/3k4/7n/w Kf5g4 (Adorjan_EofCE3) #974 draw 8/4R3/5n2/3b4/3Kpk2/8/8/8/w Re7e5 (Adorjan_EofCE3) #975 draw 8/6N1/8/2B1P3/4r2k/K7/8/8/w Bc5e7+! (Adorjan_EofCE3) #976 white_wins 8/8/8/4k3/r7/3BNP2/5K2/8/w Ne3g2 (Adorjan_EofCE3) #977 white_wins 1NB5/8/6P1/6r1/3k4/8/7P/7K/w Nb8c6+ (Adorjan_EofCE3) #978 white_wins b6n/6RP/8/5k2/8/3K4/8/8/w Rg7g8 (Adorjan_EofCE3) #979 white_wins 1k6/8/3P4/3n4/3R4/8/6K1/1b6/w Kg2f3 (Adorjan_EofCE3) #980 draw 8/8/5P2/2n5/5K1R/8/k7/5b2/w Pf6f7 (Adorjan_EofCE3) #981 white_wins 8/8/8/P1k1b3/n7/8/8/1R3K2/w Pa5a6 (Adorjan_EofCE3) #982 white_wins 6k1/8/8/4R3/5K2/8/1P2b3/2n5/w Kf4e3! (Adorjan_EofCE3) #983 white_wins 2b5/2n2K1k/8/8/8/8/RP6/8/w Ra2a1 (Adorjan_EofCE3) #984 white_wins 1n6/7k/8/b7/8/4R3/6P1/3K4/w Re3b3 (Adorjan_EofCE3) #985 white_wins 8/4nk2/8/1R3PP1/3b2K1/8/8/8/w Rb5b7 (Adorjan_EofCE3) #986 white_wins 4b2K/8/1R6/1P6/4P3/6k1/8/2n5/w Pe4e5 (Adorjan_EofCE3) #987 white_wins 6k1/8/8/b6P/8/7R/2Kn3P/8/w Rh3g3+! (Adorjan_EofCE3) #988 white_wins 8/4K3/2B3k1/r5p1/4N1P1/7P/8/8/b Ra5a3 (Adorjan_EofCE3) #989 white_wins 8/8/6r1/1NPk4/4p3/4B3/5P1K/8/w Nb5c3+ (Adorjan_EofCE3) #990 white_wins 8/1n6/6P1/7k/8/pp6/3R4/1K3b2/w Pg6g7 (Adorjan_EofCE3) #991 draw 1R6/8/P3b1p1/k7/8/7n/p5K1/8/w Pa6a7 (Adorjan_EofCE3) #992 draw 7B/8/4k2P/P7/1p6/r1N5/1K6/8/w Ph6h7! (Adorjan_EofCE3) #993 white_wins 8/5k1p/5p2/1P3N1P/1r6/3BKP2/8/8/w Bd3c4+! (Adorjan_EofCE3) #994 white_wins 8/8/5k2/p7/P5B1/4N3/3K4/1r6/b Kf6e5! (Adorjan_EofCE3) #995 draw 6k1/6p1/8/3K1PN1/3B4/8/8/1r6/w Ng5e6 (Adorjan_EofCE3) #996 draw 1B6/8/1P6/8/3p2r1/2k5/7K/N7/w Pb6b7 (Adorjan_EofCE3) #997 draw 8/5p2/2kN3P/7K/8/8/8/B4r2/w Ba1f6! (Adorjan_EofCE3) #998 white_wins 7K/7p/1P6/8/6rB/8/4k3/5N2/w Nf1e3! (Adorjan_EofCE3) #999 white_wins r7/P4k2/2N5/8/5B1p/8/8/4K3/b Kf7e6 (Adorjan_EofCE3) #1000 draw 1r6/8/4p3/6p1/2K1B1P1/3NkP2/8/8/w Kc4c5 (Adorjan_EofCE3) #1001 white_wins 8/5p2/7k/7p/4KN2/r3B1PP/8/8/b Kh6g5 (Adorjan_EofCE3) #1002 white_wins 8/1K4p1/1p4P1/8/3kN2B/8/3P4/r7/w Bh4f6+! (Adorjan_EofCE3) #1003 white_wins 4k3/8/pN4P1/8/5r2/5p2/1P3B2/1K6/w Nb6d5 (Adorjan_EofCE3) #1004 white_wins 2R5/8/1p6/p1p1k1b1/P1P1n1K1/1P6/8/8/b Ke5d4 (Adorjan_EofCE3) #1005 black_wins 8/8/1pkNK3/p1p1B3/P1P5/8/1P1r4/8/w Nd6f5 (Adorjan_EofCE3) #1006 draw 8/5kp1/5p1p/8/4NPP1/r7/5BKP/8/b Ra3b3 (Adorjan_EofCE3) #1007 draw 6k1/5pp1/r3p2p/2B1P3/4K2P/3N2P1/5P2/8/w Ph4h5! (Adorjan_EofCE3) #1008 white_wins 6k1/1R3p1p/1p4p1/2b1n3/8/8/PP4PP/7K/w Pb2b4! (Adorjan_EofCE3) #1009 draw r7/5pk1/5p2/8/ppB5/1P3KPN/P6P/8/b Ra8c8! (Adorjan_EofCE3) #1010 draw 1R6/8/5k1p/n2K3P/P7/4b3/8/8/w Kd5e4! (Adorjan_EofCE3) #1011 white_wins 8/4N3/8/4p3/B3p1rk/8/1P6/7K/w Ba4d1! (Adorjan_EofCE3) #1012 white_wins 6k1/5p1p/4rp2/5N2/4B3/5K2/6PP/8/w Ph2h4 (Adorjan_EofCE3) #1013 draw 6R1/1k1b4/3P4/5p2/1K4p1/8/5PP1/n7/w Rg8g7! (Adorjan_EofCE3) #1014 white_wins 8/8/2p5/3k4/p1p5/PpP5/1P2B3/r1NK4/w Be2f3+ (Adorjan_EofCE3) #1015 draw r5k1/5ppp/8/5P2/p7/6PP/N3K3/4B3/b Ra8e8+ (Adorjan_EofCE3) #1016 black_stands_slightly_better 8/6r1/4k3/4p1pp/p3P1P1/4B2P/2N1K3/8/b Ph5h4! (Adorjan_EofCE3) #1017 black_wins 2k5/p4p2/1p3N2/8/P3p3/2P4r/1PK2B2/8/w Kc2d2 (Adorjan_EofCE3) #1018 white_wins 8/p3k3/1p2p1p1/2p1B1N1/P1K2PP1/8/1P6/3r4/w Kc4b5 (Adorjan_EofCE3) #1019 white_wins 7r/p3N3/1kp4p/3p2p1/3P4/4P3/P1B1KP2/8/w Ne7g6 (Adorjan_EofCE3) #1020 draw 6k1/p5pp/5p2/1r6/5P2/2B2KP1/pPN4P/8/w Nc2a1 (Adorjan_EofCE3) #1021 black_wins 8/8/4K3/3P2k1/4nb1p/5R1P/6P1/8/w Rf3a3 (Adorjan_EofCE3) #1022 draw 6k1/8/P7/4p3/2N2p1p/3r4/3B4/4K3/w Bd2a5! (Adorjan_EofCE3) #1023 white_wins 8/k7/1n4R1/3b4/pP3P2/2K5/7P/8/w Ph2h4 (Adorjan_EofCE3) #1024 white_wins 8/p1K1N3/1r5P/p1p5/8/5k2/8/5B2/w Ne7c6 (Adorjan_EofCE3) #1025 white_wins 8/5pk1/6p1/1pp5/1r6/1BN1K1P1/P7/8/w Bb3d5! (Adorjan_EofCE3) #1026 draw 8/8/1r3kp1/1p1p3p/1P1N1B1P/3K4/8/8/w Bf4c7 (Adorjan_EofCE3) #1027 draw 8/3nkppb/4p2p/2P5/1P6/6P1/4PP1P/3R2K1/w Pc5c6 (Adorjan_EofCE3) #1028 white_wins k3r3/2pp3p/2p1p3/4NP2/1P6/4K3/4B3/8/w Pf5f6 (Adorjan_EofCE3) #1029 white_wins 8/2p5/pp6/2p2pp1/6k1/r1P3P1/P5K1/2N1B3/b Pc5c4 (Adorjan_EofCE3) #1030 black_wins 8/8/3BB3/8/8/5r2/3K4/k7/w Kd2e2! (Adorjan_EofCE3) #1031 white_wins 8/8/8/8/5bk1/7p/2R1b3/6K1/b Be2f3! (Adorjan_EofCE3) #1032 black_wins 8/8/8/3b4/5b1k/7p/1R6/6K1/b Kh4g3 (Adorjan_EofCE3) #1033 black_wins 8/8/8/1k6/2b5/R4Kp1/8/4b3/w Kf3g2 (Adorjan_EofCE3) #1034 draw 8/2K4B/8/k3P3/7B/7r/8/8/w Bh4e1+ (Adorjan_EofCE3) #1035 white_wins 8/8/8/6K1/3k4/1B4B1/3p4/5r2/b Kd4c3 (Adorjan_EofCE3) #1036 draw 8/8/8/6B1/8/6k1/5rBp/7K/w Bg5e7! (Adorjan_EofCE3) #1037 draw 8/8/4B2B/3r3k/8/3p3K/8/8/w Bh6e3! (Adorjan_EofCE3) #1038 white_wins 7k/b7/6b1/1RP5/8/K7/8/8/w Pc5c6 (Adorjan_EofCE3) #1039 white_wins 8/8/3B3k/6pp/8/3BK3/r7/8/b Ph5h4 (Adorjan_EofCE3) #1040 black_wins 8/4k3/3b4/7R/P3b3/4P3/4K3/8/w Rh5h4 (Adorjan_EofCE3) #1041 draw 5B2/1pr5/2p5/7p/8/7B/8/k3K3/w Bf8d6 (Adorjan_EofCE3) #1042 white_wins 6K1/7P/k6p/7R/6p1/2b4b/8/8/w Rh5c5! (Adorjan_EofCE3) #1043 white_wins k2K4/8/1P6/8/1R6/3p4/1p2bb2/8/w Kd8c8! (Adorjan_EofCE3) #1044 draw 1K6/4p3/8/1B1P4/8/1k4B1/3r4/8/w Bb5d7 (Adorjan_EofCE3) #1045 draw 4k3/b1P5/6p1/3RKb2/8/8/8/8/w Ke5d6 (Adorjan_EofCE3) #1046 white_wins 8/1b6/1P6/4b3/6k1/7p/R7/6K1/b Bb7f3! (Adorjan_EofCE3) #1047a black_wins 8/1b6/1P6/4b3/6k1/7p/R7/6K1/w Ra2e2 (Adorjan_EofCE3) #1047b black_wins 1b6/1P6/2b5/8/6k1/7p/1R6/6K1/b Bc6f3 (Adorjan_EofCE3) #1048 draw b7/P1b5/8/8/6k1/7p/R7/6K1/b Bc7f4 (Adorjan_EofCE3) #1049 draw 8/5b2/8/R6p/3b2pP/6P1/4k1K1/8/b Bf7b3 (Adorjan_EofCE3) #1050 draw 7k/7P/4B2P/8/rp6/p2KB3/8/8/w Be6g8 (Adorjan_EofCE3) #1051 white_wins 1r2B1k1/4P3/p6P/2p5/8/8/1B4K1/8/w Ph6h7+! (Adorjan_EofCE3) #1052 white_wins 4r2k/6p1/5p1p/7P/3BBPP1/5K2/8/8/w Kf3e3 (Adorjan_EofCE3) #1053 draw 8/3r3k/6p1/4Bp1p/2B2P2/7P/4K1P1/8/w Ke2e3 (Adorjan_EofCE3) #1054 draw 8/6kp/6p1/P1KB4/7B/8/4p1PP/3r4/b Rd1a1 (Adorjan_EofCE3) #1055 white_wins 8/2R5/3pbkp1/4p3/3bP1p1/3P2P1/5P2/5K2/b Pd6d5! (Adorjan_EofCE3) #1056 black_wins 7r/p5p1/1pk2pB1/8/2P4P/2K1B1P1/5P2/8/w Bg6e4+ (Adorjan_EofCE3) #1057 white_wins 8/1p4p1/1P1b2P1/KP5k/P3p3/1p6/3R4/7b/w Rd2d5+! (Adorjan_EofCE3) #1058 draw 8/p7/1p2B1p1/1P4kp/3Bp1p1/4P1P1/P4PKP/2r5/w Pa2a4 (Adorjan_EofCE3) #1059 white_wins 8/1pr2k1K/1p3P2/8/B7/8/8/4B3/w Be1h4 (Adorjan_EofCE3) #1060 white_wins 6bb/7p/6P1/6kP/K7/p7/P7/1R6/w Rb1b5+! (Adorjan_EofCE3) #1061 white_wins 8/8/5p2/P1kb3P/R2bp3/8/5PK1/8/b Pe4e3+ (Adorjan_EofCE3) #1062 black_wins 8/7p/1B4p1/1P6/4rk2/5p2/7P/5BK1/w Kg1f2 (Adorjan_EofCE3) #1063 white_wins 2k5/6pB/1K6/P7/7B/5p1P/3p2r1/8/w Bh7f5+ (Adorjan_EofCE3) #1064 white_wins r4k2/4p2p/4P1p1/8/p2B4/8/P4K1P/3B4/b Ra8a6 (Adorjan_EofCE3) #1065 draw 8/8/3kb3/1p3p1p/3Pp3/b3P1P1/2R2PP1/1K6/w Rc2c3 (Adorjan_EofCE3) #1066 black_wins 5k2/3r1p2/5Bp1/8/ppK3P1/8/4B2P/8/b Rd7d2 (Adorjan_EofCE3) #1067 black_wins 8/p2P1p2/3rp3/p7/P1B5/k1K5/8/B7/w Bc4b5 (Adorjan_EofCE3) #1068 white_wins 2k5/8/3r1N2/2N3B1/8/8/8/4K3/w Nf6g8 (Adorjan_EofCE3) #1069 white_wins 8/8/1N6/8/3r4/4k2N/4B3/4K3/w Nh3g5 (Adorjan_EofCE3) #1070 white_wins 6k1/2B5/8/1pr5/8/8/2B5/1N5K/w Bc2b3+ (Adorjan_EofCE3) #1071 white_wins 8/p5pk/1R6/2p5/8/2p5/PN4PP/6K1/b Pc5c4! (Adorjan_EofCE3) #1072 black_wins 8/8/2p5/pkp3R1/7B/P7/2p3K1/8/w Pa3a4+! (Adorjan_EofCE3) #1073 draw 3r4/1k6/3P1K2/8/4N3/1n6/8/8/w Kf6e7 (Adorjan_EofCE3) #1074 draw 8/6N1/8/8/4p3/6n1/5k2/3KR3/w Ng7e6 (Adorjan_EofCE3) #1075 white_wins 8/8/8/5k2/5N2/1PK1n3/8/4r3/w Kc3d2 (Adorjan_EofCE3) #1076 draw 8/8/1KR1P1kp/7p/5b2/8/N6p/8/w Pe6e7+ (Adorjan_EofCE3) #1077 white_wins 8/8/3P4/5PN1/8/6kb/6r1/1K6/w Pd6d7! (Adorjan_EofCE3) #1078 draw 8/1k5B/8/8/4Kn2/8/6Pp/2R5/b Nf4e2 (Adorjan_EofCE3) #1079 white_wins 3k1N2/2p5/4r1P1/3P3K/1p6/3b2P1/8/8/w Pg6g7! (Adorjan_EofCE3) #1080 white_wins 6r1/P4N2/1b2P3/1k6/8/1p6/1P1K4/8/w Pe6e7 (Adorjan_EofCE3) #1081 draw 7B/p7/1pR1p3/3n1p2/k2P4/2p2KP1/8/8/b Ka4b3 (Adorjan_EofCE3) #1082 black_wins 8/8/8/4Bb1k/5Pp1/8/4K2p/R7/b Pg4g3 (Adorjan_EofCE3) #1083 black_wins 8/k7/7R/2P4K/4bp2/8/2p5/6B1/w Pc5c6+ (Adorjan_EofCE3) #1084 draw 7K/1b5P/8/1Pk1P3/2P4B/8/8/r7/w Kh8g7 (Adorjan_EofCE3) #1085 white_wins 8/5b2/2BP4/5r2/8/6k1/8/2K5/w Pd6d7 (Adorjan_EofCE3) #1086 draw 8/5b2/2BP4/5r2/8/8/7k/2K5/w Pd6d7 (Adorjan_EofCE3) #1087 draw 8/6B1/1r1P4/8/4K3/8/7b/2k5/w Bg7e5 (Adorjan_EofCE3) #1088 draw 8/4R3/4B1k1/7p/4b3/7K/8/8/b Kg6f6 (Adorjan_EofCE3) #1089 white_wins 6BK/8/P2P3k/8/8/7b/1r6/8/w Pa6a7 (Adorjan_EofCE3) #1090 white_wins 3k2r1/8/2KN4/8/8/4R3/8/8/w Re3e4! (Adorjan_EofCE3) #1091 white_wins 4k3/8/3K4/6N1/7r/5R2/8/8/w Ng5e6 (Adorjan_EofCE3) #1092 draw 4k1r1/8/8/5K2/8/8/2R4N/8/w Rc2c8+ (Adorjan_EofCE3) #1093 white_wins r4k2/1R6/3N1K2/8/8/8/8/8/w Rb7c7 (Adorjan_EofCE3) #1094 white_wins 2k5/4R3/1K2N2r/8/8/8/8/8/w Re7c7+ (Adorjan_EofCE3) #1095 draw 4rk2/8/R5K1/5N2/8/8/8/8/w Ra6f6+ (Adorjan_EofCE3) #1096 white_wins 1k6/8/1K6/1N6/1r6/8/8/2R5/w Kb6c6 (Adorjan_EofCE3) #1097 draw 6k1/8/6K1/6N1/8/8/4R3/5r2/w Re2e3 (Adorjan_EofCE3) #1098 white_wins 8/8/8/8/3R4/5K2/2r4k/3N4/w Nd1e3 (Adorjan_EofCE3) #1099 white_wins 7k/8/5NK1/8/8/1r6/3R4/8/b Rb3g3+ (Adorjan_EofCE3) #1100 white_wins r6k/1R6/4NK2/8/8/8/8/8/w Kf6g6 (Adorjan_EofCE3) #1101 white_wins 7k/R4KN1/8/8/8/8/8/7r/w Ng7h5! (Adorjan_EofCE3) #1102 white_wins 7k/1R6/5N2/8/7r/8/3K4/8/w Kd2d3 (Adorjan_EofCE3) #1103 draw 7k/8/5N2/8/r7/2K5/1R6/8/w Rb2g2! (Adorjan_EofCE3) #1104 white_wins 8/2k3Nr/8/3K4/1R6/8/8/8/w Ng7e8+ (Adorjan_EofCE3) #1105 white_wins 8/2r5/3k4/2N4R/3K4/8/8/8/w Rh5h6+ (Adorjan_EofCE3) #1106 draw 8/r2n4/3k4/8/3K4/8/1R6/8/w Rb2d2 (Adorjan_EofCE3) #1107 draw 3k4/1R1P4/7r/1N6/3K4/8/8/8/w Nb5c3 (Adorjan_EofCE3) #1108 white_wins 8/2k5/8/6R1/4p3/8/1r2n3/4K3/w Rg5g2! (Adorjan_EofCE3) #1109 draw 3r4/8/6k1/6P1/4N2R/8/2K5/8/b Kg6f5 (Adorjan_EofCE3) #1110 draw 8/6k1/2R5/2pK4/8/3n4/8/4r3/w Rc6c7+ (Adorjan_EofCE3) #1111 draw 1R6/8/8/8/2kP4/1N6/7r/5K2/w Rb8b7 (Adorjan_EofCE3) #1112 white_wins 8/8/8/8/1kP5/N6R/6r1/4K3/w Ke1d1 (Adorjan_EofCE3) #1113 draw 8/7k/5K2/8/5NR1/p7/8/5r2/w Kf6f7 (Adorjan_EofCE3) #1114 white_wins 2R1N1kr/8/3K4/2p5/8/8/8/8/w Kd6e7! (Adorjan_EofCE3) #1115 white_wins 6rk/1R6/4N3/4K1p1/8/8/8/8/b Rg8a8 (Adorjan_EofCE3) #1116 white_wins 6k1/2R5/8/4N1Kp/8/7r/8/8/b Rh3g3+ (Adorjan_EofCE3) #1117a draw 6k1/2R5/8/4N1Kp/8/7r/8/8/w Ne5g6! (Adorjan_EofCE3) #1117b white_wins 2r1k3/7R/1p4N1/1Kp5/8/8/8/8/w Ng6e5 (Adorjan_EofCE3) #1118 white_wins 8/5p2/5R2/8/2p2N2/4K3/2r4k/8/w Nf4e2 (Adorjan_EofCE3) #1119 white_wins 8/2K5/6p1/kr6/2p5/2R1N3/8/8/w Rc3a3+ (Adorjan_EofCE3) #1120 white_wins 4r3/4P2k/2P5/4R1P1/8/7n/3K4/8/w Pc6c7 (Adorjan_EofCE3) #1121 white_wins 3k1n2/8/2P4r/2R1P3/6K1/P7/6P1/8/b Rh6g6+ (Adorjan_EofCE3) #1122 draw 7k/5prp/3p1N1R/3p4/8/1K6/8/8/w Kb3b4 (Adorjan_EofCE3) #1123 white_wins 8/7r/2p2pp1/2p3p1/k5p1/3KN1p1/8/1R6/w Kd3c4 (Adorjan_EofCE3) #1124 white_wins r4k2/1R6/3p1N2/8/3P4/7P/p5PK/8/w Rb7d7! (Adorjan_EofCE3) #1125 draw 2r4k/1R6/8/4P2N/Kp5p/3P3P/1pP3P1/8/w Nh5f6 (Adorjan_EofCE3) #1126 white_wins 8/p7/P4N2/6r1/8/3k4/K7/7R/w Ka2b3 (Adorjan_EofCE3) #1127 white_wins 2k5/2p3K1/8/2Pr4/6N1/8/8/6R1/w Pc5c6 (Adorjan_EofCE3) #1128 white_wins 8/4k3/4n1K1/7p/8/7r/R6P/8/w Ra2d2! (Adorjan_EofCE3) #1129 draw 5k2/3R1p2/8/4P3/4K3/3N4/8/6r1/w Nd3f4 (Adorjan_EofCE3) #1130 white_wins 8/8/2p5/6N1/kP5r/3K4/8/1R6/w Ng5e4 (Adorjan_EofCE3) #1131 white_wins 8/2R1p1N1/7r/4k3/8/3P4/4K3/8/b Ke5f6 (Adorjan_EofCE3) #1132 white_wins 3R4/8/8/8/5pk1/8/7P/2rN2K1/b Rc1a1! (Adorjan_EofCE3) #1133 draw 7R/8/8/8/3p1K2/r5N1/6kP/8/w Rh8h5! (Adorjan_EofCE3) #1134 white_wins 8/8/P5pK/8/1kN3R1/8/r7/8/w Nc4a3+! (Adorjan_EofCE3) #1135 white_wins 8/2R5/8/P7/r1N3k1/4K1p1/8/8/b Ra4a1!,Ra4a2,Pg3g2 (Adorjan_EofCE3) #1136 white_wins all of these tries by black fail to save the game, but the first is the most complicated and therefore the best in practical play. 8/k7/8/1K1N4/P7/7r/7p/7R/w Nd5f6 (Adorjan_EofCE3) #1137 draw 7k/1R6/8/5N2/5Kp1/7p/P5rP/8/w Nf5h4! (Adorjan_EofCE3) #1138 white_wins 2R5/5pk1/6p1/4K1P1/4N3/4r3/8/8/b Re3e1 (Adorjan_EofCE3) #1139 draw 8/8/6pk/r5Np/3R1K1P/8/8/8/w Ng5f7+ (Adorjan_EofCE3) #1140 white_wins 8/8/8/p5k1/1p6/7r/PRN1K3/8/w Rb2b3 (Adorjan_EofCE3) #1141 white_wins 8/8/4R1pk/7p/1r6/7P/4NK2/8/w Ne2g1! (Adorjan_EofCE3) #1142 white_wins 8/4R2p/5p2/8/2NK2k1/6P1/7r/8/w Kd4e3! (Adorjan_EofCE3) #1143 white_wins 8/8/8/8/5p2/2Rnk2P/6PK/1r6/b Rb1b2 (Adorjan_EofCE3) #1144 black_wins 8/1R3pk1/6p1/8/1N5P/6K1/4r3/8/b Re2b2! (Adorjan_EofCE3) #1145 draw 7R/5kr1/5p2/6p1/6K1/6NP/8/8/b Kf7g6 (Adorjan_EofCE3) #1146 draw 7k/8/R7/5N1p/1p3K2/8/Pr6/8/w Kf4g5! (Adorjan_EofCE3) #1147 white_wins 8/8/5pk1/4p2R/5r1P/6N1/4K3/8/w Rh5h8 (Adorjan_EofCE3) #1148 white_wins 8/5R2/7p/4K1p1/4N2k/P7/8/4r3/w Rf7f6! (Adorjan_EofCE3) #1149 white_wins 2r5/8/8/5R2/PK2k3/p7/3p4/7N/w Nh1g3+ (Adorjan_EofCE3) #1150 draw 1k6/6R1/8/3N1pP1/1K5p/6r1/8/8/w Kb4c5 (Adorjan_EofCE3) #1151 white_wins 1r6/8/3K2p1/kP6/2p5/2R1N3/8/8/w Kd6c7! (Adorjan_EofCE3) #1152 white_wins 8/8/2k1p3/2P1K1p1/8/R7/8/1N3r2/w Nb1d2 (Adorjan_EofCE3) #1153 white_wins 6k1/1r3p2/6p1/7p/3R1K1P/8/4N1P1/8/w Ne2c3 (Adorjan_EofCE3) #1154 white_wins 8/4pN1p/4P3/p3R3/5k2/1P6/1r6/6K1/w Re5b5 (Adorjan_EofCE3) #1155 white_wins 8/1Ppp3K/n7/P2P4/1R6/4rk2/8/8/w Pd5d6! (Adorjan_EofCE3) #1156 white_wins r1N3R1/8/6P1/4p3/p7/P7/4K1kp/8/w Rg8h8 (Adorjan_EofCE3) #1157 draw 6k1/5n1p/2Pp1pp1/3Pp3/4PP2/2r3P1/1R5P/7K/w Rb2b7! (Adorjan_EofCE3) #1158 draw 8/3k4/6R1/5p2/5P2/r1n3P1/4P3/6K1/b Nc3e4! (Adorjan_EofCE3) #1159 black_wins 1R6/2n5/7K/pPP5/8/1r6/1P6/5k2/w Pb5b6 (Adorjan_EofCE3) #1160 white_wins 2K5/1p3P2/4n1P1/2P3r1/8/2R5/4k3/8/w Pc5c6! (Adorjan_EofCE3) #1161 white_wins 8/6k1/5p2/5n2/PR6/3r3P/5KP1/8/w Pg2g4! (Adorjan_EofCE3) #1162 draw 8/5pk1/1R4pp/8/6PP/1p6/1r3NK1/8/b Kg7f8 (Adorjan_EofCE3) #1163 draw 5k2/2R4p/pr6/1p2KN2/2p5/2P5/8/8/w Nf5d4! (Adorjan_EofCE3) #1164 white_wins 5r2/2p5/3kp3/2pp2p1/6N1/8/5PP1/R3K3/w Ra1a6+ (Adorjan_EofCE3) #1165 black_stands_slightly_better 5r2/6k1/6p1/1P1n4/3P3p/R6P/P4PK1/8/b Nd5f4+ (Adorjan_EofCE3) #1166 draw 5r2/3k4/4n2P/R3P3/2P3p1/P5K1/6P1/8/b Rf8h8! (Adorjan_EofCE3) #1167 draw 8/R2n4/2p5/8/2P1k3/1P4P1/P2r1P1P/6K1/w Kg1g2 (Adorjan_EofCE3) #1168 white_wins 3k4/4r3/3K4/3B4/8/8/8/5R2/w Rf1f8+ (Adorjan_EofCE3) #1169 white_wins 4k3/5R2/3KB2r/8/8/8/8/8/w Rf7f1 (Adorjan_EofCE3) #1170 white_wins 3k4/8/1R2K3/4B3/8/8/2r5/8/w Rb6b8+ (Adorjan_EofCE3) #1171 draw 2R5/1r6/8/8/4b3/4k3/8/3K4/w Rc8c3+ (Adorjan_EofCE3) #1172 draw 8/8/4r3/7R/K7/2kb4/8/8/w Rh5c5+ (Adorjan_EofCE3) #1173 draw 8/8/7r/k1BK4/8/8/8/1R6/w Bc5e3 (Adorjan_EofCE3) #1174 draw 3k4/R7/1KB5/8/8/8/3r4/8/w Kb6c5 (Adorjan_EofCE3) #1175 draw 4k3/7R/2KB4/8/8/8/8/4r3/w Rh7g7 (Adorjan_EofCE3) #1176 draw 3k4/7R/8/3K4/3B4/8/8/3r4/b Rd1d2 (Adorjan_EofCE3) #1177a draw 3k4/7R/8/3K4/3B4/8/8/3r4/w Kd5e5 (Adorjan_EofCE3) #1177b draw 4k3/7R/8/4K3/4B3/8/8/4r3/w Ke5d5 (Adorjan_EofCE3) #1178 draw 2k5/3r4/2K5/2B5/8/8/8/4R3/w Re1e8+ (Adorjan_EofCE3) #1179 white_wins 8/8/3rb2R/8/8/K1k5/8/8/w Ka3a4! (Adorjan_EofCE3) #1180 draw 2k5/R7/3BK3/8/2r5/8/8/8/w Ke6d5 (Adorjan_EofCE3) #1181 white_wins 2k5/8/R2K4/3B4/8/8/1r6/8/b Rb2b1 (Adorjan_EofCE3) #1182 white_wins 2k5/3R4/1KB4r/8/8/8/8/8/w Rd7g7 (Adorjan_EofCE3) #1183 draw 4R3/8/8/8/5k2/5b2/7r/4K3/w Re8b8!?,Re8e7? (Adorjan_EofCE3) #1184 draw 2k5/8/1K1R4/1B6/8/8/8/1r6/b Rb1b2 (Adorjan_EofCE3) #1185a white_wins 2k5/8/1K1R4/1B6/8/8/8/1r6/w Rd6d2!? (Adorjan_EofCE3) #1185b white_wins 1k6/2r5/1K6/1B6/8/8/8/3R4/w Rd1d8+ (Adorjan_EofCE3) #1186 draw 1k6/2r5/1KB5/8/8/7R/8/8/w Bc6e4!? (Adorjan_EofCE3) #1187 white_wins 8/k1K1R3/5r2/8/8/3B4/8/8/b Rf6f8 (Adorjan_EofCE3) #1188 white_wins 8/8/8/5R2/r7/8/5b1K/5k2/w Rf5f3 (Adorjan_EofCE3) #1189 draw k7/1r6/K7/B7/8/8/8/2R5/w Rc1f1 (Adorjan_EofCE3) #1190 white_wins kr6/8/K7/B7/7R/8/8/8/b Rb8e8 (Adorjan_EofCE3) #1191 white_wins 5R2/2B5/8/8/4r3/8/8/5K1k/b Re4e8 (Adorjan_EofCE3) #1192 white_wins k7/6R1/2K5/8/2B5/8/8/7r/w Bc4d3 (Adorjan_EofCE3) #1193 white_wins 7k/8/5r2/8/8/2R5/8/K1B5/w Bc1b2 (Adorjan_EofCE3) #1194 white_wins 8/8/R7/4k1r1/4B3/4K3/8/8/b Rg5g3+ (Adorjan_EofCE3) #1195 draw 1r5k/R6P/6BK/8/8/8/8/8/w Ra7a1 (Adorjan_EofCE3) #1196 draw 5R2/8/8/8/2k1p3/8/rb3K2/8/w Kf2e3 (Adorjan_EofCE3) #1197 black_wins 8/8/2b5/8/p1k5/7r/K7/6R1/w Rg1c1+ (Adorjan_EofCE3) #1198 black_wins 1R1B4/1K6/8/8/8/8/1k3p2/7r/w Kb7c8+!? (Adorjan_EofCE3) #1199 draw 2k5/K7/3RPr2/8/8/8/1b6/8/w Pe6e7!? (Adorjan_EofCE3) #1200 white_wins 5kr1/1R6/8/3K4/8/2p5/8/2B5/w Bc1h6+ (Adorjan_EofCE3) #1201 white_wins 5K2/7k/8/8/6R1/p5Br/8/8/w Bg3f4 (Adorjan_EofCE3) #1202 white_wins 8/6R1/8/7r/1P2b3/4k3/8/5K2/b Rh5h1+ (Adorjan_EofCE3) #1203 black_wins R7/5k1r/8/6p1/6K1/8/8/B7/w Kg4f5 (Adorjan_EofCE3) #1204 white_wins r2k1B2/7R/p7/8/8/8/8/4K3/w Bf8c5 (Adorjan_EofCE3) #1205 white_wins 7k/3B2p1/8/4R2K/8/8/8/r7/w Kh5g6 (Adorjan_EofCE3) #1206 white_wins 5R2/8/8/r7/1p6/8/p7/k2K1B2/w Bf1c4!? (Adorjan_EofCE3) #1207 draw 4k3/R5p1/2K4p/3B4/8/8/8/4r3/w Kc6d6!? (Adorjan_EofCE3) #1208 white_wins k6r/P1b2P2/K1R5/8/8/8/8/8/w Rc6g6!? (Adorjan_EofCE3) #1209 white_wins kr6/1pR5/1B4K1/8/8/7p/8/8/w Rc7c1!? (Adorjan_EofCE3) #1210 white_wins 3B4/8/8/1r6/8/7k/p6p/R6K/w Bd8h4!? (Adorjan_EofCE3) #1211 draw 8/8/8/4b1k1/7R/6P1/6PK/r7/w Rh4g4+!? (Adorjan_EofCE3) #1212 draw r7/5R2/8/p1K5/1p6/1Bp1k3/8/8/b Pc3c2 (Adorjan_EofCE3) #1213 draw 3k1r2/R7/4B3/8/3p4/3pp3/8/4K3/w Be6f7!? (Adorjan_EofCE3) #1214 white_wins 2R5/5ppk/8/4p2p/6r1/4B3/5K2/8/b Ph5h4 (Adorjan_EofCE3) #1215 black_wins 1k6/7p/7P/8/4p3/8/1r2b3/4K1R1/w Rg1g2!? (Adorjan_EofCE3) #1216 draw 8/2p5/2p1r1P1/5b2/k1Kp4/8/2P3R1/8/w Pc2c3 (Adorjan_EofCE3) #1217 draw 4rk2/2P2p2/p4P2/2p5/2p5/7b/P7/2KR4/b Pc4c3 (Adorjan_EofCE3) #1218 white_wins 4b3/k7/8/K7/2r4p/7P/8/3R4/w Rd1d7+!? (Adorjan_EofCE3) #1219 draw 8/8/4k3/8/4p3/8/rb2P1K1/3R4/w Rd1d2 (Adorjan_EofCE3) #1220 draw 1R6/p7/k7/2B5/5r2/1K6/P7/8/b Rf4f3+ (Adorjan_EofCE3) or ...Rf7 both lose. White wins. No good move. #1221 white_wins 1R6/8/8/5bkp/8/2r5/6PK/8/b Rc3d3!? (Adorjan_EofCE3) #1222 black_wins 5R2/8/8/4b1kp/8/6PK/4r3/8/b Re2e3 (Adorjan_EofCE3) #1223 black_wins 8/1k6/1p4r1/3KB3/8/P7/7R/8/w Rh2h7+ (Adorjan_EofCE3) #1224 white_wins 8/3P3k/6R1/1p6/8/2K5/1B6/3r4/w Rg6h6+!? (Adorjan_EofCE3) #1225 white_wins 5b2/8/3P4/2K5/k7/3r1p2/8/6R1/w Rg1g8!? (Adorjan_EofCE3) #1226 draw 4k3/8/2P5/8/p1r5/8/K2B1R2/8/w Rf2f6!? (Adorjan_EofCE3) #1227 white_wins 7k/1P3p2/8/1r6/1B6/2K5/8/6R1/w Rg1h1+!? (Adorjan_EofCE3) #1228 white_wins 8/2r5/1R2B2P/4kP2/4p3/5p2/5K2/8/b Ke5f4 (Adorjan_EofCE3) #1229 draw 8/1R3pk1/4p1pp/4P3/5PK1/6P1/1b5P/1r6/w Kg4h4 (Adorjan_EofCE3) #1230 black_wins 8/3R4/5k2/r6p/4B1p1/6P1/6K1/8/w Kg2f2 (Adorjan_EofCE3) #1231 white_wins 8/6pk/8/6R1/7P/1r4PK/5b2/8/b Bf2a7 (Adorjan_EofCE3) #1232 black_wins 8/r5kp/1R6/8/5PK1/2b5/7P/8/b Ra7a5 (Adorjan_EofCE3) #1233 black_wins 8/2R5/6pk/8/6P1/P1b2K2/2r5/8/w Pa3a4 (Adorjan_EofCE3) #1234 black_wins 8/8/5Pr1/3R4/pp6/8/k2B4/2K5/w Bd2g5 (Adorjan_EofCE3) #1235 white_wins 8/6k1/1PPR4/2r5/7p/7b/3K4/8/w Pb6b7 (Adorjan_EofCE3) #1236 white_wins 8/8/kb4RP/8/p7/1r6/6P1/5K2/w Kf1e2!? (Adorjan_EofCE3) #1237 draw 8/7k/8/3Rbr1p/P7/8/1PK5/8/w Pa4a5 (Adorjan_EofCE3) #1238 black_wins 8/4bk2/R7/5p2/6p1/4P1P1/1r3P2/5K2/b Pf5f4!? (Adorjan_EofCE3) #1239 black_wins 1r6/6kp/6p1/8/4RP2/2b3P1/6KP/8/b Rb8b2+ (Adorjan_EofCE3) #1240 black_wins 8/5pk1/3r2p1/1R1B3p/3K4/6P1/7P/8/w Rb5b7!? (Adorjan_EofCE3) #1241 white_wins 8/R6p/6k1/5p2/1b3P2/6P1/3r3P/7K/w Ra7b7 (Adorjan_EofCE3) #1242 black_wins 1k6/2p2R2/1p5P/8/2P4K/5P2/2b5/r7/w Pf3f4 (Adorjan_EofCE3) #1243 draw 6k1/2R3bp/2P3p1/8/4p1P1/6P1/1r3P2/6K1/w Rc7d7 (Adorjan_EofCE3) #1244 draw 8/8/3P3p/2R1Bpp1/6k1/6P1/2p3PK/4r3/w Rc5c4+!? (Adorjan_EofCE3) #1245 white_wins 1r4k1/8/3p4/2pPp3/1p2B2P/6P1/3R4/7K/b Pb4b3 (Adorjan_EofCE3) #1246 draw 8/5p2/3p2p1/3Pk2p/R3P2P/6P1/pr4BK/8/w Kh2h3 (Adorjan_EofCE3) #1247 draw 8/4R2p/1pBP2pk/pP6/K6P/2p3P1/1r6/8/b Pc3c2 (Adorjan_EofCE3) #1248 black_wins 2R5/5p1k/1K4pp/B7/6P1/7r/8/8/w Pg4g5!? (Adorjan_EofCE3) #1249 white_wins 8/8/4kbR1/8/5P1p/3r4/5KPP/8/w Pg2g4 (Adorjan_EofCE3) #1250 draw 2k5/3R1P2/6P1/7p/8/8/1bP2r2/7K/w Pc2c3!? (Adorjan_EofCE3) #1251 white_wins 8/6kp/3p4/R2B2p1/P4r2/6K1/8/8/w Bd5f3 (Adorjan_EofCE3) #1252 white_wins 1B6/4R3/3P1k2/7p/2r4p/2p4K/8/8/w Re7c7!? (Adorjan_EofCE3) #1253 white_wins 8/5r1p/8/3kb3/1p6/3K2P1/PPR4P/8/b Be5d4!? (Adorjan_EofCE3) #1254 black_wins 7k/2pb4/2p5/P1P5/P1P5/2r5/R7/6K1/w Pa5a6!? (Adorjan_EofCE3) #1255 white_wins 4B3/8/4p3/2p1p1k1/4P2p/6P1/2r2RK1/8/b Ph4h3+!? (Adorjan_EofCE3) #1256 draw 8/8/R3rk2/1P1p1p2/4p1p1/3B4/2PK4/8/b Kf6e5 (Adorjan_EofCE3) #1257 black_wins 1R6/3r4/8/5p1k/P7/1P2P1pP/4K2b/8/w Rb8h8+ (Adorjan_EofCE3) #1258 black_wins 5r2/3k3p/1p4p1/4P1P1/PPR1KP2/8/8/6b1/w Rc4c2!? (Adorjan_EofCE3) #1259 white_wins 8/R4pp1/3pk2p/8/p7/4BPK1/r5PP/8/w Ra7a6 (Adorjan_EofCE3) #1260 white_wins 8/8/3r4/5kp1/p5p1/2K3p1/1P6/4RB2/b Rd6b6 (Adorjan_EofCE3) #1261 draw 5Br1/6P1/8/8/2p1kp2/1p6/pK6/3R4/w Rd1c1 (Adorjan_EofCE3) #1262 draw 8/2b5/6p1/p4k2/5P2/1Pr3P1/P2R2KP/8/b Kf5g4!? (Adorjan_EofCE3) #1263 black_wins 8/1p6/2b5/6k1/pP2P3/P3RPP1/1r6/6K1/b Bc6d7!? (Adorjan_EofCE3) #1264 black_wins 3r2k1/5p1p/p5p1/1P1p4/8/5P2/1p3B1P/3R1K2/b Rd8c8 (Adorjan_EofCE3) #1265 draw b1r5/P1P2pp1/6kp/8/3P1P2/7P/2R3PK/8/w Pd4d5!? (Adorjan_EofCE3) #1266 draw 2R5/4K2k/8/n3n3/3N4/8/8/8/w Rc8c5 (Adorjan_EofCE3) #1267 white_wins 2n5/n7/5N2/8/8/7R/8/2k1K3/w Rh3c3+ (Adorjan_EofCE3) #1268 white_wins 3k1n2/8/2K4n/4N1R1/8/8/8/8/w Rg5h5 (Adorjan_EofCE3) #1269 white_wins 4k3/Nnr5/4K3/6N1/8/8/8/8/w Ke6f6!? (Adorjan_EofCE3) #1270 draw 8/8/8/1K2k1n1/1n6/5R2/8/4N3/w Rf3e3+ (Adorjan_EofCE3) #1271 white_wins 7R/8/8/3n4/2K5/2n5/6kN/8/w Kc4d4 (Adorjan_EofCE3) #1272 white_wins 4N3/8/R7/7k/2n3n1/8/4p3/7K/w Ne8g7+!? (Adorjan_EofCE3) #1273 draw 8/8/1N2R1n1/4n2K/8/8/1pk5/8/w Re6c6+!? (Adorjan_EofCE3) #1274 draw 4K3/8/2P5/N7/1r4n1/2N5/8/k7/w Pc6c7 (Adorjan_EofCE3) #1275 white_wins 8/1R6/8/4K1p1/8/n5n1/3N2k1/8/w Rb7b3 (Adorjan_EofCE3) #1276 white_wins 8/N6R/3p4/2n5/8/1n6/K3kp2/8/w Rh7e7+!? (Adorjan_EofCE3) #1277 draw 7R/8/n1P5/7n/3k4/8/pN1K4/8/w Rh8d8+ (Adorjan_EofCE3) #1278 draw 5Kn1/4n3/8/5P2/8/3k4/3p4/1N3R2/w Rf1f3+!? (Adorjan_EofCE3) #1279 white_wins 8/8/5K2/Pk2N3/2R5/2n5/4p3/n7/w Rc4d4!? (Adorjan_EofCE3) #1280 draw 6K1/5p2/nn6/k7/8/P3R3/p7/3N4/w Re3e5+ (Adorjan_EofCE3) #1281 draw 8/4kp1n/3p2p1/2nP4/4P3/4K3/1R1N4/8/w Ke3d4 (Adorjan_EofCE3) #1282 white_wins k7/3nN2R/8/8/8/8/1b6/3K4/w Kd1c2 (Adorjan_EofCE3) #1283 white_wins 5n2/1R4bk/2N5/5K2/8/8/8/8/w Nc6e7 (Adorjan_EofCE3) #1284 white_wins 6n1/8/k3N3/8/8/K7/2b5/4R3/w Ne6d4 (Adorjan_EofCE3) #1285 white_wins 8/5b2/8/6n1/k7/1R6/1KN5/8/w Rb3b4+ (Adorjan_EofCE3) #1286 white_wins 8/4k3/4N3/n7/7b/4K3/8/R7/w Ke3f4 (Adorjan_EofCE3) #1287 white_wins kN6/b7/6n1/3R4/8/8/3PK3/8/w Rd5g5!? (Adorjan_EofCE3) #1288 white_wins 6n1/8/6b1/1p6/k7/5N2/5R2/2K5/w Nf3e5 (Adorjan_EofCE3) #1289 white_wins 2b5/n4R2/p7/k7/8/2N5/1K6/8/w Rf7c7!? (Adorjan_EofCE3) #1290 white_wins 2n5/3N2R1/b3p3/p7/7k/8/8/4K3/w Nd7c5 (Adorjan_EofCE3) #1291 white_wins 8/R2N1b2/1p6/1p6/4n3/8/8/2K1k3/w Nd7f6!? (Adorjan_EofCE3) #1292 white_wins 8/p6n/8/p4R2/N1k5/8/1K4b1/8/w Rf5f7 (Adorjan_EofCE3) #1293 white_wins n7/5B2/2p1p2P/2N5/5r2/8/4p3/4K2k/w Bf7h5 (Adorjan_EofCE3) #1294 white_wins 8/1r2k2B/1n3p2/5K2/6P1/8/8/N7/w Pg4g5 (Adorjan_EofCE3) #1295 draw Kn1N4/B6p/8/3r4/8/8/5Pk1/8/w Nd8e6 (Adorjan_EofCE3) #1296 draw 5n2/6k1/2B5/r5pp/8/2NK2P1/5P2/8/w Bc6g2 (Adorjan_EofCE3) #1297 black_wins 4r3/6KP/2pkp3/N7/p7/P7/1B3P2/3n4/w Na5b7+ (Adorjan_EofCE3) #1298 white_wins 4K3/8/NP1p2n1/8/5k2/2B3r1/4P3/8/w Pb6b7 (Adorjan_EofCE3) #1299 white_wins 4k3/n1P1p2R/p3p2P/4P1bN/4K1p1/8/1p6/8/w Rh7h8+!? (Adorjan_EofCE3) #1300 draw 7k/8/4R3/8/b7/5Nb1/8/7K/w Kh1g2 (Adorjan_EofCE3) #1301 white_wins 7k/8/8/8/3NR3/6b1/8/5b1K/w Kh1g1 (Adorjan_EofCE3) #1302 white_wins 8/4k3/8/4N3/2R5/4b3/8/3b1K2/w Kf1e1 (Adorjan_EofCE3) #1303 white_wins k7/8/b4b2/8/8/1KN5/3R4/8/w Nc3e4 (Adorjan_EofCE3) #1304 white_wins 8/8/6b1/R2KNkb1/8/8/8/8/w Ra5a1 (Adorjan_EofCE3) #1305 white_wins 4n3/8/1B4K1/8/2r5/8/2B5/k7/w Kg6f7 (Adorjan_EofCE3) #1306 draw 6B1/4n3/1k6/6B1/8/5K2/3p4/3r4/w Bg8b3 (Adorjan_EofCE3) #1307 draw 7n/8/5r1B/8/2k5/1p5B/8/1K6/w Bh6g7 (Adorjan_EofCE3) #1308 draw 1BB5/4p3/8/8/8/n7/3K4/5k1r/w Bc8a6+ (Adorjan_EofCE3) #1309 draw 4b3/7p/7k/5K2/8/4N1b1/R7/8/w Kf5g4 (Adorjan_EofCE3) #1310 white_wins 3k2b1/8/2R5/b3pN2/4p3/4K3/8/8/w Rc6a6 (Adorjan_EofCE3) #1311 white_wins 5k2/2pK4/8/2p3b1/2R5/8/4N1b1/8/w Ne2f4!? (Adorjan_EofCE3) #1312 white_wins 6n1/8/2p4P/8/8/r1p3K1/B7/4B1k1/w Be1f2+ (Adorjan_EofCE3) #1313 draw 8/1B5K/4Pp1p/8/k1r5/p2n4/P7/2B5/w Bc1f4!? (Adorjan_EofCE3) #1314 draw 8/2BB4/8/8/8/k4n2/2Kp1rP1/8/w Bc7d6+ (Adorjan_EofCE3) #1315 white_wins 4N1kb/2P2R2/b7/4pK2/4P3/6p1/8/8/w Rf7d7!? (Adorjan_EofCE3) #1316 draw 6b1/3R4/1kP5/N1b5/2p5/8/5p2/5K2/w Pc6c7 (Adorjan_EofCE3) #1317 draw 6r1/p1B2k2/3P1p2/1BP1n3/7P/8/P4K2/8/b Pa7a6 (Adorjan_EofCE3) #1318 white_wins k4nn1/8/2R5/8/6B1/8/8/7K/b Ng8e7 (Adorjan_EofCE3) #1319 white_wins 8/8/8/8/3nK3/4Bnk1/5R2/8/w Rf2f1 (Adorjan_EofCE3) #1320 white_wins 1n6/7K/4k1B1/7R/8/n7/8/8/w Rh5c5!? (Adorjan_EofCE3) #1321 white_wins 3N4/3P1b2/5Nk1/8/8/K7/7r/8/w Nd8c6 (Adorjan_EofCE3) #1322 white_wins 8/R7/6n1/7k/8/3Bpn2/8/7K/w Bd3e2 (Adorjan_EofCE3) #1323 white_wins 8/8/b2N2P1/8/8/3rNk2/8/6K1/w Pg6g7 (Adorjan_EofCE3) #1324 white_wins 8/5R2/4k3/1p1n3B/1Pn5/P3p2P/3pK1P1/8/b Nc4b2 (Adorjan_EofCE3) #1325 black_wins 8/1k5B/2R5/8/4Kn2/7p/6P1/1n6/w Rc6c1 (Adorjan_EofCE3) #1326 white_wins 1b6/1P6/1p3P2/1N1p4/p6k/3r4/KP6/5N2/w Nf1h2!? (Adorjan_EofCE3) #1327 white_wins 4N3/b7/4P1pp/8/2kr2N1/7p/P4P1K/8/w Pe6e7 (Adorjan_EofCE3) #1328 white_wins 8/pP1p3p/Pr3P1P/5p1K/5k2/5P1p/2N2b1P/N7/w Na1b3!? (Adorjan_EofCE3) #1329 white_wins nB6/6k1/K7/8/2p1n3/3pR3/1P5p/8/w Re3e1 (Adorjan_EofCE3) #1330 draw 8/3kb3/3n4/3K4/8/3B4/8/7R/w Rh1h7 (Adorjan_EofCE3) #1331 white_wins K3B3/8/8/3N4/3k4/8/2r5/2b5/w Be8g6 (Adorjan_EofCE3) #1332 draw 4KR1n/6kP/8/8/3b4/8/8/1B6/w Rf8g8+ (Adorjan_EofCE3) #1333 white_wins 2b4k/8/5Pr1/5N2/8/8/8/K1B5/w Pf6f7 (Adorjan_EofCE3) #1334 white_wins 8/4n3/k2b4/8/1p2R3/8/6B1/2K5/w Re4e6 (Adorjan_EofCE3) #1335 white_wins 6b1/1k6/3Rp3/8/2K3n1/8/8/B7/w Rd6d8 (Adorjan_EofCE3) #1336 white_wins 4N3/8/7B/7r/8/1k6/1Pb5/4K3/w Bh6g7 (Adorjan_EofCE3) #1337 black_wins 3K2k1/8/8/1P6/4P2p/3bR2P/pn6/6B1/w Re3e1 (Adorjan_EofCE3) #1338 draw 3B4/3b1p2/K7/8/2k1N3/8/1P4r1/8/w Ne4d6+ (Adorjan_EofCE3) #1339 draw 2k5/5R2/2Pb4/1KnB4/8/8/7p/8/w Pc6c7 (Adorjan_EofCE3) #1340 draw 4b3/7K/2kPR3/8/4n3/B1pp4/3P4/8/w Pd6d7+!? (Adorjan_EofCE3) #1341 white_wins 8/5k2/8/2BR4/b7/8/1P2p1Kp/1n6/w Rd5e5 (Adorjan_EofCE3) #1342 white_wins 8/2Nk2p1/1B3p1p/P6P/2b3P1/5PK1/r7/8/b Ra2a3 (Adorjan_EofCE3) #1343 black_wins 7k/4b2p/5p1P/5PP1/1pNp1P2/1P1B4/2P2K2/r7/w Pg5g6 (Adorjan_EofCE3) #1344 white_wins 8/8/2b3kp/4B2N/4P1P1/1r3PK1/7P/8/w Kg3f4 (Adorjan_EofCE3) #1345 white_wins 3b3k/4n3/8/8/7B/8/8/5KR1/w Bh4f6+ (Adorjan_EofCE3) #1346 white_wins 3R4/5b2/8/k2n4/8/K2B4/8/8/w Bd3g6!? (Adorjan_EofCE3) #1347 white_wins 8/8/8/3p1N2/5r2/8/4k1Kb/6B1/w Nf5d4+ (Adorjan_EofCE3) #1348 draw 8/3K3k/8/1r5B/8/6P1/2b5/3N4/w Bh5g4!? (Adorjan_EofCE3) #1349 draw 4N3/8/1P3P2/3k4/8/8/3B2r1/K5b1/w Pb6b7!? (Adorjan_EofCE3) #1350 white_wins 8/1n5p/7p/7k/2R5/8/4b2K/1B6/w Rc4e4 (Adorjan_EofCE3) #1351 white_wins 2R5/k2Bn3/1pP5/8/b7/2K5/8/8/w Rc8c7+ (Adorjan_EofCE3) #1352 white_wins 8/8/4n3/5R2/B6K/5P2/p5b1/7k/w Rf5d5 (Adorjan_EofCE3) #1353 draw 8/5k2/7p/4p2P/4b1P1/4NpK1/r4P2/5B2/b Ra2e2!? (Adorjan_EofCE3) #1354 black_wins 8/6p1/P1p2N2/8/5PB1/3Pr3/8/1k3K1b/w Pa6a7 (Adorjan_EofCE3) #1355 draw 8/p7/2B2P2/8/6N1/1bP4p/1Pk4K/r7/w Pc3c4!? (Adorjan_EofCE3) #1356 white_wins 8/6R1/4b3/8/7b/4K3/6Bk/8/w Bg2e4 (Adorjan_EofCE3) #1357 white_wins 2B5/8/8/8/7k/4b3/3r3B/7K/b Rd2c2 (Adorjan_EofCE3) #1358 black_wins k4b2/8/8/8/6b1/6B1/6R1/6K1/w Bg3f2 (Adorjan_EofCE3) #1359 white_wins k4b2/8/8/8/8/1b6/2R3K1/3B4/w Bd1f3+ (Adorjan_EofCE3) #1360 white_wins 1r1B3k/3B4/8/8/8/2b5/8/7K/w Bd8h4!? (Adorjan_EofCE3) #1361 draw 1k6/7b/8/6R1/6p1/2b5/7K/2B5/w Bc1f4+ (Adorjan_EofCE3) #1362 white_wins 1r6/1B6/8/8/5k1b/8/1B4P1/6K1/w Pg2g3+!? (Adorjan_EofCE3) #1363 draw 6R1/2B5/8/5k2/4b2b/3p3p/3K4/8/b Bh4g5+ (Adorjan_EofCE3) #1364 draw 7k/pR6/8/8/2K1p3/8/2b1B2b/8/w Rb7b2 (Adorjan_EofCE3) #1365 white_wins 2r5/b6P/7B/3B3P/8/2k5/8/2K5/w Bh6g7+ (Adorjan_EofCE3) #1366 white_wins 5K2/1B6/1bPB4/8/2P5/4k2r/8/8/w Pc4c5!? (Adorjan_EofCE3) #1367 white_wins 4B1b1/1R6/3p4/3P2b1/2k5/8/7K/8/w Rb7g7 (Adorjan_EofCE3) #1368 white_wins 8/1k2B1b1/2p3P1/K6b/R7/8/8/8/w Ra4a3!? (Adorjan_EofCE3) #1369 white_wins 2B5/p7/3P4/2B1k3/1P6/5bp1/r7/4K3/w Pd6d7 (Adorjan_EofCE3) #1370 draw 8/K2Pb3/2k5/8/1P3B2/1B3r2/3p4/8/w Bb3a4+ (Adorjan_EofCE3) #1371 draw K2b2B1/2p2R2/4p3/P7/k7/8/4b3/8/w Rf7f2 (Adorjan_EofCE3) #1372 white_wins 8/6P1/1p1Pb3/7k/7p/2P3r1/1B5K/7B/w Pc3c4!? (Adorjan_EofCE3) #1373 white_wins 2kr4/p7/8/1pp2Pp1/4P3/P1B1KB2/1Pb4P/8/w Pf5f6 (Adorjan_EofCE3) #1374 draw 4b1k1/7p/8/8/2PB1P2/3p1BK1/r5PP/8/w Bf3d1 (Adorjan_EofCE3) #1375 black_wins 5R2/8/8/p1pB1pkp/P1P2pp1/4bP1b/7P/7K/b Bh3f1 (Adorjan_EofCE3) #1376 black_wins 1R6/2r5/8/8/pn6/k3K3/4N3/8/b Rc7c4!? (Adorjan_EofCE3) #1377 black_wins 7k/1p6/4K3/3RN3/8/8/8/4r1n1/w Ke6f7 (Adorjan_EofCE3) #1378 white_wins 3k4/R7/3r2NK/P1n5/8/8/7P/8/w Ph2h4 (Adorjan_EofCE3) #1379 white_wins 6k1/5Rn1/3p2P1/6N1/5P1K/8/8/6r1/w Rf7d7 (Adorjan_EofCE3) #1380 draw 8/1p6/p1pk4/4n3/8/1Pr5/P3R1N1/5K2/b Rc3c1+!? (Adorjan_EofCE3) #1381 black_wins 6k1/1R5p/4Np2/2p2P1K/1nr4P/8/8/8/b Nb4d5!? (Adorjan_EofCE3) #1382 draw 6k1/5p2/2n1p1p1/3p4/1r1P4/2NRK1PP/8/8/b Nc6e7 (Adorjan_EofCE3) #1383 black_wins 8/6k1/3Np2p/1P1n2p1/8/6PP/2R2PK1/1r6/w Rc2c8 (Adorjan_EofCE3) #1384 white_ahead 7R/p4k2/2p2p2/2Pp4/3P1N2/3K2n1/P7/6r1/b Rg1d1+!? (Adorjan_EofCE3) #1385 black_wins 8/1N6/3p2Rp/1n1Pp3/kpK1P3/5r2/1P6/8/w Pb2b3+!? (Adorjan_EofCE3) #1386 white_wins 4r1k1/p6p/1p6/1NnP1p2/3Rp3/P7/5KPP/8/b Kg8g7 (Adorjan_EofCE3) #1387 black_wins 8/p5k1/2pr1np1/4p2p/2P1P2P/1P4PK/P1R2N2/8/b Rd6d4 (Adorjan_EofCE3) #1388 draw 6k1/pN3pp1/1n2p2p/8/8/1P2PP2/P2r1P1P/R5K1/b Nb6d7!? (Adorjan_EofCE3) #1389 draw 8/2p2k2/1p1p1Ppp/1P1Rn1P1/2P4P/4P3/3NK3/2r5/w Pg5xPh6!? (Adorjan_EofCE3) #1390 white_wins 8/p7/1pP3pp/n6k/7r/8/1P2KN2/R7/w Pc6c7 (Adorjan_EofCE3) #1391 white_wins 1k6/1p3R2/p7/5p2/7P/4nN2/P5PK/r7/w Ph4h5 (Adorjan_EofCE3) #1392 draw 8/8/6p1/1nk3N1/2p1PP1p/2P5/1K3R2/7r/b Ph4h3 (Adorjan_EofCE3) #1393 unclear 5k2/R7/p4p2/P1n2N1P/4p1PK/8/8/2r5/w Kh4g3!? (Adorjan_EofCE3) #1394 white_wins 6k1/3R4/3KN3/p2p1P2/P7/1P2p3/2n2r2/8/w Kd6e5!? (Adorjan_EofCE3) #1395 draw 8/6Rp/5n2/r3pNpk/4Pp2/5P1P/6PK/8/w Rg7b7 (Adorjan_EofCE3) #1396 draw 6r1/2p1n3/2P1p2p/4p1k1/4P1P1/2R2PNK/8/8/w Ng3h5!? (Adorjan_EofCE3) #1397 white_wins 4R3/5nkp/3p2p1/2pP4/5PP1/3rNK1P/8/8/b Rd3a3 (Adorjan_EofCE3) #1398 draw 4k3/2R2p2/pp4p1/4N3/3PK3/P7/1P3rnP/8/w Ne5c4!? (Adorjan_EofCE3) #1399 white_wins 7k/7n/p7/2pPpr2/2P4P/5p2/P7/1NK3R1/b Nh7f6!? (Adorjan_EofCE3) #1400 black_wins r3nk2/4pp1p/6p1/2NPR3/2p5/2P4P/5PP1/6K1/b Ra8a1+ (Adorjan_EofCE3) #1401 black_wins 5nk1/4Rppp/1pp5/3r4/3p4/1N4PP/PPP2P2/6K1/w Re7b7 (Adorjan_EofCE3) #1402 white_wins 8/3r1Np1/b7/8/8/8/1k3K2/5R2/w Nf7e5 (Adorjan_EofCE3) #1403 draw 8/6K1/6P1/3NR3/6k1/8/8/1b4r1/w Kg7f6 (Adorjan_EofCE3) #1404 draw b7/8/6k1/8/5R1P/r4PKN/8/8/w Kg3g4 (Adorjan_EofCE3) #1405 white_wins 5k2/8/7R/p1KB1Pn1/P7/8/4r3/8/b Re2f2 (Adorjan_EofCE3) #1406 white_stands_slightly_better 8/6B1/1PR5/5k2/7K/2p2P2/1r6/3n4/w Bg7d4!? (Adorjan_EofCE3) #1407 white_wins 8/4k3/1KB5/1P1p4/6R1/7r/4n2P/8/w Kb6c7!? (Adorjan_EofCE3) #1408 white_wins 8/8/2B5/8/5ppk/r3n3/3R1KP1/8/b Ne3f5!? (Adorjan_EofCE3) #1409 black_wins 8/8/4r1kp/1R2b3/4N3/5KPP/8/8/b Be5c7 (Adorjan_EofCE3) #1410 draw 8/4p3/B3pk2/5n2/8/R7/1r3P2/5K2/b Nf5d4 (Adorjan_EofCE3) #1411 draw 8/2b1p3/2r4P/6RN/8/2kP4/4K3/8/w Nh5g7!? (Adorjan_EofCE3) #1412 white_wins 8/8/1kb5/5P2/3RN1P1/7p/7r/5K2/w Rd4b4+ (Adorjan_EofCE3) #1413 draw 8/R7/p7/1p4k1/8/3B4/5KP1/r1n5/w Bd3xPb5!? (Adorjan_EofCE3) #1414 draw 8/p4p2/5kn1/2R5/3KP3/r5P1/4BP2/8/b Ng6f8 (Adorjan_EofCE3) #1415 white_wins 8/6p1/1r1k4/1P1np1P1/8/1R1BPK2/8/8/w Rb3a3 (Adorjan_EofCE3) #1416 white_wins 8/7R/4p2p/4k1p1/6P1/8/2nr2BP/6K1/b Nc2e1!? (Adorjan_EofCE3) #1417 black_wins 8/4k3/PNb3p1/4P2p/5P2/4K3/1R6/2r5/w Pa6a7 (Adorjan_EofCE3) #1418 white_wins 8/2pkN3/4R3/1p1P2P1/8/1r1b1KP1/8/8/w Kf3g4 (Adorjan_EofCE3) #1419 white_wins 2N5/8/4P3/k3Ppp1/4b3/2R4K/6rP/8/w Rc3g3!? (Adorjan_EofCE3) #1420 white_wins 8/4k3/6p1/2N2b1p/2P5/1P2r3/P2R3K/8/w Pa2a4 (Adorjan_EofCE3) #1421 white_wins 5k2/p1R5/6pp/1P1N1pb1/r2P4/8/7P/7K/w Ph2h4 (Adorjan_EofCE3) #1422 draw 8/6k1/5pp1/7p/2bNP2P/4KP2/3R2P1/r7/w Ke3f4 (Adorjan_EofCE3) #1423 white_wins 1r6/5pk1/5npp/2R5/Pp6/5B2/1P4P1/6K1/w Pa4a5 (Adorjan_EofCE3) #1424 white_wins 8/b4p2/3kp3/p5P1/6R1/P1P2P2/4K3/5N1r/w Rg4f4 (Adorjan_EofCE3) #1425 white_wins 8/3r1k2/1R6/5p2/P2N2pp/1P1KP3/6Pb/8/b Ph4h3!? (Adorjan_EofCE3) #1426 black_wins 8/5k2/2p1p3/3bPp2/3N1P2/2R1K1PP/r7/8/w Nd4f3 (Adorjan_EofCE3) #1427 white_wins 8/3b1p1p/r7/P2p4/1k1N4/8/4KPPP/R7/w Ke2d3!? (Adorjan_EofCE3) #1428 white_wins 1r6/7p/1p1k2p1/2nP1pP1/2PK1P2/3B4/2P5/1R6/w Rb1h1 (Adorjan_EofCE3) #1429 white_wins 2r5/p1P5/3B1k1p/3n1pp1/8/P5P1/5P1P/4R1K1/w Pf2f4!? (Adorjan_EofCE3) #1430 white_wins 6rk/p5pp/4p3/8/2p2P1P/P1Nb2P1/3R4/4K3/w Rd2b2 (Adorjan_EofCE3) #1431 draw 7r/p1k4p/4p2B/5p2/3n4/P7/2P2PPP/5RK1/w Rf1d1 (Adorjan_EofCE3) #1432 white_wins 8/2pb1p2/3k2pp/8/rP3P2/P1R1K2P/4N1P1/8/w Rc3d3+!? (Adorjan_EofCE3) #1433 white_wins 3r4/4R2p/1pB3pk/pP1P4/n1p4P/6P1/3K4/8/b Rd8f8!? (Adorjan_EofCE3) #1434 black_wins 8/1p2rk1p/1R2b3/2ppp1P1/7N/1P1PP3/2P2KP1/8/w Pe3e4!? (Adorjan_EofCE3) #1435 white_wins 8/3k3p/4p3/ppbp4/r7/P1P3P1/1P1RNPKP/8/w Ne2d4!? (Adorjan_EofCE3) #1436 white_wins 2b2k2/7p/5P2/P3N1R1/6P1/r7/3K4/8/b Ra3xPa5!? (Adorjan_EofCE3) #1437 draw R7/4kp2/P2p4/1KnP4/6P1/5B2/2r3P1/8/w Pg4g5 (Adorjan_EofCE3) #1438 white_wins 8/6pk/4B3/R3pP2/P2nr3/1P5K/7P/8/w Ra5a8!? (Adorjan_EofCE3) #1439 white_wins 8/N4pk1/P2p2p1/1P1b4/1K5p/6r1/8/R7/w Na7c6!? (Adorjan_EofCE3) #1440 draw 8/8/p5k1/N1pP2p1/4K1p1/b3P3/1r6/7R/b Rb2b4+ (Adorjan_EofCE3) #1441 black_wins 3r4/5k1p/8/1p2p1b1/2p1P1P1/5PN1/PP4P1/1K5R/b Pb5b4!? (Adorjan_EofCE3) #1442 draw r7/p3R1B1/1p2p3/1kpp1p2/4n2P/2P2KP1/P7/8/w Ph4h5 (Adorjan_EofCE3) #1443 draw 8/8/1P1b4/4PR2/4k1P1/4pN1P/1r6/3K4/b Bd6a3!? (Adorjan_EofCE3) #1444 draw 5r1k/6bp/2P5/pp4N1/3p4/8/6R1/4K3/w Ng5e6 (Adorjan_EofCE3) #1445 black_wins 6B1/8/1kn5/7R/pp5P/3P2P1/Pr3PK1/8/w Bg8d5 (Adorjan_EofCE3) #1446 white_wins 8/8/5p2/1P1R4/3Bn1kr/8/2K5/8/w Pb5b6 (Adorjan_EofCE3) #1447 draw 8/R7/5bpk/8/1N4P1/P1p2K2/1r6/8/b Pc3c2!? (Adorjan_EofCE3) #1448 black_wins 8/8/1R6/1PNbpk2/8/1PK1p3/r7/8/w Rb6a6 (Adorjan_EofCE3) #1449 draw 8/pp2rk2/5p2/2N5/P1P3b1/1PK5/R7/8/w Ra2f2 (Adorjan_EofCE3) #1450 draw 1B6/4R3/p3P3/5kpp/3n4/7P/r5P1/7K/w Re7d7 (Adorjan_EofCE3) #1451 black_ahead 2k2n2/8/6pK/pp3r1p/5B1P/5PP1/PR6/8/w Bf4d6!? (Adorjan_EofCE3) #1452 white_wins 3r4/pR4pk/1b6/2p5/2p5/2N5/PP4PP/6K1/b Rd8d2 (Adorjan_EofCE3) #1453 black_wins 7r/2Pbkpp1/4p3/2R4p/2N5/6P1/5PKP/8/w Ph2h4!? (Adorjan_EofCE3) #1454 white_wins 6k1/3R1p2/8/4p2p/P2bN1p1/6P1/2r2P1P/5K2/w Rd7d8+!? (Adorjan_EofCE3) #1455 draw 8/7p/2k1p1p1/1n6/p2P4/2r2P1P/3K1BP1/1R6/b Rc3b3!? (Adorjan_EofCE3) #1456 black_wins 4r3/P5p1/5k2/6pP/1P3pn1/2P1pK2/8/R4B2/b Pe3e2!? (Adorjan_EofCE3) #1457 draw 8/pp1k3p/2pr1p2/3n4/P1B2P1P/2P2KP1/8/4R3/w Bc4d3!? (Adorjan_EofCE3) #1458 white_wins 8/8/1p2k2p/p1p1p1b1/P1PrN1P1/1P1R1P2/4K3/8/w Rd3d1 (Adorjan_EofCE3) #1459 draw 1r4k1/3R2pp/1p2P3/2p2P2/p1n4B/2P5/6PP/6K1/b Pa4a3 (Adorjan_EofCE3) #1460 white_wins 2k5/1p1n1p1p/1p2r1p1/1R3p2/3K4/P1P2B1P/1P3PP1/8/w Pa3a4!? (Adorjan_EofCE3) #1461 white_wins 2k5/2p3Rp/p1pb4/1p2p3/4P3/PN1P1P2/1P2KP1r/8/w Pf3f4!? (Adorjan_EofCE3) #1462 white_wins 2r3k1/4b2p/p2p2p1/4pp2/PpP1P3/1P3N2/5PPP/4RK2/w Pe4xPf5 (Adorjan_EofCE3) #1463 white_wins 1r5b/p3k3/1p2p1pp/2p1p3/2P1N3/3RP2P/PP2KPP1/8/w Pa2a4!? (Adorjan_EofCE3) #1464 white_wins 2k1r3/2p3B1/pp4np/6p1/2P1pp2/PP5P/2P2PP1/2KR4/b Ng6h4!? (Adorjan_EofCE3) #1465 black_ahead 6B1/5P2/7R/1k6/8/8/1b3r2/3K4/w Rh6h2!? (Adorjan_EofCE3) #1466 white_wins 8/8/7k/2K1B1R1/r5PP/8/2b5/8/w Be5g7+!? (Adorjan_EofCE3) #1467 white_ahead 8/8/8/8/1kbp3r/1p6/1B1K2R1/8/b Bc4d5 (Adorjan_EofCE3) #1468 black_wins 1R6/2B5/4p1k1/3b2p1/8/7r/8/6K1/b Rh3c3 (Adorjan_EofCE3) #1469 black_wins 4k3/8/8/R5K1/1Bb1r2P/P7/8/8/b Re4d4!? (Adorjan_EofCE3) #1470 draw 8/8/6p1/4Bb1k/5P2/4r2p/7K/6R1/b Re3e2+ (Adorjan_EofCE3) #1471 black_wins K7/p7/P2R4/1B3k2/2P5/4b3/8/2r5/w Rd6d3!? (Adorjan_EofCE3) #1472 white_wins 6r1/6b1/8/8/8/p1P5/P3B1R1/4k1K1/w Be2a6!? (Adorjan_EofCE3) #1473 white_wins 8/8/4b3/2k2p2/1R3P2/1pBK4/6r1/8/w Rb4a4 (Adorjan_EofCE3) #1474 black_wins 6k1/4b3/4P3/p2K1Br1/P7/5R2/8/8/w Kd5c6 (Adorjan_EofCE3) #1475 draw 2k1K3/4p3/8/3P2br/1R2B3/8/4p3/8/w Be4f5+ (Adorjan_EofCE3) #1476 draw 8/R7/6P1/4b3/1pk5/6r1/Kp6/1B6/w Ra7a6!? (Adorjan_EofCE3) #1477 draw 4r1k1/1R3b2/7p/3p4/3B1PP1/4P1K1/8/8/w Rb7d7 (Adorjan_EofCE3) #1478 white_wins 7k/2R4p/6p1/P2B4/1r4PP/5K2/8/6b1/w Pg4g5 (Adorjan_EofCE3) #1479 white_wins 6k1/2R5/p4p2/1b6/6pP/2B1Pr2/8/6K1/b Bb5f1!? (Adorjan_EofCE3) #1480 black_wins 2r5/R2b3p/3Bk1p1/4Pp2/5PP1/6KP/8/8/b Rc8c3+ (Adorjan_EofCE3) #1481 draw 8/3k4/2p2Rp1/P2r1bPp/7P/2B1K3/3P4/8/w Ke3f4 (Adorjan_EofCE3) #1482 white_wins 8/ppk4B/2p5/8/2r5/6P1/Pb3P1P/5RK1/w Ph2h4 (Adorjan_EofCE3) #1483 white_wins r7/6RP/4k3/4Bp1p/1P1Pb3/8/p4P1K/8/w Rg7a7!? (Adorjan_EofCE3) #1484 white_wins 5b2/6pp/4Bpk1/1p6/1P6/P1r3P1/5P1P/3R2K1/w Rd1d8 (Adorjan_EofCE3) #1485 white_wins 5k2/5p2/p1b5/1p2Br1p/8/P3R2P/1P3PP1/6K1/w Pf2f3 (Adorjan_EofCE3) #1486 white_wins 1r6/p1p5/4k3/2p3B1/4p1pP/5bK1/PP3P2/4R3/w Ph4h5 (Adorjan_EofCE3) #1487 white_ahead 8/5kp1/4p3/3p3p/2bP2PP/1p3P2/1R1B1K2/3r4/b Kf7g6!? (Adorjan_EofCE3) #1488 black_wins 8/5k1p/4rB1P/6P1/1P1K3R/8/6b1/8/w Pb4b5 (Adorjan_EofCE3) #1489 white_wins 1k6/4R3/P7/1B6/1K6/2P1p3/2Pb4/r7/w Kb4b3 (Adorjan_EofCE3) #1490 white_wins 5B2/K7/4P3/k7/2r5/1b2p3/8/2R5/w Pe6e7 (Adorjan_EofCE3) #1491 white_wins 3B4/1b6/3P4/7K/6p1/6R1/2k2r2/8/w Pd6d7 (Adorjan_EofCE3) #1492 white_wins 1r5b/4P2R/p3k3/8/8/8/2K5/5B2/w Bf1h3+ (Adorjan_EofCE3) #1493 white_wins 1R1B4/8/k7/P4p2/2p1b2P/3r4/4K3/8/w Rb8b6+ (Adorjan_EofCE3) #1494 draw 8/1kpr4/1p4PR/p3B2P/2b5/2P5/8/6K1/b Rd7d5 (Adorjan_EofCE3) #1495 draw 8/5k1p/5PpB/3PR3/2r4P/1p3K2/2b5/8/b Rc4e4!? (Adorjan_EofCE3) #1496 black_wins 8/8/p6R/2b1kP2/3pP3/2p5/2B1K2P/6r1/b Rg1g2+!? (Adorjan_EofCE3) #1497 black_wins 8/7p/1kp1R1p1/2r5/p3BbP1/2P4P/1PK5/8/b Pa4a3!? (Adorjan_EofCE3) #1498 draw 3R4/1p6/2b5/2P1k2p/p3p2P/P6r/1P2KB2/8/b Bc6d5 (Adorjan_EofCE3) #1499 draw 3k4/3b2R1/p1pB1p2/2Pp2p1/P2P4/4P3/3K1P2/7r/w Bd6e7+ (Adorjan_EofCE3) #1500 white_wins 6k1/4p1bp/p2p2p1/2rP1p1P/2P2PP1/3K1B2/P7/7R/w Ph5h6 (Adorjan_EofCE3) #1501 white_wins 6R1/8/P5K1/bk6/r7/8/7B/8/w Pa6a7 (Adorjan_EofCE3) #1502 white_wins 8/5r2/B2Kbk2/1R6/4P3/8/8/8/w Pe4e5+ (Adorjan_EofCE3) #1503 white_wins 4R3/4P3/2r1k1B1/1b6/8/4PK2/8/8/w Bg6f5+!? (Adorjan_EofCE3) #1504 white_wins 6b1/4R3/7k/6p1/r3B1P1/4KP2/8/8/w Re7d7 (Adorjan_EofCE3) #1505 draw 8/2k5/8/8/R4b2/4p1p1/5rP1/4B1K1/b Pe3e2!? (Adorjan_EofCE3) #1506 black_wins 8/2pk4/3b4/R3p3/8/3KB3/P7/5r2/b Kd7e6 (Adorjan_EofCE3) #1507 black_wins 5bk1/R7/7p/8/6KP/4B3/p1r2PP1/8/w Be3d4!? (Adorjan_EofCE3) #1508 draw 6k1/7p/8/R3B3/3PK1P1/p6P/1b3r2/8/w Ph3h4 (Adorjan_EofCE3) #1509 white_wins 1r6/8/p1pk3P/4p1R1/8/2b1B3/5PK1/8/w Ph6h7!? (Adorjan_EofCE3) #1510 draw 8/1R2P3/6k1/3B4/2P2P2/1p2r3/1Kb4p/8/w Bd5e6!? (Adorjan_EofCE3) #1511 white_wins 8/k7/2R1p2p/1p2P3/1PbPB3/r1P1K3/8/8/w Ke3f4 (Adorjan_EofCE3) #1512 white_wins 8/4k3/p1bp3R/2P1pBp1/4P3/1r6/3K2P1/8/b Rb3b4!? (Adorjan_EofCE3) #1513 draw 1R6/2p1b3/2k5/2P1p3/5pP1/1p3P2/1r3B2/5K2/b Kc6d5!? (Adorjan_EofCE3) #1514 black_wins 7k/2R4p/6p1/1P3b2/2Bp1P2/8/4KPP1/1r6/b Pd4d3+ (Adorjan_EofCE3) #1515 white_wins 4k3/3b4/B2R2P1/pp5K/5P2/P3p3/1P4r1/8/w Rd6d5 (Adorjan_EofCE3) #1516 white_wins 1B1b4/8/p3Pk2/1ppr2p1/4R1P1/1P3P2/P1K5/8/w Bb8c7!? (Adorjan_EofCE3) #1517 white_wins 7r/B5bp/1R2p3/P2k1pp1/8/2P2P2/5P1P/3K4/w Ba7b8!? (Adorjan_EofCE3) #1518 white_wins 6R1/3p1k2/1p6/3K4/4P3/1B1b4/4p3/r7/w Kd5e5+!? (Adorjan_EofCE3) #1519 draw 7b/8/1kp4P/p1p5/7r/5R2/8/2BK4/b Pc5c4 (Adorjan_EofCE3) #1520 black_wins 1r3k2/5p2/p1P1b3/2p2p2/2p1P3/8/P7/2KR1B2/w Bf1h3!? (Adorjan_EofCE3) #1521 white_wins 2r1kb1R/8/4PB2/3K4/5p2/8/8/8/w Bf6g7!? (Adorjan_EofCE3) #1522 white_wins 6b1/8/3P4/1r4p1/1k6/4R3/4K3/1B6/w Re3e4+ (Adorjan_EofCE3) #1523 white_wins 2K2R2/2b5/6k1/2r5/8/2B3P1/1p6/8/w Rf8g8+ (Adorjan_EofCE3) #1524 draw 4k3/R7/6K1/p2r1pB1/8/6P1/1b3P2/8/b Bb2a3!? (Adorjan_EofCE3) #1525 draw 8/6p1/R2P2p1/7k/2B4P/4K3/6b1/1r6/w Pd6d7 (Adorjan_EofCE3) #1526 white_wins 7k/R7/7p/1b1B2p1/1P6/4K3/P6r/8/w Pa2a4 (Adorjan_EofCE3) #1527 white_wins 7k/6pp/3b1p2/8/r4P2/6P1/5B1P/1R4K1/w Rb1b6!? (Adorjan_EofCE3) #1528 white_wins 8/p3r2p/2bk2p1/R5P1/2BK4/1P6/7P/8/w Ra5a6!? (Adorjan_EofCE3) #1529 white_wins 8/1b6/p2k2P1/2Rp1B2/PKp5/2P5/6r1/8/w Bf5c8 (Adorjan_EofCE3) #1530 black_wins 8/R2b3r/8/1P3p2/Pk2pp2/8/3KB1P1/8/b Pe4e3+ (Adorjan_EofCE3) #1531 draw 8/B3p2p/4kb2/8/1PR2p2/2P2r2/K6P/8/b Ke6d5!? (Adorjan_EofCE3) #1532 black_wins 8/p7/R2bkp2/2p1p2r/2P2P2/6BP/P3K3/8/w Ph3h4!? (Adorjan_EofCE3) #1533 white_wins 5R2/1pkbr1p1/p6p/P2B1p2/1P1K3P/8/5PP1/8/w Pf2f4 (Adorjan_EofCE3) #1534 white_wins 8/p1pp2k1/4p2p/2P1Pb2/2BP1R2/6K1/P2r3P/8/b Pa7a5!? (Adorjan_EofCE3) #1535 black_wins 8/4k3/4b2p/1pp3p1/p5P1/Pr3B1P/1P1RPK2/8/w Pe2e3 (Adorjan_EofCE3) #1536 black_wins 3r2k1/p4p1p/4b1p1/1p6/2p1B3/P1R1P1P1/1P3P1P/6K1/b Rd8d1+!? (Adorjan_EofCE3) #1537 black_wins 6k1/1b3p1p/p5p1/3p4/Pp1P1P1P/4P3/R4PBK/2r5/w Pa4a5!? (Adorjan_EofCE3) #1538 white_wins 6k1/4pp1p/3p2p1/P1pPb3/R7/1r2P1PP/3B1P2/6K1/w Bd2b4!? (Adorjan_EofCE3) #1539 white_wins 8/pp3k2/2p1bp1p/4p1p1/2Pr4/1P4P1/P3PPBP/R4K2/b Rd4d2 (Adorjan_EofCE3) #1540 black_wins 7r/1p1kb1p1/p2p1p1p/P2PpP2/1P1pP1PP/3P4/6R1/3KB3/w Rg2b2 (Adorjan_EofCE3) #1541 white_wins 8/8/8/8/k7/2R4R/1p1p3K/8/w Rc3a3+ (Adorjan_EofCE3) #1542 white_wins 8/8/2kr4/3r4/2K5/5B2/8/8/b Rd6d8 (Adorjan_EofCE3) #1543 draw 3K4/7r/3k4/2R5/R7/8/8/8/w Rc5h5!? (Adorjan_EofCE3) #1544 white_wins 2k5/6K1/r6r/8/4P3/8/8/5R2/w Rf1f8+ (Adorjan_EofCE3) #1545 draw K7/8/1R6/8/PP6/2k5/1r6/1r6/w Pa4a5 (Adorjan_EofCE3) #1546 draw 8/4k3/5R1R/1K6/7r/1p6/6p1/8/w Rf6e6+ (Adorjan_EofCE3) #1547 white_wins 8/8/R4p2/1R4pk/5r1p/4K3/8/8/w Ra6a2 (Adorjan_EofCE3) #1548 white_wins 8/6R1/1p6/3r4/1kp5/1p5K/8/1R6/b Pb6b5 (Adorjan_EofCE3) #1549 black_wins k7/p6R/p7/8/8/8/5r1p/RK6/w Kb1c1 (Adorjan_EofCE3) #1550 white_wins 3r4/3k3p/5Rp1/5p2/8/8/1p5P/4R2K/b Rd8c8!? (Adorjan_EofCE3) #1551 draw 7k/7p/R6P/5r2/1P6/2P5/P5R1/4K3/b Rf5f1+ (Adorjan_EofCE3) (white should have won but it was drawn) #1552 white_wins 2r5/7k/PR3p2/5P1p/4P2p/2pp1P2/1p6/4R2K/w Re1g1 (Adorjan_EofCE3) #1553 black_wins 8/8/2N5/1r6/2K1N3/8/1r6/7k/w Ne4f2+!? (Adorjan_EofCE3) #1554 draw 8/3k4/6P1/8/1r2NPK1/r5N1/8/8/b Kd7e7 (Adorjan_EofCE3) #1555 draw 2r5/7P/5N2/B7/8/4r3/8/5K1k/w Ph7h8=Q+!? (Adorjan_EofCE3) #1556 draw 2B3K1/8/3N1p1p/6pk/5P1P/6P1/7r/5r2/w Nd6e8 (Adorjan_EofCE3) #1557 white_wins 8/2k5/2r1pPp1/p2r2Bp/7P/2N2P2/PPK3P1/8/w Pg2g4 (Adorjan_EofCE3) #1558 black_wins 8/5k2/6b1/4b3/8/8/3R4/2KR4/w Rd2f2+ (Adorjan_EofCE3) #1559 white_wins 8/R1K4k/R7/1bb5/8/8/8/8/w Ra6b6!? (Adorjan_EofCE3) #1560 white_wins 8/1p6/8/1B6/8/k1K5/rr6/2B5/w Bb5d7!? (Adorjan_EofCE3) #1561 white_wins 8/8/3R2R1/6K1/8/7k/1b1p1p2/3b4/w Rd6d3+!? (Adorjan_EofCE3) #1562 draw 5R2/6pk/4b3/1pp4p/3b4/6P1/2R2P1P/6K1/w Rf8b8 (Adorjan_EofCE3) #1563 white_wins 2k5/8/rn6/6R1/7R/1K6/8/8/w Rg5c5+!? (Adorjan_EofCE3) #1564 white_wins 2R5/8/5R2/1k6/3nK3/8/3r4/8/w Rf6f1 (Adorjan_EofCE3) #1565 white_wins 8/1R6/5k2/8/2n1K3/6r1/8/7R/w Ke4f4 (Adorjan_EofCE3) #1566 white_wins 8/2RR4/8/8/4k1K1/8/r2n4/8/w Rc7c8!? (Adorjan_EofCE3) #1567 white_wins 8/8/R7/3rk3/1R6/2P4n/6K1/8/b Nh3f4+ (Adorjan_EofCE3) #1568 white_wins 8/8/R7/4r1p1/7n/8/7R/1K1k4/w Ra6a1 (Adorjan_EofCE3) #1569 white_wins 5k1r/R5R1/3n4/4p3/8/8/6K1/8/w Rg7d7 (Adorjan_EofCE3) #1570 white_wins r4k2/n7/1p6/8/8/8/8/1R1R1K2/w Rb1a1 (Adorjan_EofCE3) #1571 white_wins 8/5p1n/1k6/2R5/4p3/8/1r6/2R1K3/w Rc5h5 (Adorjan_EofCE3) #1572 white_wins 8/6R1/4ppp1/3n1k1p/6rP/R5P1/5PK1/8/w Kg2h2!? (Adorjan_EofCE3) #1573 white_wins 5k2/p2r1p2/1p1n2p1/3R4/3P4/7P/P5K1/2R5/w Rc1e1!? (Adorjan_EofCE3) #1574 white_wins r5k1/8/1P4p1/N5Pp/R2K1p1P/2P2r2/8/8/b Ra8d8+ (Adorjan_EofCE3) #1575 draw 8/1p2ppk1/p1np2p1/8/2R1P3/1P4KP/P1R3P1/4r3/b Pg6g5!? (Adorjan_EofCE3) #1576 draw 8/1p1r1k1p/pR1p2p1/P1nPp1P1/2P1Pp2/5P2/5K2/R7/w Kf2e2 (Adorjan_EofCE3) #1577 white_wins 7R/8/4pk2/5p1p/3r2nP/1R6/8/6K1/b Kf6e5 (Adorjan_EofCE3) #1578 draw 8/r7/6R1/2kp2NP/8/5P2/3r2PK/8/b Rd2a2!? (Adorjan_EofCE3) #1579 white_to_move 8/1P6/8/6pk/7n/1R3pp1/2r5/1R4K1/w Pb7b8=Q (Adorjan_EofCE3) #1580 black_wins 1r4k1/5p2/p4pp1/8/R7/7P/1n4P1/5R1K/w Ra4a2 (Adorjan_EofCE3) #1581 white_wins 6rk/p6p/1p6/2p5/1P3pn1/5R2/PR5P/7K/b Ng4e5!? (Adorjan_EofCE3) #1582 draw 7k/p3r2p/1p2N3/2pPPr2/2P5/8/PP5P/4R2K/b Ph7h6 (Adorjan_EofCE3) #1583 white_wins 1kr5/p1pR4/2P3pp/5p2/1N6/KP2p3/2P2r2/8/w Nb4a6+ (Adorjan_EofCE3) #1584 white_wins 8/2R5/7k/3p4/1N1P4/r7/5r2/2K5/w Nb4c2 (Adorjan_EofCE3) #1585 black_wins 8/8/2pk4/3r4/8/2KN2r1/1P6/3R4/b Kd6c7 (Adorjan_EofCE3) #1586 black_wins 5r1k/3R3p/p3P3/1p6/1P6/r5N1/7P/7K/w Ng3f5!? (Adorjan_EofCE3) #1587 black_wins 8/R7/1r2ppk1/3n2p1/1p2R3/3K1PP1/PP6/8/w Kd3c4 (Adorjan_EofCE3) #1588 white_wins 8/p5pp/2p1k3/2P5/5p2/N2r1P2/P1R1K1PP/3r4/b Rd3d5!? (Adorjan_EofCE3) #1589 black_wins 8/6k1/3K2b1/8/7r/6R1/8/R7/w Ra1g1 (Adorjan_EofCE3) #1590 white_wins 1r2kbR1/R6K/8/8/8/8/8/8/w Rg8h8!? (Adorjan_EofCE3) #1591 white_wins 8/8/8/8/8/1k6/3r4/R4KBr/w Ra1b1+!? (Adorjan_EofCE3) #1592 draw 2b1k3/8/8/r6P/8/1R6/7K/3R4/w Rb3e3+ (Adorjan_EofCE3) #1593 white_wins 2r3k1/R7/8/3R4/8/5PK1/2b5/8/w Pf3f4 (Adorjan_EofCE3) #1594 white_wins 8/1K4bk/8/2R5/4r3/8/6RP/8/w Rc5h5+ (Adorjan_EofCE3) #1595 white_wins 8/3k1b1K/2rp4/8/8/8/3R4/6R1/w Rg1g7 (Adorjan_EofCE3) #1596 white_wins 1R6/1R4p1/8/8/b7/8/K7/3r3k/w Rb8h8+ (Adorjan_EofCE3) #1597 white_wins 8/8/8/3r2k1/5pp1/4b3/2R3K1/1R6/w Rc2a2 (Adorjan_EofCE3) #1598 draw 8/6P1/1k6/8/1B6/1P6/3R2K1/1r5r/w Kg2g3!? (Adorjan_EofCE3) #1599 white_wins r7/3R4/2K4p/1p2b3/6R1/8/8/7k/w Rd7d5 (Adorjan_EofCE3) #1600 white_wins 8/4R1R1/3p3r/8/1p6/3p3k/b7/5K2/w Re7e3+ (Adorjan_EofCE3) #1601 white_wins 8/8/6r1/1R6/p4k2/P1B5/1P3r2/7K/b Rf2c2!? (Adorjan_EofCE3) #1602 black_wins 8/5k2/8/5p2/2r2P2/1r2BK1P/R7/8/b Rc4e4 (Adorjan_EofCE3) #1603 black_wins 3rk3/1KB5/4r3/4p3/8/8/2P2P2/7R/b Rd8d4!? (Adorjan_EofCE3) #1604 black_wins 2R1K3/R7/6p1/P7/1k3r2/8/3p3b/8/w Ra7b7+ (Adorjan_EofCE3) #1605 white_wins 1R6/8/3Pp3/2Br2p1/1P2k3/1r6/4KP2/8/w Rb8e8!? (Adorjan_EofCE3) #1606 draw r7/1p4k1/2p4p/2P1rB2/1P3RPP/8/2K5/8/b Re5e3 (Adorjan_EofCE3) #1607 draw 8/5kp1/1R1b4/2p4p/1p2R3/5KPP/5P2/3r4/w Kf3e2 (Adorjan_EofCE3) #1608 white_wins 8/p2k1p2/1p3p2/1P1P4/4P1P1/1R1BKP2/7r/2r5/b Rh2a2 (Adorjan_EofCE3) #1609 draw 8/p2r3p/6p1/3kp3/3bRP1P/2p3P1/P1K5/4R3/b Rd7b7!? (Adorjan_EofCE3) #1610 draw 5rk1/2R3pp/p7/P2P1p2/4p3/7P/3b2P1/5R1K/w Rc7e7!? (Adorjan_EofCE3) #1611 white_wins 2r4k/1p4pp/1R2b3/3pPp2/5P2/2p5/P5PP/5R1K/b Rc8c6!? (Adorjan_EofCE3) #1612 white_wins 8/8/pr3bk1/6pp/1PR5/6K1/4R3/8/w Re2c2 (Adorjan_EofCE3) #1613 draw 8/3k4/1R2p1p1/p4r2/P3RPKp/6b1/8/8/w Rb6a6!? (Adorjan_EofCE3) #1614 white_wins 2r3k1/8/3B1p2/2P2P1p/2K1P3/3P3r/8/R7/w Pd3d4 (Adorjan_EofCE3) #1615 white_wins 8/5R2/1b1p2p1/p2Pp1k1/4P3/2r5/4R3/7K/b Kg5g4 (Adorjan_EofCE3) #1616 black_wins kr6/pr4p1/2p5/2P3PP/3R1P2/1B6/P7/2K5/b Rb8h8 (Adorjan_EofCE3) #1617 white_wins r7/p5p1/5k2/2p5/7r/2KBPP2/PP2R2P/8/w Bd3e4!? (Adorjan_EofCE3) #1618 draw 7k/5R2/8/6P1/1KB1P2P/1pP2P2/6r1/1r6/w Ph4h5 (Adorjan_EofCE3) #1619 white_wins r7/6R1/8/2K2P2/5kb1/8/7p/7R/w Pf5f6 (Adorjan_EofCE3) #1620 draw 8/6k1/2B3p1/7p/3r3P/R4KP1/3r4/8/b Rd4d6!? (Adorjan_EofCE3) #1621 black_wins 8/8/8/5pk1/7p/5B1P/1r1r1PK1/5R2/b Kg5f4 (Adorjan_EofCE3) #1622 black_wins 8/5P1p/2r1B3/8/1p4P1/6k1/3r4/5RK1/b Rc6c2!? (Adorjan_EofCE3) #1623 black_wins 1r6/R7/4rkp1/4p2p/4P2P/5BK1/6P1/8/b Rb8h8!? (Adorjan_EofCE3) #1624 black_ahead 6R1/p6p/4p2k/P3P3/5R2/r6P/2K1b3/8/w Rf4f6+ (Adorjan_EofCE3) #1625 white_wins 8/5pk1/4b1p1/p7/P2R4/KP1P4/1R6/6r1/w Rb2e2!? (Adorjan_EofCE3) #1626 white_wins 2r5/R3p3/5b1p/8/1PP3p1/PK3k2/8/2R5/w Ra7d7 (Adorjan_EofCE3) #1627 white_wins 3rbk2/R6p/p7/6p1/6P1/1P6/1P1p3P/3R2K1/b Be8f7 (Adorjan_EofCE3) #1628 white_wins 5k2/5p1p/6p1/5b2/8/8/P1pr1PPP/4RRK1/w Re1c1 (Adorjan_EofCE3) #1629 black_wins 4k3/R2R4/2r3r1/8/8/8/8/4K3/w Rd7h7 (Adorjan_EofCE3) #1630 white_wins 3k4/8/8/8/8/4R3/5r1r/4R1K1/w Re1d1+!? (Adorjan_EofCE3) #1631 white_wins 8/8/8/8/8/4R3/r1k4r/5KR1/b Kc2d2 (Adorjan_EofCE3) #1632 draw 3r1r2/2k5/K7/7R/8/8/8/1R6/w Rb1b7+ (Adorjan_EofCE3) #1633 white_wins 3r2r1/7k/8/7K/8/8/8/3RR3/w Re1e7+ (Adorjan_EofCE3) #1634 white_wins 8/8/6k1/8/1r6/R2R1K2/2r5/8/w Rd3d6+!? (Adorjan_EofCE3) #1635 white_wins 8/3k4/3r1P2/8/2R5/7r/5K2/R7/w Pf6f7 (Adorjan_EofCE3) #1636 white_wins 5k2/8/8/8/2K5/pr2r3/4R3/2R5/w Rc1f1+ (Adorjan_EofCE3) #1637 white_wins 1r6/R3R3/6K1/2k3P1/8/7r/8/8/w Kg6g7 (Adorjan_EofCE3) #1638 white_wins 1k6/2R2R2/8/6r1/p7/7K/1r6/8/w Rc7e7 (Adorjan_EofCE3) #1639 black_wins 4R3/2R5/5K2/3k2r1/5P2/8/5r2/8/b Rg5h5 (Adorjan_EofCE3) #1640 white_ahead 8/8/1rk5/8/RP6/2K4R/8/2r5/w Kc3b2 (Adorjan_EofCE3) #1641 draw r1k1r3/5R2/p5R1/2K5/8/8/8/8/w Kc5c6 (Adorjan_EofCE3) #1642 white_wins 8/3kr3/p5K1/r7/2R5/8/8/2R5/w Rc1d1+ (Adorjan_EofCE3) #1643 white_wins 8/8/5PR1/5K2/1r4Pk/7r/5R2/8/b Rh3f3+!? (Adorjan_EofCE3) #1644 draw 8/8/2R5/4pp2/8/7K/R7/r1r4k/w Rc6c2!? (Adorjan_EofCE3) #1645 white_wins 8/3k4/R7/1P3RK1/1r6/8/6P1/7r/b Rh1b1 (Adorjan_EofCE3) #1646 white_wins 8/R3R1pk/p5r1/8/r7/5K2/8/8/b Ra4a5 (Adorjan_EofCE3) #1647 black_wins 8/7r/4p3/4p2r/5k2/8/4R3/4R1K1/w Re1f1+ (Adorjan_EofCE3) #1648 white_wins 3rk2r/2K3Rp/8/R6p/8/7p/8/8/w Ra5a3!? (Adorjan_EofCE3) #1649 white_wins 8/6pk/7p/2R5/5K2/1R5P/4r3/6r1/b Re2e8!? (Adorjan_EofCE3) #1650 black_wins 5kr1/7R/3K4/7R/2p5/2P1p1r1/8/8/w Rh5f5+ (Adorjan_EofCE3) #1651 white_wins 8/8/R4p2/p1r2rk1/8/8/R4PK1/8/b Kg5h5 (Adorjan_EofCE3) #1652 draw 7k/R7/p2R1K2/r4p2/5P2/8/6r1/8/w Ra7a8+!? (Adorjan_EofCE3) #1653 white_wins 8/R7/4p3/2Kpkr2/1P4r1/8/8/7R/b Rg4c4+ (Adorjan_EofCE3) #1654 draw 2R5/4r3/5Rpk/7p/6r1/2P2K2/8/8/b Re7e1 (Adorjan_EofCE3) #1655 black_wins 6k1/4P3/4r3/8/2R1pK2/2p4R/3r4/8/w Rc4c8+ (Adorjan_EofCE3) #1656 white_wins r5r1/4RR2/3k2p1/7p/7P/6P1/5PK1/8/w Re7e2 (Adorjan_EofCE3) #1657 white_wins 6k1/6p1/5p2/7R/1r3PKP/3R2P1/1r6/8/w Rd3d8+ (Adorjan_EofCE3) #1658 white_wins 8/1p6/4rkp1/PR5p/7P/5r2/3K4/6R1/b Rf3f5 (Adorjan_EofCE3) #1659 draw 8/R4p2/6pk/1r6/p4PK1/3R3P/8/r7/b Ra1g1+ (Adorjan_EofCE3) #1660 draw 8/p2r4/5k2/5P2/6p1/1P3r2/P1K1R3/6R1/b Pg4g3!? (Adorjan_EofCE3) #1661 draw 2r5/7R/2Ppk3/R7/2p2P2/2r3P1/5K2/8/b Rc3c2+ (Adorjan_EofCE3) #1662 white_wins 2R5/3R1pk1/4p1p1/4P3/5P2/7p/1r3r1P/2K5/w Rd7d8 (Adorjan_EofCE3) #1663 white_wins 6k1/4Rp1p/2R3p1/p7/P4P2/6PK/1r4r1/8/b Ph7h5 (Adorjan_EofCE3) #1664 black_wins 8/p2r2p1/2p5/2k5/R1P1R1K1/PP4P1/7r/8/w Ra4a6 (Adorjan_EofCE3) #1665 white_wins r4k2/p2r2pp/2R5/8/P7/4R1P1/5P1P/6K1/w Pa4a5!? (Adorjan_EofCE3) #1666 white_ahead r5k1/p4p1p/R7/8/8/8/Pr3PPP/R5K1/b Ra8d8!? (Adorjan_EofCE3) #1667 draw 6k1/R1p3p1/5p1p/5P1P/2R1P2K/3r2r1/8/8/b Rg3g5!? (Adorjan_EofCE3) #1668 black_wins 6r1/8/1p6/k1p3r1/p6R/P5P1/1PP3RK/8/w Pg3g4 (Adorjan_EofCE3) #1669 white_wins 1r6/8/5p1k/2R3p1/1r5p/KP3P1P/3R2P1/8/w Rd2b2 (Adorjan_EofCE3) #1670 white_wins r7/P1r2p2/4pk1p/8/R3KP1P/4P3/R7/8/w Pf4f5!? (Adorjan_EofCE3) #1671 white_wins 2R5/p4p1k/5p1p/r5r1/3R1KP1/4P2P/8/8/w Rd4d8 (Adorjan_EofCE3) #1672 white_wins 2k5/2p1R3/2p5/7p/1P6/Pr6/3r2PP/R5K1/w Re7f7 (Adorjan_EofCE3) #1673 white_wins 7R/p4k2/4rp2/r3p2R/P7/3P2PP/6K1/8/w Rh5h7+ (Adorjan_EofCE3) #1674 white_wins 8/2r3p1/6k1/4p3/3pr3/1P6/1KP2RPP/R7/w Ra1d1 (Adorjan_EofCE3) #1675 white_wins 8/1p1r4/8/2r1k3/3p2P1/P3p1K1/1RP4P/4R3/b Rd7c7 (Adorjan_EofCE3) #1676 black_wins 2r4k/pp1r4/8/4R1P1/2p2P2/8/P4KP1/R7/b Pc4c3 (Adorjan_EofCE3) #1677 draw 2r4k/5K1p/8/5R2/3p1p1r/1PpP4/P7/2R5/b Rh4h6!? (Adorjan_EofCE3) #1678 black_wins 6k1/5pp1/1p3r1p/8/1R4P1/7P/PP2rP2/5RK1/b Kg8f8 (Adorjan_EofCE3) #1679 white_wins 5rk1/R4pp1/1p2p2p/3r3P/8/1P3R2/P5P1/6K1/w Pa2a4!? (Adorjan_EofCE3) #1680 draw 1r6/R5R1/7p/1pp1r1p1/2P1P1k1/3P2P1/2P3K1/8/w Ra7f7!? (Adorjan_EofCE3) #1681 white_wins 2r4k/4r2p/1p6/2ppPR2/1P3P2/8/2R3PP/6K1/w Rf5f6!? (Adorjan_EofCE3) #1682 white_wins 2r5/pp3pkp/2r5/3pPR2/3P4/7P/P4PP1/4R1K1/w Re1e3 (Adorjan_EofCE3) #1683 white_wins 8/p2Rp1r1/r2p4/P1p2p2/2P1k3/1P2P1P1/4KP2/R7/w Pb3b4!? (Adorjan_EofCE3) #1684 white_wins 4r3/5kpp/p4p2/2ppr3/P7/1PP5/3R1P1P/5R1K/b Re8b8 (Adorjan_EofCE3) #1685 black_wins 4k3/pr3ppp/3rp3/1P6/1R1P4/3K2P1/P4P1P/1R6/w Pa2a4 (Adorjan_EofCE3) #1686 white_wins 4r1k1/1RR2p1p/2p5/2p5/2Pp2p1/r5P1/4PP1P/5K2/b Pd4d3!? (Adorjan_EofCE3) #1687 black_wins 7r/5r2/p3p1k1/4P1p1/2pPKpp1/6P1/P4R1P/5R2/b Pf4f3 (Adorjan_EofCE3) #1688 black_wins r6k/1p3p1p/p1p1p3/6r1/2PP4/1P4P1/1P3PP1/R2R2K1/w Rd1d3 (Adorjan_EofCE3) #1689 white_wins 6r1/4k3/1p2p3/p1rp1p1p/P2RpP2/1KP1R1PP/1P6/8/b Ph5h4!? (Adorjan_EofCE3) #1690 black_wins 3r4/5R2/8/4k2p/1P3R1P/P7/6r1/4K3/b Rg2a2!? (Adorjan_EofCE3) #1691 draw 8/5k2/7R/5p2/1P6/6RP/2r2rP1/6K1/w Rh6c6!? (Adorjan_EofCE3) #1692 white_wins 8/8/prPr3k/8/4R1pK/R1p5/8/8/w Pc6c7 (Adorjan_EofCE3) #1693 white_wins 4r3/2R5/1p2k3/pP6/P2r1PR1/3P1K2/8/8/b Re8d8 (Adorjan_EofCE3) #1694 white_wins R5R1/2rkr2p/p7/2p1p2P/P3K3/8/8/8/w Ke4d5 (Adorjan_EofCE3) #1695 white_wins 2R5/p4pkp/2P3p1/8/1r6/r7/6P1/2R3K1/b Ra3a2!? (Adorjan_EofCE3) #1696 white_wins 2r4k/1R4Rp/p2p1p2/7r/2p2P2/6PP/8/6K1/w Kg1g2!? (Adorjan_EofCE3) #1697 draw 8/R7/7R/7P/1p6/1P5P/KP3k2/4r2r/w Rh6f6+!? (Adorjan_EofCE3) #1698 draw 1r5k/5p1p/5p1K/5P2/7P/8/1pp3r1/1R2R3/w Ph4h5!? (Adorjan_EofCE3) #1699 draw 8/8/8/5R2/1P1krP2/P3p1P1/4R1KP/1r6/w Rf5c5 (Adorjan_EofCE3) #1700 white_wins 1r2kr2/R7/3K2R1/8/8/7p/7P/8/w Rg6g7 (Adorjan_EofCE3) #1701 white_wins 8/5p2/8/5R2/6P1/8/5rk1/r2RK3/b Rf2f1+!? (Adorjan_EofCE3) #1702 draw 8/4r3/1P5K/8/1p2kr2/8/R7/R7/w Ra1e1+!? (Adorjan_EofCE3) #1703 white_wins 2k4r/8/2K4P/5p2/1r6/3R4/R7/8/w Ph6h7!? (Adorjan_EofCE3) #1704 white_wins 8/4pk2/8/2K5/2P4R/1r6/3r4/7R/w Rh4e4!? (Adorjan_EofCE3) #1705 white_wins 5k2/3P4/3r4/6R1/6p1/1R6/2r5/K7/w Rb3b8+ (Adorjan_EofCE3) #1706 white_wins 5rk1/3R4/RP3r2/8/5p2/8/6K1/8/w Ra6a7 (Adorjan_EofCE3) #1707 white_wins 8/8/5P1k/8/2K5/pr2r3/4R3/2R5/w Pf6f7 (Adorjan_EofCE3) #1708 white_wins 5r1k/R3R2p/P7/8/4K3/8/7r/8/b Rh2h4+ (Adorjan_EofCE3) #1709 draw 2rr3k/6p1/R5R1/8/8/3p1PK1/6P1/8/w Rg6d6!? (Adorjan_EofCE3) #1710 draw 7R/1p3k2/5p2/7R/6K1/5PP1/6r1/r7/b Ra1g1!? (Adorjan_EofCE3) #1711 draw 8/P1k3p1/1R4p1/7P/8/6K1/5r1R/r7/w Ph5h6!? (Adorjan_EofCE3) #1712 white_wins 8/7R/2rpk3/R7/2p2P2/2r3P1/5K2/8/w Pf4f5+ (Adorjan_EofCE3) #1713 white_wins 5k2/6RR/p7/1pr5/1r6/8/6PP/6K1/w Ph2h3 (Adorjan_EofCE3) #1714 white_wins 1r2k3/2R2R2/p2p4/8/8/6PK/r6P/8/w Rc7e7+ (Adorjan_EofCE3) #1715 white_wins 8/p2r1k2/8/5p2/6p1/1P2Pr2/P1K1R3/6R1/w Pe3e4!? (Adorjan_EofCE3) #1716 draw 7k/6p1/7p/1P6/3RK1P1/2r4P/2p4r/2R5/b Rh2e2+ (Adorjan_EofCE3) #1717 draw 8/6kp/1P4p1/P1R5/5p2/8/2r3rP/3R2K1/w Kg1f1 (Adorjan_EofCE3) but white is lost (mated soon). No good move. #1718 black_wins 8/8/8/R3pp2/P2p1k2/1P1r4/1KP2r2/2R5/b Pe5e4 (Adorjan_EofCE3) #1719 black_ahead 1k2r3/1p4R1/p7/7p/5P2/5K2/1r2P2P/4R3/w Pe2e4 (Adorjan_EofCE3) #1720 white_wins 5r2/6k1/8/p3rP2/4p1Pp/R6P/5K2/4R3/b Rf8d8!? (Adorjan_EofCE3) #1721 draw 8/6pp/pR2pk2/P7/4R3/4P1P1/r5rP/4K3/w Rb6xPe6+ (Adorjan_EofCE3) #1722 black_wins 4r3/2R2pk1/6p1/2pR3p/2r4P/4PKP1/5P2/8/w Rd5d7!? (Adorjan_EofCE3) #1723 white_wins 6rk/R2R2p1/7p/1p1p4/8/3P1P2/1r4PP/6K1/w Ph2h4!? (Adorjan_EofCE3) #1724 draw 8/4RR2/p1r3kp/1p1p4/3r2P1/1P4K1/P4P2/8/w Pf2f4 (Adorjan_EofCE3) #1725 white_wins 6R1/1kp3P1/1p6/p6p/r5rP/4PK2/2P3R1/8/w Pe3e4!? (Adorjan_EofCE3) #1726 white_wins 8/4P2p/3p1ppk/8/P7/1P4r1/2r3P1/1R2R1K1/w Kg1h2!? (Adorjan_EofCE3) #1727 white_wins 6k1/p4p1p/1p4p1/3r4/2r5/P1P4P/2R2PP1/2R1K3/b Rc4e4+ (Adorjan_EofCE3) #1728 black_wins 6k1/5pp1/8/p2RpR2/Pp4P1/1Pr2PK1/6P1/7r/b Pf7f6 (Adorjan_EofCE3) #1729 white_ahead 5r1r/1kp5/4R2p/p1P5/P4pp1/2P5/5RPP/6K1/b Rf8f5 (Adorjan_EofCE3) #1730 draw 3k2r1/2p1r2p/1p1p2p1/p2P2P1/P3PPP1/5K2/2R5/7R/w Rh1g1 (Adorjan_EofCE3) #1731 white_wins 6k1/1p2r1p1/p3pr1p/3pR2P/P2P2P1/2R2PK1/1P6/8/w Pf3f4!? (Adorjan_EofCE3) #1732 white_wins 4k3/3r2p1/1p3p2/p1pPrP1p/P1P1P3/6KP/4R3/4R3/w Re1b1 (Adorjan_EofCE3) #1733 white_wins r7/r1k3pp/p7/1pPp4/1P1Pp3/4P3/R4KPP/R7/w Ra2a5 (Adorjan_EofCE3) #1734 white_ahead 4r3/5pk1/p4p1p/p3rP2/6P1/2PRp2P/PPK1R3/8/b Ph6h5!? (Adorjan_EofCE3) #1735 draw 8/rkp1r1p1/1p1p1p2/p2Pp3/4PPKP/3P4/PPR5/2R5/w Pf4xPe5!? (Adorjan_EofCE3) #1736 white_wins 5r2/5r2/p3p1k1/1p1pPpp1/3P2p1/1PP1K1P1/P4R1P/5R2/b Rf8h8!? (Adorjan_EofCE3) #1737 black_wins 8/p2r1pkp/1p1p1r1p/2p5/2P5/3RP1P1/PP3P1P/3R2K1/w Pe3e4!? (Adorjan_EofCE3) #1738 white_wins 4r3/p3kppp/1p1p3r/2pR4/2P2P1P/1P1RP1P1/P4K2/8/w Pe3e4 (Adorjan_EofCE3) #1739 white_wins 8/1p2kp2/p1rpppr1/7p/2PRP2P/1P4P1/P4PK1/3R4/w Pc4c5!? (Adorjan_EofCE3) #1740 white_wins 1k2r3/1ppr2pp/p1p2p2/5R2/4P3/1P1P3P/P1P3P1/5RK1/w Pg2g4 (Adorjan_EofCE3) #1741 white_ahead 4rrk1/p5pp/2p5/3p1p2/2p5/2P1PP2/PPK2P1P/3R1R2/w Rd1d4!? (Adorjan_EofCE3) #1742 white_ahead 4r1k1/2p3pp/rppp4/4p3/4P3/P2R1P2/1PP2RPP/6K1/b Pb6b5!? (Adorjan_EofCE3) #1743 draw 8/p3kp1p/p3p1p1/P1PpP3/3P4/1rPK4/2R2RPP/1r6/w Pc5c6!? (Adorjan_EofCE3) #1744 white_wins 5r2/5r2/2ppkppp/2p1p3/p1P1P1PP/P2PPRK1/1P6/5R2/b Rf7h7 (Adorjan_EofCE3) #1745 draw 5rB1/3R4/8/8/3K2kB/p7/8/8/w Rd7d8 (Adorjan_EofCE3) #1746 white_wins gnuchess-4.0.pl70/test/CHESSTEST/finecomb.fin100644 21542 13 14261 5527662450 17636 0ustar cracraftuser##50 Positions from R. Fine: World's greatest chess games. These are #among the most difficult combinations ever played over the board, Fine #seems to imply. It is far from clear, though, how correct they are and #whether the indicated best move is always unique. Usually is. #Gnuchess got only 8 right out of these 50 at 1 minute per move setting. # # rn2k2r/pp2q1pp/1b1p1n2/3Np1B1/2B1Ppb1/5N2/PP2Q1PP/3R1K1R/b Nf6xNd5 (Fine_WGCG) (page 7. Macdonnell, immortal game.) "Black has 2 pcs and a powerful attk for the Q. Subsequent analysis has never been able to demonstrate... adequate defense." r1qnk2r/ppp2ppp/1b5n/4p1Nb/2B1P3/BQP2P2/P5PP/RN1R3K/w Rd1xNd8+ (Fine_WGCG) (page 9, Capt. Evans.) Led to mate in the game, but should've led to less. Gnuchess finds the cook Qb3b5+, leading to major material gain... rnb1k1nr/p2p1ppp/8/1pbN1N1P/4PBP1/3P1Q2/PqP5/R4KR1/w Bf4d6 (Fine_WGCG) (page 17. Anderssen. Immortal.) incredible mate 1r2k1r1/pbppnp1p/1bn2P2/7q/Q7/B1PB1N2/P4PPP/R3R1K1/w Ra1d1 (Fine_WGCG) (page 17. Anderssen. Evergreen.) mates 4r1k1/p1pb1ppp/Qbp1r3/8/1P6/2Pq1B2/R2P1PPP/2B2RK1/b Qd3xBf3 (Fine_WGCG) (page 24. Morphy.) wins r2qr1k1/pp3ppp/2n2n2/8/2P2Pb1/3P4/P1PBB1PP/R2Q1KNR/b Re8xBe2 (Fine_WGCG) (page 26. Morphy.) mates 2qnr1k1/p5p1/R1p3Np/3pNP2/3P4/2P5/5P1K/4R3/w Ne5xPc6 (Fine_WGCG) (page 29. Bird.) wins r3k2r/pp1qn1pp/2p2p2/8/3P4/5N2/PP2QPPP/2R1R1K1/w Pd4d5 (Fine_WGCG) (page 35. Steinitz.) wins r2q1rk1/pbpnb2p/1p4p1/3pN3/3P1Pp1/3BB2R/PPP1Q2P/R5K1/w Rh3xPh7 (Fine_WGCG) (page 37. Steinitz.) mates brk4r/p1p2Ppp/2n5/bN3n1q/2B5/B4N2/P3QPPP/5RK1/w Nb5xPa7+ (Fine_WGCG) (page 38. Kolisch.) gnuchess seems to think the simple Pf7f8=Q, winding up 1 pawn up, is a good idea... Kolisch's move apparently forces quick victory, though. 2r4k/pb2q2P/1p6/3Pp3/4p3/1P2R3/PBrQ2PP/5RK1/w Qd2b4 (Fine_WGCG) (page 40. Zukertort.) wins r1bqr1k1/p4ppp/2p1p3/b1B5/8/1R1B4/P1P2PPP/3Q1RK1/w Bd3xPh7+ (Fine_WGCG) (page 41. Zukertort.) wins 5rk1/pp3pp1/4Pb1p/q2p3Q/3P4/2r5/PP4PP/1K1R1B1R/b Rc3a3 (Fine_WGCG) (page 53. Lasker.) wins 5kn1/6p1/5qR1/4pP2/1P1pP3/p2P1N1Q/1rr5/5R1K/b Pa3a2 (Fine_WGCG) (page 65. Tarrasch.) at least draws r3n1k1/4R2p/4p1pB/3p1p2/3P4/2P2P1P/6P1/6K1/w Kg1h2 (Fine_WGCG) (page 69. Tarrasch.) quick win. probably there are cooks. 3b2rk/7p/p7/2pbqNrn/Pp1p1R2/1P1Q2P1/1BPN1R1P/6K1/w Rf4xPd4 (Fine_WGCG) (page 69. Tarrasch.) mates 6k1/3nr1pp/2q2p2/5PP1/1p1Pp1NQ/rbp1P2P/5R2/2N2RK1/w Rf2g2 (Fine_WGCG) (page 74. Pillsbury.) wins material, at least r2qk2r/1p1b1p2/1P2p1p1/p2pP2p/n2N1P2/b2PB3/4NQPP/1R3RK1/w Pf4f5 (Fine_WGCG) (page 75 Pillsbury.) "rockcrusher" r1b2rk1/p1q3pp/1p2p3/2b1np1P/1PP5/2B3P1/P1QN1P2/R3KB1R/b Bc5xPf2+ (Fine_WGCG) (page 86. Rubinstein.) wins kb1r2r1/pp2qpp1/2p4p/P3p3/2B1Pn2/2PP1R1P/1PK2QP1/R5B1/w Pg2g3 (Fine_WGCG) (page 87. Rubinstein.) wins an N 4rn1r/pp3kpp/1qpb1p2/3p1b2/3P3N/2PB2N1/PP2QPPP/1R3RK1/w Nh4xBf5 (Fine_WGCG) (page 90. Marshall.) 3r2k1/1bp2pp1/1p2p2p/8/2P2q2/1KN2N2/1P2Q1PP/r4B1R/b Pb6b5 (Fine_WGCG) (page 94. Marshall.) mates r1bqr1k1/pppnppbp/3p2p1/7n/3P1B2/3BPN2/PPPN1PP1/R2QK2R/w Rh1xNh5 (Fine_WGCG) (page 95. Marshall.) wins r1bq1k1r/ppppbpp1/5nB1/3P2p1/3Q4/5N2/PP1N1PPP/4RK1R/w Nf3e5 (Fine_WGCG) (page 96. Marshall.) wins mat 5rk1/1p3rpp/2bpp3/p1q5/1PP1P3/P1QR2P1/6BP/4R2K/b Bc6xPe4 (Fine_WGCG) (page 139. Spielmann.) wins 5rr1/pp1R3p/k1p5/8/2N4P/P1p5/1PB2qPQ/1K6/w Qh2c7 (Fine_WGCG) (page 142. Spielmann.) wins r1b3k1/pp1n3p/2pbpq1r/3p4/3Pp1p1/PP2P1P1/1BQN1P1P/3RRBK1/b Rh6xPh2 (Fine_WGCG) (page 143. Tartakower.) wins, but quiet moves probably also suffice since black is a P up with better position... 2rqrk2/4ppbQ/p2p2pR/np4P1/2b1P3/2NBBP2/PPP5/2KR4/w Pe4e5 (Fine_WGCG) (page 144. Tartakower.) wins rnbqr1k1/pp3pp1/3b1n1p/4N3/2Np4/2PB4/PP4PP/R1BQ1RK1/w Ne5xPf7 (Fine_WGCG) (page 145. Tartakower.) wins 5r1k/4p2p/1p2Q1p1/p1pPb2q/4P1Nr/5P2/PP2R2P/5R1K/b Rh4xNg4 (Fine_WGCG) (page 146. Yates.) mates 1r1rnk2/pp4pb/4pp1p/N7/PP1nP3/2N2P2/5KPP/2RR1B2/w Nc3b5 (Fine_WGCG) (page 161. Alekhine.) wins a P r2r2k1/p2b2pp/Q3p3/1p1pPp1q/5P2/2P1P3/P4PBP/3R2RK/w Bg2xPd5 (Fine_WGCG) (page 166. Bogoljubow.) wins 2r2rk1/p2n1p1p/1p2q1p1/4p2n/4P3/2B2P1R/PP2NP1P/2QR3K/w Rh3xNh5 (Fine_WGCG) (page 166. Bogojubow.) wins r2r2k1/pbqn1pp1/1p5p/2bpP3/2P5/3B1N2/PB2Q1PP/R4R1K/w Nf3g5 (Fine_WGCG) (page 169. Flohr.) wins 1rbqrbk1/pp4pp/4np2/2p2N2/P4P2/8/PBQPP1BP/2R1K1R1/w Bg2c6 (Fine_WGCG) (page 171. Flohr.) wins r3k2r/pp1npp2/3p4/2pP4/Q1P1q2P/2P1B3/P3KP2/1R5R/b Pb7b5 (Fine_WGCG) (page 175. Flohr.) wins r4r2/pb1n1kq1/1ppb2p1/3p1p2/3P4/P1B1PQNR/1P2NPP1/2KR4/w Bc3d2! (Fine_WGCG) (page 174. Flohr. Misprinted.) wins r4rk1/3p1ppp/bpn1p1q1/p7/2P1P3/2PQBN2/P4PPP/1K1R2R1/b Pd7d5 (Fine_WGCG) (page 178. Kashdan.) q1r1r3/pb2b1kp/1p1pQnp1/2nP4/2P5/1P1B2N1/PB3PPP/2R1R1K1/w Ng3f5+ (Fine_WGCG) (page 180. Colle.) r7/pp4kp/5n2/3pr3/1b6/1Q1B1pPb/PP3P1P/R5KR/b Bb4c5 (Fine_WGCG) (page 186. Stoltz.) r4rk1/2p3pp/4p3/1p6/p2P1N2/P1P2bP1/qP1QR2P/2KR4/b Pb5b4 (Fine_WGCG) (page 188. Stahlberg.) wins a piece 6k1/2N1rpp1/1B4b1/P2P3p/8/1q1n3P/3R1QPK/8/w Pd5d6 (Fine_WGCG) (page 191. Thomas.) gets R,N,B for a Q and will win 2r2rk1/1b2q2p/4pPpQ/p1b3Nn/PpN5/3B4/1P3PPP/2RR2K1/b Bc5xPf2+ (Fine_WGCG) (page 206. Reshevsky.) wins 1r3r1n/3b1pk1/1R1N2p1/1P3P2/6P1/8/5KB1/R7/w Pf5f6+ (Fine_WGCG) (followed by ...Kh6 2. Kg3! page 209. Reshevsky.) wins xchg at least rnb1k2r/pp3ppp/3b4/q2pN1B1/8/3B4/Pp3PPP/1R1Q1RK1/w Ne5xPf7 (Fine_WGCG) (page 224. Keres.) "tears black's postion apart." Also won R+P+P for N+B then forced mate in the game. r3r1k1/pp1b1pb1/3q3p/3n4/1p1P1RpN/3B4/P2B1PPP/1R1Q2K1/w Rf4xPg4 (Fine_WGCG) (page 226. Keres.) gets an overwhelming attack (resigned in 9) 2r1k2r/2pn1pp1/1p3n1p/p3PP2/4q2B/P1P5/2Q1N1PP/R4RK1/w Pe5xNf6 (Fine_WGCG) (page 230. Lilienthal.) resigns in 6 3r1r2/pp1q2bk/2n1nppp/2p5/3pP1P1/P2P1NNQ/1PPB3P/1R3R1K/w Ng3f5 (Fine_WGCG) (page 244. Smyslov.) resigns in 18 r4r1k/pp2b1pp/n4n2/1bqPN3/1p6/6N1/PBBQ2PP/3R1R1K/w Ng3f5 (Fine_WGCG) (page 279. Kramer.) led to mate and, starting 2 moves later, 12 checks in a row... 2r1r1k1/p2q1pbp/1p4p1/3pPP2/2nP2N1/3Q3R/P5PP/R1B3K1/w Rh3xPh7 (Fine_WGCG) (page 281. Larry Evans. Misprinted: there should be a black B on g7) wins # #(Four other good ones are Evans, diagram p282, and Nadjorf, diagram #p.251, and Nadjorf's 15...P-K4!!! in his "Polish Immortal" game page #248-9, and Adams-Torre 18. Qg4!!! page 285. See file "oldpos.wds".) gnuchess-4.0.pl70/test/CHESSTEST/gelfer.fin100644 21542 13 61367 5527662450 17331 0ustar cracraftuser#326 of the 495 positions in Israel Gelfer: Positional chess handbook, #Macmillan 1991. Only positions in which there is apparently a unique #best move (that is, Gelfer uses a "!" or it is a "study") or in which #there is a clearly bad move (that is, Gelfer uses a "?") are included #which is why only 326 of the 495 appear here. The "?" positions are at the #end, segregated from the "!" ones. In the "?" positions moves listed #without "?" are certainly better than the "?" moves, thinks Gelfer, #although it is perhaps not as clear as in the "!" cases that he thinks #they are clearly the unique best choice. Definitely you should get points #for not playing the "?" move. # 2r3k1/p4pbp/6p1/1NB1p3/p3P3/P4P2/1P4PP/2K4R/w Nb5c3! (bad is Nxa7?) Gelfer.3.495 2r1r1k1/2pq1pbp/Q1pp1np1/8/4P3/2N5/PPP2PPP/R1B2RK1/w Qa6c4! (bad was Qd3? Qe6!) Gelfer.4.495 8/7b/8/8/1N5p/1pp5/7Q/k1K5/w Qh2a2+! Gelfer.5.495 5r1k/p4Ppr/5p1p/2R4Q/7b/8/R5Kn/6n1/w Rc5c8! Gelfer.6.495 1nq3k1/4Q1p1/6P1/3pp2b/2pp3p/8/1P5K/2B5/w Qe7f7+! Gelfer.7.495 4q1kr/p6p/1prQPppB/4n3/8/2P5/PP2B2P/R5K1/w Qd6xNe5! Gelfer.8.495 r3k1r1/ppp2p1p/3p1Bp1/4p1N1/8/8/PP3PbP/2R1K2R/w Rc1xPc7! Gelfer.9.495 r2qr1k1/p1pn1ppp/bp6/3QPp2/2BP4/2P5/P2B1PPP/R3K2R/b Nd7xPe5! Gelfer.12.495 4r1q1/1p1b1k2/p2PpBp1/2P1PpQp/1P5P/2R5/5PPK/8/w Pb4b5! Gelfer.13.495 4n2k/pp3rp1/3p3p/1PpPpNP1/2P1P2P/P7/8/4R1K1/w Pb5b6! Gelfer.14.495 4k3/1pp2npB/p2p1p1p/3P3P/2P2P2/8/PP4P1/2K5/w Kc1d2! Gelfer.15.495 3k4/p2n3p/1p2p1p1/2p1P1P1/2K1BP2/2P5/PP6/8/w Be4f3! Gelfer.16.495 8/ppk4p/2pr1pn1/8/P1B2P2/2P3P1/7P/4R1K1/w Ph2h4! Gelfer.28.495 2nB4/8/p5k1/2p2rp1/2P5/1P4K1/P7/3R4/w Pa2a4! Gelfer.29.495 7r/3k1pp1/pp3n1p/2p1R3/5P2/6P1/PPP3BP/6K1/w Bg2f1! Gelfer.30.495 1r4k1/5p1p/1p3np1/pR6/P1Pr3P/2R2B2/1P4P1/7K/w Pc4c5! Gelfer.32.495 2k5/1p1r2p1/p7/3n1pBp/4r2P/2P2K2/P4PP1/2RR4/w Rd1d3 (planning ...Rc4, 2. Rcd1!) Gelfer.33.495 5k2/5p2/2PP1n2/8/8/6p1/PP1pB3/6K1/b Nf6e4! Gelfer.36.495 8/1Pk5/p1p5/5p1p/b1P3P1/5N2/8/6K1/w Pg4xPh5! Gelfer.37.495 6k1/7b/8/5pK1/5P2/8/6N1/8/w Kg5h6! Gelfer.38.495 5bk1/7p/3p4/2pPp2P/2P1N1P1/8/5K2/8/w Pg4g5! Gelfer.41.495 8/5b2/1k2p1p1/2NpP1P1/1K1P4/8/8/8/w Nc5a4+! Gelfer.42.495 8/2kb4/p1p2pp1/2Pp4/3N1PP1/1P4K1/P7/8/w Pg4g5! Gelfer.46.495 8/1p3p1p/p2kb1p1/2np4/P2N4/2K1PP2/1PB3PP/8/w Pe3e4! Gelfer.50.495 8/8/p2k1p2/1p1p3p/1P1P3p/P3NPP1/5K2/1b6/w Ne3g2! Gelfer.56.495 8/p2b1kpp/2p5/3p4/5N2/5P2/PP4PP/4K3/b Bd7f5! Gelfer.60.495 rq4k1/3b1ppp/4p3/n2pP3/p2N4/1P2QN2/P4PPP/2R3K1/w Ph2h4! Gelfer.63.495 4r3/r4kpp/p7/1p1pRP2/3Pn2B/P5P1/6P1/2R3K1/b Re8xRe5! Gelfer.66.495 5rk1/p2b2pp/2p5/2Pprp2/8/P1N5/1P3PPP/2R2RK1/w Pf2f4! Gelfer.68.495 6k1/4b1p1/8/4p3/8/8/1P1BK1P1/8/w Bd2c3! Gelfer.70.495 8/5b2/p2k4/1p1p1p1p/1P1K1P1P/2P1PB2/8/8/w Bf3e2! Gelfer.72.495 4b1k1/1p3p2/4pPp1/p2pP1P1/P2P4/1P1B4/8/2K5/w Pb3b4! Gelfer.77.495 8/kp1b4/2p1p1p1/P1P1Pp1p/1KB2P2/6PP/P7/8/w Pa5a6! Gelfer.81.495 8/1p1b4/6k1/2Pp3p/3P1p1P/8/6PK/5B2/w Pg2g3! Gelfer.83.495 8/2k4p/p1p1bp2/8/1P2PP2/4K3/7P/5B2/w Ke3d4! Gelfer.84.495 2b1k3/2q3b1/3p2p1/p1pPp1Bp/PpP1P2Q/1P5P/6P1/3B2K1/w Pg2g4! Gelfer.85.495 2rb4/1p1k2p1/p2p1p1p/P2PpP2/1P1pP1PP/3P4/1R1B4/3K4/w Pb4b5! Gelfer.86.495 8/pbR1r1kp/6p1/1p6/4PB2/P2P4/6PP/6K1/b Re7xRc7! Gelfer.92.495 8/8/4b1p1/2Bp3p/5P1P/1pK1Pk2/8/8/b Pg6g5! Gelfer.93.495 4r3/6k1/1p1p2p1/p2P1p2/P1Pb3p/1P3R1P/4B1P1/5K2/b Bd4e3! Gelfer.95.495 3rqr1k/ppp1b1pp/8/3B4/1P1pP1P1/P5P1/4QPK1/3R1R2/w Bd5c4! Gelfer.102.495 3bqr1k/6p1/4p2p/p2p4/1p4Q1/1PrBP2P/P2R1PP1/3R2K1/w Pe3e4! Gelfer.104.495 1r6/4b1k1/3q2pp/p2Bpp2/1pQ5/1P2P1P1/P4PKP/2R5/w Pe3e4! Gelfer.105.495 3r4/p1r1qpkp/1p2p1p1/1B4b1/3P4/P3P3/1P2Q1PP/R2R2K1/b Pe6e5! Gelfer.106.495 8/8/8/1N1k4/1p6/8/7K/8/w Nb5c7+! Gelfer.107.495 K7/8/8/5pp1/2k2N2/8/8/8/w Nf4e6! Gelfer.108.495 k7/8/4p3/6p1/p7/8/Pp4N1/3K4/w Kd1c2! Gelfer.109.495 4K1nk/7p/8/7P/8/4N3/8/8/w Ke8f7! Gelfer.110.495 8/5pkp/1n4p1/1P6/3K2P1/2N4P/8/8/w Nc3d5! Gelfer.112.495 2n3k1/pp3ppp/3p4/3P4/3N4/8/PP3PPP/2K5/w Nd4b3! Gelfer.116.495 8/p1pk1p1p/1p2n1p1/8/P7/1P4P1/2P2PKP/3N4/b Ne6d4! Gelfer.119.495 6k1/p5p1/2n2p1p/3p1N2/Pp1P2PP/1P6/5P2/6K1/b Pg7g6! Gelfer.120.495 8/4p2p/p3kp2/4n1p1/8/1P3P2/P3K1PP/2N5/b Ke6d5! Gelfer.123.495 6k1/2n2pp1/pp2p2p/8/4P3/P2P2PP/2N2P2/6K1/w Pd3d4! Gelfer.124.495 8/5kp1/p2r4/8/4P3/3PK3/8/R7/w Ra1a5! Gelfer.127.495 8/5kpp/p4p2/1p6/2rP1P2/P3K1P1/1R5P/8/b Kf7e6! Gelfer.129.495 3rk3/5p2/p2p1P2/2pP3p/2P5/5K1P/P7/5R2/w Rf1b1! Gelfer.131.495 8/pp2r1k1/2p1p3/3pP2p/1P1P1P1P/P5KR/8/8/w Pf4f5! Gelfer.133.495 3r4/7p/Rp4k1/5p2/4p3/2P5/PP3P1P/5K2/b Rd8d2! Gelfer.134.495 8/R5pp/2p1k3/2p2p2/2P5/1P2P1P1/P3r2P/6K1/b Pg7g5! Gelfer.135.495 8/5p1k/r5pp/P7/3R3P/6P1/5PK1/8/w Rd4a4! Gelfer.136.495 8/8/1R2pkpp/P7/5p1P/4r3/1P3K2/8/b Re3e5! Gelfer.141.495 8/r5k1/2p3p1/P1P2pP1/1K6/5R2/8/8/w Rf3a3! Gelfer.147.495 5r2/p2k3p/1pR3p1/1P1p1p2/3P1PP1/3KPP2/8/8/w Kd3e2! Gelfer.149.495 6k1/8/6rp/P1B2p2/4b3/2b4P/5K2/4RB2/w Re1xBe4! Gelfer.153.495 7k/2n5/p2p3p/2pP1P1B/2P5/4B3/1b3P2/6K1/w Be3d2! Gelfer.154.495 8/1p1nkpbp/p2p1np1/2pP4/P1P2B2/2N4P/1P3PP1/3B2K1/w Pa4a5! Gelfer.161.495 2kr2nr/ppp2ppp/n7/1N6/3N4/8/PPP1KPPP/R3R3/w Nb5xPa7+! Gelfer.163.495 b1r5/p1r2pkp/2n1p1p1/2P5/4B3/2R2N2/P4PPP/2R3K1/b Nc6b4! Gelfer.164.495 2r2rk1/1p1qbppp/p1n1p3/3pP3/3P3P/5N2/PPRBQPP1/2R3K1/b Be7xPh4! Gelfer.165.495 r1r5/p2k2bp/1p2ppp1/3n4/8/P2P2P1/1B1NPPKP/2R2R2/b Bg7h6! Gelfer.166.495 R4rk1/5ppp/5q2/1p1Qp3/8/1B6/1PP2bPP/5K2/w Qd5xPf7+! Gelfer.167.495 rn5k/1p2q1p1/pB1pp2p/4p3/4P1Q1/2P3P1/PP3P1P/3R2K1/w Qg4h4! Gelfer.168.495 2b2k2/5ppp/p3p3/1nN5/4P3/5P2/1P2BKPP/8/w Be2xNb5! Gelfer.169.495 2r2rk1/p1q3pp/bp1bp3/4P3/Q1P5/6B1/P4PPP/2R1R1K1/b Bd6a3! Gelfer.170.495 8/5b1k/1p2p2p/2qpPp2/p2N1P2/P2PK3/1P5P/3Q4/w Qd1c2! Gelfer.171.495 2r5/p1r2b2/1p1p1k1p/PP2ppp1/2P2P2/3KP1P1/2RN3P/2R5/b Pd6d5! Gelfer.173.495 8/1B3kpp/4b3/p1Nn1p2/1p3P2/1P4P1/P3P2P/6K1/w Bb7xNd5! Gelfer.174.495 3r4/3r1k1p/1pppq3/p4p2/2PRnPpN/1P2P1P1/P1Q4P/3R2K1/b Pd6d5! Gelfer.176.495 3r2k1/p4pp1/1p2n2p/3p4/3P1q1P/1P1Q1NP1/P4PK1/2R5/w Pg3xQf4! Gelfer.189.495 r1r3k1/1b3ppp/p3p3/1pb5/5P2/5N2/PP2PPBP/2RR2K1/w Nf3e5! Gelfer.191.495 5rk1/2p1q1p1/r1n1p2p/p2p1p2/P2P1P2/Q1P3P1/4P1BP/R4RK1/w Qa3c5! Gelfer.192.495 r1b2rk1/ppp2pb1/3p3p/2nPp1q1/2P1P1BN/2N3P1/PP4P1/R2QK2R/w Bg4xBc8! Gelfer.195.495 rnr3k1/pp2qnb1/3p1p2/2pPp1p1/2P1P2B/2N4P/PP3P2/R2QKN1R/w Nf1e3! Gelfer.196.495 r1rq2k1/p2n4/b2b1pp1/PppPp2p/4P3/1P2N3/1B1QBPPP/R3R1K1/w Be2xPh5! Gelfer.197.495 r4rk1/1p1nbppp/p2p1n2/4pPB1/4P3/1NNP4/PP4PP/R4RK1/w Bg5xNf6! Gelfer.198.495 r4rk1/ppq1bppp/3pbn2/4p3/4PP2/2N1B3/PPP1B1PP/R3QRK1/w Pf4f5! Gelfer.200.495 r2r2k1/pp3pbp/3pbnp1/1N2p3/q3P3/P3BP2/1PPQ2PP/1K1R1B1R/w Pc2c4! Gelfer.201.495 2r1k2r/2q1bpp1/pn1p1n2/4pP2/R3P2p/1NN1B2P/1PP2RP1/3Q2K1/w Be3xNb6! Gelfer.202.495 2kr3r/1bq1bppp/p2p4/2n1pPP1/1p2P2P/1N3QN1/PPP5/2KR1B1R/w Bf1c4! Gelfer.203.495 1r1r2k1/1pqn1ppp/p2p4/P2P4/2P5/3B3P/1P1Q2P1/2RR3K/w Pc4c5! Gelfer.205.495 2rr2k1/1b3pp1/p2p1b1p/1p2pP2/4P3/P1N5/1PP1BRPP/3R3K/b Pd6d5! Gelfer.206.495 r4rk1/p1pnbppp/4p3/qp6/3PN1PP/P3Q3/1PP2P2/2KR1B1R/w Pb2b4! Gelfer.210.495 2q2rk1/p1rn1ppp/1p2pn2/8/Q2P4/2P2N2/P2B1PPP/2RR2K1/b Rc7c4! Gelfer.216.495 r3r1k1/pp3pp1/2np1q1p/2p1p3/2PPQ3/2P1PB2/P4PPP/R3R1K1/w Pd4xPc5! Gelfer.221.495 rnb1k2r/pp3ppp/3p4/q1p1p3/2PP4/P1P1P3/2QN1PPP/R3KB1R/w Pd4xPe5! Gelfer.222.495 3r2k1/pp4bp/2n1pnp1/2p5/8/2N1PN2/PP2KPPP/R1B5/w Nf3g5! Gelfer.223.495 4r1k1/pp1rq1pp/2p1p3/4Ppb1/P1PP4/1PNR1QP1/6KP/3R4/w Pc4c5! Gelfer.225.495 r2q1rk1/1np1bppp/p2p4/4p3/Pp2P3/3P1N2/1PP2PPP/R1BQR1K1/w Pc2c3! Gelfer.234.495 r1bq1rk1/3n1ppp/p2b1n2/1ppPp3/P3P3/1PNB1N2/5PPP/R1BQ1RK1/b Pc5c4! Gelfer.235.495 r4r2/3nq1kp/3p1bp1/2pPpp2/p1P5/2B2P2/PPB1Q1PP/3R1RK1/b Pe5e4! Gelfer.236.495 2rq1rk1/pb3ppp/1p2p3/n7/3PP3/3B1N2/P2Q1PPP/3RR1K1/w Pd4d5! Gelfer.237.495 r3r2k/pb1q1pp1/1p1P3p/4P3/2p5/2Q2N2/P4PPP/3RR1K1/w Pe5e6! Gelfer.238.495 2nrbrk1/1pq1bppp/n7/p1pP4/2N5/PPN3P1/1B2QPBP/3R1RK1/w Pd5d6! Gelfer.239.495 q4rk1/pb2bppp/1p2pn2/8/3PP3/3BQN2/PB3PPP/2R3K1/w Pd4d5! Gelfer.243.495 1rb1r1k1/2qn1pbp/3p2p1/1pnP4/2p1PP2/2N1B1NP/1PB2QP1/R4RK1/w Pe4e5! Gelfer.244.495 2r1nrk1/pbqn1p1p/1p6/2p1pP2/2Pp3P/1P1Pb1P1/PB2Q1BK/RN2NR2/b Pe5e4! Gelfer.245.495 snb1k2s/pp1n2bp/2p2pp1/8/2P1PB2/2N2N2/PP2B1PP/3R1RK1/w Pe4e5! (contrary to appearances, black cannot castle here, hence the "s"s representing rooks which cant castle) Gelfer.247.495 r3k2r/ppq1n1pp/2nbbp2/2p5/2PpPP1N/3P4/PP1N2BP/R2Q1RK1/w Pe4e5! Gelfer.248.495 2q3rk/3n3r/1pBp1n1p/pPpPpPpP/P3P3/2PKQ3/1R1N4/7R/b Pc5c4+! Gelfer.250.495 3n1nk1/2Qb1p2/3p1qp1/2pPp2p/1pP1P3/1P3P2/2BN2P1/5NK1/w Pf3f4! Gelfer.251.495 5nk1/2p3q1/1p1p1p2/3P1P1Q/2P1P1p1/5p2/PPB2P2/5K2/w Pe4e5! Gelfer.252.495 r1br1bk1/2p2p1p/p1Bpn1p1/N6n/2P1P2q/5P1P/P3N1P1/1RBQR1K1/b Pd6d5! Gelfer.253.495 r2q1bk1/p1p2r1n/2Ppbnpp/1P2p3/1N2Pp2/2N2P2/P3B1PP/R1BQ1RK1/b Pd6d5! Gelfer.254.495 2r2qk1/r2n2p1/p3p2p/2pp4/8/Q3P3/PP2BPPP/2R2RK1/w Pe3e4! Gelfer.255.495 2r3k1/4bppp/1q1p4/1p1P4/nP1pP3/3B1Q1P/5PP1/R4NK1/w Pe4e5! Gelfer.256.495 r2bk2r/pp3p2/2p1n1p1/3pP3/1P4PN/2P3B1/P4PK1/R6R/w Nh4f5! Gelfer.257.495 1r2rqk1/pbnn2bp/3p1pp1/2pP4/Np2PP2/5NPP/PP3B2/2RQRBK1/w Nf3d4! Gelfer.258.495 2rq2k1/1b1r1ppp/1pp1p1n1/p2pP1P1/PnPP1P2/1PN1N1P1/3Q2B1/2RR2K1/w Pf4f5! Gelfer.259.495 r4rk1/3nb1pp/p1b1p3/q2pP3/2pP2P1/2N1BN2/PPQ2R1P/2R4K/b Nd7c5! Gelfer.260.495 6r1/3bbk2/4p2p/1p1pPp2/2pP1Pr1/P4K2/1P4NP/1R2B1R1/b Pb5b4! Gelfer.261.495 2rqn1k1/p2prppp/1p2p3/8/1PP5/P2Q1BP1/4PP1P/2RR2K1/w Bf3b7! Gelfer.262.495 1rr3k1/1q1bbp1p/4p1p1/1Pp1P3/p1B2P2/8/P1RBQ1PP/1R5K/b Bd7c6! Gelfer.263.495 r7/1p1qr1kp/p4pp1/2QP4/P3N3/7P/1b3PP1/R3R1K1/w Ne4g5! Gelfer.264.495 8/2k2p2/1p6/2p1nB1p/3pP3/P2P4/2P4r/3K2R1/b Pc5c4! Gelfer.266.495 rnbqnrk1/ppp2pbp/3p2p1/3Pp3/2P1P3/2N1BP2/PP2N1PP/R2QKB1R/b Bg7h6! Gelfer.270.495 2kr3r/ppbqn1pp/2n1bp2/2p1pP2/P1NpP2N/3P2P1/1PPB2BP/R2Q1RK1/b Be6xNc4! Gelfer.272.495 r1b2rk1/1p3pp1/pn3n1p/2q1p3/P3P3/2N2N2/BP1RQPPP/3R2K1/w Qe2e3! Gelfer.273.495 8/3k4/1qp1p2p/p2pPppb/P3n3/BP2P1PP/2Q2PBK/8/w Bg2xNe4! Gelfer.274.495 6k1/2q2p1p/p2b2pP/1p1B4/1p2P3/1P3QP1/P4PK1/8/w Pe4e5! Gelfer.275.495 r1b1k2r/pp3ppp/2p5/2npP3/1b3P2/2N1P1Pq/PPB2K1P/R1BQ3R/b Bb4xNc3! Gelfer.276.495 r2qk2r/pppb1ppp/8/n2p4/3P1B2/P1P5/2Q1PPPP/R3KB1R/b Bd7b5! Gelfer.278.495 r1q2rk1/3nbp1p/2p3p1/p3p3/Pn2P3/2N1BB1P/1PP2RP1/R4QK1/w Bf3g4! Gelfer.279.495 r4rk1/4bppp/p3bn2/3p4/N7/3BB3/PP3PPP/R3R1K1/w Be3c5! Gelfer.280.495 r4k2/r2b1ppp/p4n2/2NpR3/1P6/3B1P2/P5PP/R5K1/w Nc5xBd7+! Gelfer.281.495 r1r3k1/4b1pp/pp2pp2/3p4/1NnP3P/2P3P1/P3PP2/1R2BRK1/b Be7xNb4! Gelfer.282.495 r4rk1/pp2pp1p/2n1b1p1/2p5/7N/1PP3P1/P3PPBP/R2R2K1/w Bg2xNc6! Gelfer.283.495 1rb1qrk1/p1p1bppp/8/2p1PP2/n4BP1/2N5/PP3Q1P/2KR1B1R/w Bf1b5! Gelfer.285.495 r3rqk1/1p1b1pb1/p2p1npp/P1pP4/2P5/2NB3P/1PQBRPP1/4R1K1/w Re2xRe8 Gelfer.286A.495 4rqk1/1p1b1pb1/p2p1npp/P1pP4/2P5/2NB3P/1PQB1PP1/4R1K1/w Re1b1! Gelfer.286B.495 (same as 286A only after 1 rook exch) 1r3r2/p2q2k1/3p1p1p/2p1pPp1/2PnP1PP/8/PP1QN1K1/1R5R/w Ne2c3! Gelfer.287.495 1qr3k1/pbrnppbp/1p3np1/PP1p4/3P4/1QN1PN2/1B2BPPP/R4RK1/w Pa5a6! Gelfer.291.495 1rb5/2pp1qpk/2p3pp/p1N1P3/P1PQ1P2/1P1R3P/6PK/8/w Pe5e6! Gelfer.292.495 1rbqnnkr/6b1/1p1p1ppp/pPpPp3/2P1P1PP/P1NBBPN1/2KQ4/6RR/w Pg4g5! Gelfer.293.495 r3nr1k/pp1bq1bn/3p1p1p/PPpPp1p1/2P1P3/3BN1NP/3B1PP1/R2QR1K1/w Pb5b6! Gelfer.294.495 r3b1r1/4pkb1/1p1q1p1p/p1pPpPpP/P1P1P1P1/1P1BB3/5Q2/R5RK/w Pb3b4! Gelfer.295.495 1rbqk2r/5p1p/p1ppp1p1/4b3/4P3/2N3Q1/PPP2PPP/R1BR2K1/w Qg3xBe5! Gelfer.297.495 2br4/r2pknpp/p1pRpp2/8/N1P1PP2/6P1/PP2B2P/2KR4/w Pc4c5! Gelfer.298.495 1r2qr1k/2nbnpb1/p2p2pp/PppPp3/2P1P1PB/1P2N2P/2QNBP2/R3K2R/w Pb3b4! Gelfer.299.495 5bk1/4pp2/B5p1/2r1P2p/P3PP1P/6P1/1R3K2/8/w Pe5e6! Gelfer.300.495 3r4/4bk1p/1p3pp1/p1p1pP2/3pK1PP/BP1P4/P2P4/2R5/b Ph7h5! Gelfer.303.495 r4rk1/ppp1p1bp/1nnq2p1/2Q1Pp2/3P4/4BP1P/PP2NP2/2KR1B1R/b Qd6d5! Gelfer.304.495 after e5 r1rq1bk1/1n1b1p1p/3p1np1/1p1Pp3/1Pp1P3/2P1BNNP/R2Q1PP1/1B2R1K1/w Be3a7! Gelfer.305.495 4n3/1b3k1p/p2p2p1/3Pp3/2P3P1/6PP/2BB4/6K1/w Pg4g5! Gelfer.308.495 r1bq1rk1/ppp1bppn/3p3p/4pP2/2BnP1PP/2NP1N2/PPP5/R1BQK2R/w Pg4g5! (h5? would be wrong) Gelfer.309.495 1n6/4k2p/p3ppp1/1pPp4/3P1PP1/3NP3/P3K2P/8/w Pf4f5! Gelfer.311.495 r4rk1/pb2qppp/1p1p1b2/3Pp3/2PpP3/1P3NP1/P1Q2PBP/R2R2K1/w Bg2h3! Gelfer.317.495 r2qk2r/pb1p1pb1/1p4p1/3np2p/2PpP2P/P2P2P1/1P3PB1/1RBQK2R/w Pe4xNd5! Gelfer.318.495 5b2/ppk2pp1/4p2p/2p1P2P/q1P1Q3/P3B1P1/1P3P2/2K5/w Qe4f4! Gelfer.320.495 3bn3/pk3pp1/1pq1p2p/7P/2P3P1/1PB5/P1K1QP2/4N3/w Qe2f3! Gelfer.322.495 1k6/p1q1npp1/1p2p2p/2p1P2P/2P2P2/3QB1P1/PP6/2K5/b Pg7g6! Gelfer.323.495 1k2r3/1ppr2pp/p1p2p2/5R2/4P3/1P1P3P/P1P3P1/5RK1/w Pg2g4! Gelfer.327.495 8/3b4/5k2/2pPnp2/1pP4N/pP1B2P1/P3K3/8/b Pf5f4! Gelfer.330.495 r4rk1/1pq1bppp/p5b1/P1pPp3/2P5/4B3/1P2BPPP/2RQ1RK1/w Pb2b4! Gelfer.333.495 2r2rk1/pb1n1ppp/1ppqp3/8/2PPQ3/1P3NP1/P4PBP/R2R2K1/w Pc4c5! Gelfer.336.495 r4rk1/1q1n1pp1/4b2p/p1pp4/8/Q2NP3/PP2BPPP/R4RK1/b Pc5c4! Gelfer.338.495 2kr3r/pbqnbp2/1p2p3/2ppP2p/PP3B1p/2PBPN2/5PP1/R2Q1RK1/b Pc5c4! Gelfer.339.495 2b3k1/p3rp1p/2p5/3p1p1n/N6P/P2B4/1PP3P1/2KR4/w Kc1d2! Gelfer.342.495 2r5/p4p2/1bk5/4RpBp/7P/P7/1P6/1K6/b Pf7f6! Gelfer.344.495 6k1/2p3np/1p1p2p1/3P4/1PPK1R2/6PB/7P/4r3/w Bh3e6+! Gelfer.345.495 8/p3kr2/1p5R/2p2p2/2P2P2/P2P4/4K3/8/w Pd3d4! Gelfer.346.495 r2qrnk1/pp3bpp/1bp2p2/1P1p4/3P1P2/3BNNP1/P1Q2P1P/R4RK1/b Bf7h5! Gelfer.351.495 r4rk1/pp3ppp/2pnpn2/2Pp1b2/3P4/1N1BPNP1/PP3PP1/2R2RK1/w Bd3a6! Gelfer.352.495 2rr2k1/1bq1bpp1/pp1ppnn1/7p/P1P1PP2/1PN2NPP/1B2Q1B1/R2R2K1/b Pd6d5! Gelfer.353.495 r1b2rk1/2qnppbp/3p2p1/2pPP3/p1N2P1P/2B3P1/PP6/R2QRBK1/b Nd7b6! Gelfer.354.495 1r2k2r/1pbn2p1/p1p1p3/2P2pq1/Q2Pp3/P3P1P1/1P1BB2P/2KR3R/w Be2xPa6! Gelfer.355.495 4r1k1/q1r2ppp/p2R2n1/1p2p3/4Q3/1P2P1B1/P4PPP/3R2K1/w Ph2h4! Gelfer.356.495 8/4k2p/3n1p2/3p1p2/2p5/r3PPP1/P1R1BK1P/8/b Pf5f4! Gelfer.357.495 2r3k1/5p1p/4b1p1/2q5/4PPP1/p6P/P2RQ1BK/8/b Pg6g5! Gelfer.358.495 5R2/ppk5/2p1p1rp/6n1/1BPP2P1/P7/1P6/2K5/w Bb4a5+! Gelfer.359.495 1n3rk1/8/pp3p2/3p2pp/3P4/2R5/PP3PPP/4NK2/w Ph2h4! Gelfer.360.495 7k/8/5r2/8/3R4/8/8/K1B5/w Bc1b2! Gelfer.362.495 6rk/1b4rp/2q2n2/p1n5/4p2Q/1PN2N2/1BP1R3/K3R3/w Nc3xPe4! Gelfer.363.495 1q6/2b2p1p/7k/8/1p1Q4/8/1K3B2/8/w Qd4f6+! Gelfer.364.495 6k1/pp1q3p/2p3p1/5b2/4p3/2B1P1P1/PP4PP/3Q2K1/w Qd1e1! Gelfer.366.495 5rk1/1q2b1pp/pp1pp3/2p2p2/2PP4/1P1QPbP1/PB1R1P1P/4R1K1/b Qb7c8! Gelfer.367.495 after Re1 3r1r1k/1b4p1/pb5p/2ppPp1q/2p1nP2/2P1BN1N/PPQ3PP/3R1R1K/b Pd5d4! Gelfer.368.495 r1r3k1/1b2bppp/p3p3/1p1q4/P2Pn3/2PB1N2/1B2QPPP/2R2RK1/b Ne4g5! Gelfer.369.495 r2r4/1p3pkp/2p1q3/p2nP3/4p1PQ/2B1P3/bP2B2P/3R1RK1/w Rd1xNd5! Gelfer.371.495 r1bq1rk1/1p2bppp/p3p3/n3P3/4N3/1P1P1N2/PB4PP/R3QR1K/w Ne4f6+! Gelfer.372.495 3q1rk1/4bppp/1np1pn2/3p4/5P2/1N1P2P1/1BP1QPBP/R5K1/w Pf4f5! Gelfer.373.495 5rk1/1pq1ppbp/2rp2p1/pQ6/P1P1P2P/1P2BP2/6P1/2KR3R/b Rc6c5! Gelfer.374.495 3q1rk1/1bppbppp/p4n2/Q3N2r/6P1/P1N2P2/1PP4P/R1B1R1K1/b Nf6xPg4! Gelfer.376.495 2r3k1/pbr1q2p/1p2p1p1/5P2/3Pp3/1P2R3/PB1Q2PP/5RK1/w Pf5xPg6! Gelfer.377.495 r4r2/p2pq1kp/1pn2p2/2p5/2b1PP2/4Q1P1/PB4BP/R2R2K1/w Pe4e5! Gelfer.378.495 r4rk1/1b1n1pb1/3p2p1/1p1Pq1Bp/2p1P3/2P2RNP/1PBQ2P1/5R1K/w Ng3xPh5! Gelfer.379.495 1r1q1rk1/1ppb4/6np/1P1P1pb1/2P1p1p1/1Q2P1P1/1B1N1RBP/5RK1/w Nd2xPe4! Gelfer.380.495 rn4k1/p1q3bp/2b1r1p1/3ppp2/2N1n3/1P3NP1/PB2PPBP/2RQ1RK1/w Nc4xPe5! Gelfer.381.495 r1bq1rk1/pp4bp/3p2p1/n1pP1P2/2P1p1n1/1PN3P1/P2N1PBP/R1BQ1RK1/w Pf5f6! Gelfer.382.495 2r1r1k1/5pbp/p5p1/3Pn3/3QP3/N1B5/PP4qP/1K1R3R/b Rc8xBc3! Gelfer.383.495 2rq1rk1/1p1bppbp/p2p2p1/2n2P2/2P1P3/1PN3P1/PB1Q2BP/R4RK1/w Pf5f6! Gelfer.384.495 r2q1rk1/pp5p/2n1bnp1/2pNpp2/1bP5/1P1BP1N1/PB3PPP/R2Q1RK1/w Pf2f4! Gelfer.385.495 r2r2k1/pbq2pbp/1p2p1p1/n1p5/3PPP2/2PBB2P/P3NQP1/2R2RK1/b Pf7f5! Gelfer.386.495 1r3rk1/p1q2pbp/1p2n1p1/1Pp1p3/2P5/6P1/1PP2PBP/R1BQR1K1/w Pc2c3! Gelfer.387.495 2q2rk1/r4pb1/ppppb1p1/4pn1p/PPP5/2NP2PP/3BPPB1/1R1QK2R/w Pb4b5! Gelfer.388.495 5r1k/1b1q3p/1p2ppp1/p2n1n2/3P3P/P5NQ/1Pr2PP1/1BBRR1K1/b Rc2xBc1! Gelfer.389.495 6k1/1br3p1/4p2p/2b3q1/8/1Q4P1/P1R2P1P/2R3K1/b Bc5xPf2+! Gelfer.390.495 4r3/4b2k/5R2/3p1P1q/pP2p1pP/P5P1/1B2Q2K/8/w Qe2a6! Gelfer.391.495 rn3rk1/ppp5/3b3p/6pq/2P1R1b1/5NP1/PP1B1PBP/R2Q2K1/w Bd2c3! Gelfer.392.495 2r3k1/r1q1bp1p/ppbppnp1/8/2P1PP2/1PN5/PBB1Q1PP/3R1RK1/w Pf4f5! Gelfer.394.495 1q1r1rk1/1b2bp1p/ppnppnp1/8/2PNPP2/1PN2R2/PBB3PP/2RQ3K/w Nc3d5! Gelfer.395.495 4r1k1/pp1r1p1p/5bp1/3B1q2/8/1Q4P1/PP1R1P1P/R5K1/b Bf6g5! Gelfer.396.495 r4rk1/1bqnbppp/p2p1n2/1p2pP2/4P1P1/PNN2B2/1PP1Q2P/R1B2RK1/b Pd6d5! Gelfer.397.495 1r3rk1/1bq1bppp/ppnppn2/8/P3PPP1/1NN2B2/1PPQ3P/R1B2R1K/b Pd6d5! Gelfer.398.495 r2q4/pp3rk1/5pp1/3b4/3P3P/3Q2B1/PP3P2/R1R3K1/w Ph4h5! Gelfer.399.495 2q5/2pp4/3pr3/4pb2/K1p2pn1/2bn1kp1/3pr1R1/6BB/w Rg2f2+! Gelfer.400.495 r4rk1/1b2bppp/ppq1p3/2ppB2n/5P2/1P1BP3/P1PPQ1PP/R4RK1/w Bd3xPh7+! Gelfer.401.495 3qr1k1/1br2ppp/p2b4/8/PpNp4/3P4/1PP2PPP/R1BQ1RK1/b Bd6xPh2+! Gelfer.402.495 3r1rk1/bpq2ppp/p1b1p3/2P5/1P2B3/P4Q2/1B3PPP/2R2RK1/w Be4xPh7+! Gelfer.403.495 3r1rk1/p3qp1p/2bb2p1/2pp4/8/1P2P3/PBQN1PPP/2R2RK1/b Pd5d4! Gelfer.404.495 r1b2rk1/2qpbppp/p1p1p3/2Pn4/N2B1P2/3B4/PP4PP/R2Q1RK1/w Na4b6! Gelfer.405.495 r2qkb1r/n1pp1pp1/4p1bp/1p6/1P1P3P/P3P1P1/1B1N1P2/R2QKB1R/w Pd4d5! Gelfer.406.495 r1bq1rk1/2p2pb1/2Pp1np1/1N5p/1P6/1Q4PP/1B3PB1/3RR1K1/w Nb5xPd6! Gelfer.408.495 1r1b2k1/rp1R1p1p/5np1/p1pPp3/P1P1P3/R4PPB/1P1B3P/6K1/w Rd7xBd8+! Gelfer.409.495 r6r/1ppkBpp1/5np1/p2PR3/2P5/3R4/P1P2P1P/2K5/w Pd5d6! Gelfer.410.495 2rr2k1/1b3ppp/pb2p3/1p2P3/1P2BPnq/P1N3P1/1B2Q2P/R4R1K/b Rc8xNc3! Gelfer.411.495 r1b2rk1/ppp2p2/6p1/4P2p/1n4qP/3BQ3/PBP5/2KR3R/w Pe5e6! Gelfer.412.495 4rnk1/2qn2p1/p3b2p/1pp1N3/2P5/4P1Q1/PB4PP/1B3RK1/w Qg3xPg7+! Gelfer.413.495 2rq1rk1/pb3ppp/1p2p3/n7/1b1PP3/3B1N2/PB2QPPP/3R1RK1/w Pd4d5! Gelfer.414.495 4r1k1/p1p2ppp/b2b4/3p1q2/8/P3B1P1/1PP2P1P/RN1Q2K1/b Re8xBe3! Gelfer.415.495 6rk/8/pq1p3b/1p1bp2P/1P6/2P3NP/2R2Q1K/4R3/b Rg8xNg3! Gelfer.416.495 r2qr1k1/p4pbp/bp4p1/3p4/8/BPN1n1P1/P2QN1BP/R2R2K1/b Ne3xBg2! Gelfer.417.495 4rb1r/Pkppq1pp/b1p5/4P3/4QB2/1N6/PP4PP/R3K2R/b Qe7h4+! Gelfer.418.495 1r4k1/5p2/p5pp/2pP1b2/3b4/q1N2P2/PPR3PP/K3Q2R/b Rb8xPb2! Gelfer.419.495 r4rk1/ppp3bp/3p4/3Ppb2/2P4q/3B1P2/PP3n1P/R2Q1RK1/b Pe5e4! Gelfer.420.495 r2qr2k/pbp3pp/1p2Bb2/2p5/2Pp1P2/6P1/PP2Q1NP/3R1RK1/b Pd4d3! Gelfer.422.495 5q1k/ppp2Nbp/2np2p1/3B1b2/2PP4/4r1P1/PP1Q3P/R5K1/b Qf8xNf7! Gelfer.423.495 1r3rk1/pbpn2qp/1p1p1np1/3P1p2/1P5N/5PPB/PB5P/2QR1RK1/w Bh3xPf5! Gelfer.424.495 r3rnk1/ppp1q2p/3p2p1/3P1p1n/2P1p3/P1B1P1P1/1PQ2PBP/3R1RK1/w Pf2f3! Gelfer.425.495 3rr1k1/pb1nqppp/3b1n2/2pp4/8/1PQBPN2/PB1N1PPP/2RR2K1/b Pd5d4! Gelfer.427.495 1rb1r1k1/p1p1qppp/2pb4/8/2P3n1/4P1P1/PB2BP1P/R1QN1RK1/b Ng4xPh2! Gelfer.428.495 2r2rk1/pbq1bppp/1p2p3/n7/2PP4/P2B1N2/1B2QPPP/3R1RK1/w Pd4d5! Gelfer.429.495 6k1/p1nb3p/3p2qn/2pP1p2/P4P2/3B2N1/2Q3PP/4B2K/b Nc7xPd5! Gelfer.430.495 r2q1rk1/pb2bppp/1p2pn2/3pP3/5P2/P1NPBN2/1P4PP/R2Q1R1K/b Pd5d4! Gelfer.431.495 3rrnk1/ppq2pb1/2p1p3/5p1p/2PP3P/1PB2NP1/PQ2RP2/4R1K1/w Pd4d5! Gelfer.432.495 r3k2r/p1qnbpp1/1pb1p2p/2p5/3PP3/P1PB1N2/2Q2PPP/R1BR2K1/w Pd4d5! Gelfer.433.495 1rb1r1k1/3n1ppp/p1p1p3/q3P3/7P/2N1Q1R1/PPP3P1/2KR1B2/w Rd1xNd7! Gelfer.434.495 r1rb1nk1/1q1b1pp1/3p3p/n2Pp2N/1p2P3/1P1BBQ1P/R2N1PP1/R5K1/w Ra2xNa5! Gelfer.435.495 2r2rk1/1pq1bppp/p2pbn2/8/P3PR2/2NQB3/1PP1B1PP/5RK1/w Rf4xNf6! Gelfer.436.495 2r3k1/2q2pp1/Bp2p1n1/3p1n2/PQ1P3p/2PN2P1/5PKP/4R3/b Qc7xPc3! Gelfer.437.495 r3k2r/pb3ppp/1q1ppb2/8/np1NPPP1/2P2Q2/PPB1N2P/2KRR3/b Na4xPb2! Gelfer.438.495 r2q1rk1/pp4pp/5p2/4pb2/1PPp3Q/P1n1PP2/3R2PP/4KBNR/b Pd4xPe3! Gelfer.439.495 rq2k2r/1p1bppbp/3p2p1/pNnP4/4P3/4BP2/PP1Q2PP/2R1KB1R/w Rc1xNc5! Gelfer.441.495 r2qk2r/pp1nbp1p/2p1b1p1/3pP3/1n1P1B2/PQN2P2/1P4PP/2KR1BNR/b Pa7a5! Gelfer.442.495 r3kb1r/pp1bpppp/1qp2n2/8/3P4/2NQ4/PP1BPPPP/R3KB1R/b Pe7e5! Gelfer.443.495 rnbr2k1/ppq1ppbp/6p1/2PN4/8/4P3/PP1Q1PPP/2R1KBNR/b Rd8xNd5! Gelfer.444.495 r1b2rk1/pp2bppp/2n1pn2/q2p4/2P2B2/P1N1PN2/1PQR1PPP/4KB1R/b Nf6e4! Gelfer.445.495 rnbqk2r/ppp2ppp/5n2/3P4/1b2pP2/2NP4/PPPB2PP/R2QKBNR/b Pe4e3! Gelfer.446.495 r3kb1r/3qpppp/p1p5/3pP3/Q3b3/5N2/PPP2PPP/R1B2RK1/w Pe5e6! Gelfer.447.495 r2qkb1r/1b3ppp/p3pn2/1p6/1n1P4/1BN2N2/PP2QPPP/R1BR2K1/w Pd4d5! Gelfer.448.495 3r2k1/pr3p2/3p4/2p1ppq1/2Pn4/1PNQ2P1/P4RKP/5R2/w Rf2xPf5! Gelfer.449.495 r1q1r1k1/p2p1ppp/1pn5/2pR4/Q1P5/2P1N1P1/P3PP1P/R5K1/b Re8xNe3! Gelfer.451.495 r3kr2/pp2bpp1/2b4p/q3p3/2B1p1PP/1Q2B3/PPP2P2/2KR2R1/w Rd1d5! Gelfer.452.495 r4b1r/pp1q1kp1/2p1p1p1/5nPp/2BP3P/2P2R2/PPQ2P2/R1B1K3/w Rf3xNf5+! Gelfer.453.495 r3r1k1/q4p1p/p2p2p1/2nP4/2R1PP2/1p1B3P/1P1Q2PK/2R5/w Rc4xNc5! Gelfer.455.495 2r5/1p1k1p2/p2p2p1/P1PPnp1p/1P1K1N1P/5P2/4R1P1/8/w Re2xNe5! Gelfer.456.495 8/3r3p/1p4p1/p1k2p2/P1PNp3/1P1nP3/4K1PP/R7/b Rd7xNd4! Gelfer.457.495 2q1rbk1/5ppp/3p1n2/1pr1p3/2P5/1P2P1P1/2R1NPBP/1Q1R2K1/w Ne2c3! Gelfer.458.495 r3r1k1/1pqn1pbp/p2p2p1/3P4/1RP5/4B3/P3BPPP/3Q1RK1/b Re8xBe3! Gelfer.459.495 r2q1rk1/3n1pp1/p2B1b1p/2p5/Pp2P3/1P3P2/R1B2P1P/1Q2R1K1/b Bf6e5! Gelfer.460.495 r4r1k/3qb1pp/4P3/1p1B4/p2PpPb1/4B3/1P5P/R2Q1RK1/b Bg4xPe6! Gelfer.462.495 r4rk1/pp2p1bp/4b1p1/8/2qP4/1Q2BB2/PP3PP1/R3K2R/b Rf8xBf3! Gelfer.463.495 3b1rk1/r3q1np/p2pPppB/2p1p3/Q1P1P1P1/P4RNP/5P2/1R4K1/w Ng3f5! Gelfer.464.495 1r6/q5pk/3p1p1p/p1pPpP1P/PrBnP1P1/1PQ5/1R4K1/1R6/b Rb4xBc4! Gelfer.465.495 r3r1k1/2q2p1p/p1p2np1/2b1n3/1NPRp3/1PB1N1Pb/P3PP1P/Q2R2KB/w Nb4c2! Gelfer.466.495 3n2k1/p2q1rpp/1pn1p2P/3pPp1N/1BrP4/P2Q2R1/2P2PP1/R3K3/b Pg7g6! Gelfer.467.495 r4rk1/pp3pp1/3R1bbp/2q1B3/2B5/1P6/P3QPPP/4R1K1/w Rd6xBf6! Gelfer.468.495 r4rk1/1bq2ppp/p4b2/3ppP2/2P1P3/1P2BQ2/2P1N2P/R4RK1/w Pe4xPd5! Gelfer.469.495 3rq1k1/4rppp/2n3b1/pp2P3/2pP1QB1/P1P1R3/1B4PP/4R1K1/b Re7e6! Gelfer.471.495 r2q1rk1/6bn/p2p2p1/1b1Pp1Pp/pP2P3/4BP2/PN1Q2B1/2R1K2R/b Rf8f4! Gelfer.472.495 rn1q1rk1/pp3ppp/2p1p3/5b2/PbBPn3/2N1PN2/1P2QPPP/R1B2RK1/w Bc4d3! Gelfer.473.495 1r1r2k1/2b1qp1p/b1p3p1/p1p1p3/2P1P3/1PN1BP2/P1Q3PP/R2R2K1/b Rd8d4! Gelfer.474.495 4rrk1/pp4bp/2nq2p1/3p3n/3p1p2/1QP2B2/PP1B1PPP/R1N1R1K1/w Nc1d3! Gelfer.475.495 after ...exd4 r3rbk1/1pqb3p/2ppn1p1/p1n2p2/2PNP3/PPN1B1P1/2Q2PBP/3RR1K1/w Nd4xPf5! Gelfer.476.495 2r2rk1/pb3pp1/1p2pq1p/3n4/1n1PR3/2P2N2/P2B1PPP/RBQ3K1/b Rc8xPc3! Gelfer.477.495 2rq1rk1/1p1bbppp/p2ppn2/8/Pn1NPP2/2N1B1Q1/1PP1B1PP/R4R1K/b Rc8xNc3! Gelfer.479.495 2rr2k1/1bqnbppp/p2ppn2/1p6/4P3/PNN1BPQ1/1PPRB1PP/5RK1/b Pd6d5! Gelfer.480.495 2rq1rk1/pb2bppp/1p1ppn2/n5P1/3NPP2/1BN1BQ2/PPP4P/R4RK1/b Rc8xNc3! Gelfer.481.495 r1b2r1k/ppq3n1/2p1nb2/2P1p1pp/1PB1Pp2/P1N2N1P/1BQ2PP1/3RR1K1/w Nc3d5! Gelfer.483.495 r3kb1r/4Pp2/pn3P2/1pp3B1/2p5/2N3P1/PP3P1P/3RKB1b/w Ph2h4! Gelfer.484.495 3r2k1/p4r2/1p1P1q2/3QpPp1/1P1pP1Pp/7P/P5K1/3R1R2/w Rd1xPd4! Gelfer.485.495 rn3rk1/pb4pp/1p1q4/2pPp3/2P1Pp2/2PN4/P1Q3PP/R1B2RK1/w Bc1xPf4! Gelfer.486.495 4r1k1/4rp1p/1pp3p1/p2p1nq1/3P2P1/1P2PP2/P4QNP/4RRK1/b Nf5xPe3! Gelfer.487B.495 same as 487A after g4? 4rbk1/1r1n1p1p/2b1p1p1/q2p4/P1pP4/2N3PP/1Q1BPPB1/1R3RK1/w Qb2xRb7! Gelfer.490.495 4rr1k/2pqn1bp/1pNp4/1P1b1pp1/3N4/1Q2PRP1/1B4BP/R5K1/w Nd4xPf5! Gelfer.491.495 r1b2rk1/1p2ppbp/6p1/np2P3/n1pN4/P1N3P1/1BP2PBP/2KRR3/w Nc3xNa4! Gelfer.495.495 6b1/p1k4p/1pp1pp2/3p4/3P1P2/2P1P3/PP1N3P/2K5/w Pe3e4? (which gets clobbered by e5!) Gelfer.24.495 2k5/5p1p/1np1p3/p3p3/1P2P3/P1K2P2/6PP/5B2/b Pa5a4,Pa5xPb4+? Gelfer.23.495 after b4 8/2Bn1kp1/pp2pp1p/2p4P/P1P5/1P2PP2/6P1/6K1/b Pa6a5?? (the previous move was Bc7!) Gelfer.26.495 r1bqk2r/pp3ppp/2n1p3/1BP1P3/1b1p4/2N2N2/2P2PPP/R1BQK2R/w Bb5xNc6+!? (previously, black should have played ...Bd7 instead of ...Nc6?) Gelfer.61.495 1rq3k1/4rpb1/2p3p1/4p1Pp/1p2P3/pPP2Q1P/P1B2P2/2KR3R/w Pc3c4?,Bc2d3 (Bd3 planning Bc4 is better than c4??, which is "suicide".) Gelfer.99.495 4k3/7R/r1P5/2K5/8/p7/8/8/b Pa3a2? (black should have moved ...Kd8 Gelfer.126.495 after Kc5 3q4/5pk1/1r2p1p1/1PQ5/8/7P/5P2/1R4K1/b Qd8d6? is refuted by Qxd6! Gelfer.139.495 6r1/1p3k2/2p2p1p/PpP2P2/3P4/2K4P/4R3/8/b Rg8e8?,Rg8g1,Rg8g3+ Gelfer.148.495 4b3/pp2kp1p/5bp1/8/8/4P3/PP2NPPP/3N2K1/w Nd1c3?,Kg1f1 Gelfer.157.495 8/ppp2kpp/n3r3/5p2/2RPpP2/P3P3/1P3PBP/6K1/b Pb7b5? was too loosening; ...c6 was more to the point. Gelfer.185.495 8/5p1k/3p1bpp/2pP4/2P5/5NP1/r4PP1/2R3K1/w Kg1f1? Gelfer.186.495 8/1p2k3/p1rprp2/P2Rn1p1/3RP2p/2P4P/1P2BKP1/8/b Ke7d8?,Ne5g6 Gelfer.208.495 2r1r1k1/pp1b1ppp/5n2/2p1q3/P7/2PBPP2/2Q3PP/R1B1R1K1/b Pc5c4? Gelfer.229.495 r4rk1/6pp/pq6/5p2/Pn6/1p2P3/1P2QPPP/R1BR2K1/b Nb4c2?,Ra8c8 Gelfer.230.495 r3k2r/ppq2p1p/2n1p1p1/3pPn2/5P2/2PQB3/PP2N1PP/3R1RK1/w Pg2g4? Gelfer.232.495 r3k2r/pppqn1pp/5p2/8/3P4/5N2/PP2QPPP/2R1R1K1/b Ke8f7,Pc7c6? Gelfer.240.495 r1bq1rk1/1pp3bp/3p2p1/p1nPpp1n/2P1P3/2NBBP2/PP1QN1PP/2KR3R/w Be3xNc5?? Gelfer.271.495 r1bq1rn1/pp1n2bk/3p2p1/3Pp1Pp/4P3/2N1BP1N/PP1QB3/R3K2R/w Pf3f4?? black is badly cramped but this would let him out Gelfer.289.495 2n1kb1r/p2n1pp1/2p1p2p/3pP2P/3P1P2/4B1N1/PP2N1P1/5K1R/b Pc6c5,Pf7f5? Gelfer.306.495 5rk1/p1p1rppp/bp1p4/3Pp3/2P1PnPP/1P1BKP2/P3N2R/3R4/b Nf4xNe2,Nf4xBd3? Gelfer.324.495 r1b1r3/pp3pk1/2p4p/4p1p1/P5P1/1P2R2P/2P1PPB1/2KR4/b Kg7f6?,Pa7a5 Gelfer.334.495 after a4 r6r/1p1k1p1p/2pn1pb1/p2p4/3P3N/2PBP1P1/P4P1P/2KR3R/w Nh4xBg6,Rh1e1? Gelfer.335.495 3r2k1/4ppbp/2q3p1/p1p1P3/5P2/P1P1B1PP/6RK/1Q6/w Pc3c4,Rg2d2? Gelfer.340.495 4r1k1/1p3p1p/p2p2p1/P2P4/1P6/2Pn1B1P/6P1/R6K/w Kh1g1,Pc3c4? Gelfer.341.495 4r1k1/R3p2p/5np1/5p2/8/5PP1/4PB1P/5K2/b Pe7e6?? was a stupid error Gelfer.361.495 1rb2qk1/p3p2p/1p1pPrp1/8/3N3Q/6P1/P4P1P/3RR1K1/w Pf2f4,Nd4c6? Gelfer.393.495 after ...b6 r1b2r1k/p6p/2Bp2p1/4b2q/3p4/1Q3P2/PP3NPP/R4RK1/w Pg2g3,Pf3f4? Gelfer.421.495 4rqk1/1p1n1pbp/p2p1np1/2pP4/P1P5/2N1B2P/1PQ1BPP1/R5K1/w Pg2g4?? Gelfer.461.495 after ...Qf8 2r1k2r/1p2bppp/p2pbn2/q3p3/4P1P1/2N2P2/PPP2B1P/2KRQB1R/w Pa2a3,Kc1b1? Gelfer.482.495 4r1k1/4rp1p/1pp3p1/p2p1nq1/3P4/1P2PPP1/P4QNP/4RRK1/w Ng2f4,Pg3g4? (the try g4? met with ...Nxe3!) Gelfer.487A.495 r2r2k1/pbn1qpp1/1p5p/2ppN2P/QP1P4/P1R1P1P1/5PB1/2R3K1/b Pc5c4?? Gelfer.488.495 (...b5 is correct, but allows white to make a "daunting" postional sac Rxc5!) gnuchess-4.0.pl70/test/CHESSTEST/hardmid.fin100644 21542 13 240421 5527662451 17504 0ustar cracraftuser#Here are the 879 boards from the second ("hard") section (that is, #positions numbers 939-1817) of Encyclopedia of chess middlegames / #combinations compiled by N. Krogius, A. Livsic, B. Parma, and M. #Taimanov, FIDE, Beograd 1980. # #These positions are, by and large, harder to solve than either the #Reinfeld or the Larsen tactics sets. This is because these positions #were designed to test and edify players at the master level or above, #whereas the Reinfeld and Larsen sets were designed for players below #master level. The min and max length of the solutions in a ECM/C #sample of moderate size was 5-27 ply. The median depth is ~13 ply. #Notice that game 1400 really has 3 white rooks, and game 1702 really #has 3 white knights, or at least, that is how it is printed in the #book. The symbol "+-" is translated "white has a decisive advantage" #in the book, but we've used the symbol "white_wins" below. The same #symbol but with the + above the - is "white has the upper hand" but we #have used the symbol "white_ahead". # #The players to move in Diagrams 1731 and 1762 were misprinted in the book. #In diagram 1031, a black pawn on f3 was misprinted as a black bishop. # 2q1r1k1/1ppb4/r2p1Pp1/p4n1p/2P1n3/5NPP/PP3Q1K/2BRRB2/w Pf6f7+! (Krogius_EofCM) #939 white_wins 7r/1p2k3/2bpp3/p3np2/P1PR4/2N2PP1/1P4K1/3B4/b Bc6xPf3+! (Krogius_EofCM) #940 black_wins 4k3/p1P3p1/2q1np1p/3N4/8/1Q3PP1/6KP/8/w Qb3b5! (Krogius_EofCM) #941 white_wins 2r1b1k1/R4pp1/4pb1p/1pBr4/1Pq2P2/3N4/2PQ2PP/5RK1/b Rc8xBc5! (Krogius_EofCM) #942 black_wins 6k1/p1qb1p1p/1p3np1/2b2p2/2B5/2P3N1/PP2QPPP/4N1K1/b Bc5xPf2+ (Krogius_EofCM) #943 black_wins 3q4/pp3pkp/5npN/2bpr1B1/4r3/2P2Q2/PP3PPP/R4RK1/w Bg5xNf6+ (Krogius_EofCM) #944 white_wins 3rr1k1/pb3pp1/1p1q1b1p/1P2NQ2/3P4/P1NB4/3K1P1P/2R3R1/w Rg1xPg7+! (Krogius_EofCM) #945 white_wins r1b1r1k1/p1p3pp/2p2n2/2bp4/5P2/3BBQPq/PPPK3P/R4N1R/b Bc8g4 (Krogius_EofCM) #946 black_wins 3r4/1b2k3/1pq1pp2/p3n1pr/2P5/5PPN/PP1N1QP1/R2R2K1/b Rh5xNh3 (Krogius_EofCM) #947 black_wins 2r4k/pB4bp/6p1/6q1/1P1n4/2N5/P4PPP/2R1Q1K1/b Qg5xRc1! (Krogius_EofCM) #948 black_wins 1r5r/3b1pk1/3p1np1/p1qPp3/p1N1PbP1/2P2PN1/1PB1Q1K1/R3R3/b Nf6xPg4! (Krogius_EofCM) #949 black_wins 5rk1/7p/p1N5/3pNp2/2bPnqpQ/P7/1P3PPP/4R1K1/w Nc6e7+ (Krogius_EofCM) #950 white_wins rnb2rk1/pp2np1p/2p2q1b/8/2BPPN2/2P2Q2/PP4PP/R1B2RK1/w Nf4d5! (Krogius_EofCM) #951 white_wins 2k4r/1pp2ppp/p1p1bn2/4N3/1q1rP3/2N1Q3/PPP2PPP/R4RK1/w Nc3d5! (Krogius_EofCM) #952 white_wins r3kb1r/pp2pppp/3q4/3Pn3/6b1/2N1BN2/PP3PPP/R2QKB1R/w Nf3xNe5! (Krogius_EofCM) #953 white_wins 2rr2k1/1b3p1p/p4qpb/2R1n3/3p4/BP2P3/P3QPPP/3R1BKN/b Rc8xRc5 (Krogius_EofCM) #954 black_wins r1b1k3/5p1p/p1p5/3np3/1b2N3/4B3/PPP1BPrP/2KR3R/w Rd1xNd5! (Krogius_EofCM) #955 white_wins r3rbk1/1pq2ppp/2ppbnn1/p3p3/P1PPN3/BP1BPN1P/2Q2PP1/R2R2K1/w Ne4xPd6! (Krogius_EofCM) #956 white_wins b7/2q2kp1/p3pbr1/1pPpP2Q/1P1N3P/6P1/P7/5RK1/w Rf1xBf6+! (Krogius_EofCM) #957 white_wins 1rr1nbk1/5ppp/3p4/1q1PpN2/np2P3/5Q1P/P1BB1PP1/2R1R1K1/w Bc2xNa4 (Krogius_EofCM) #958 white_wins r7/5kp1/2p1p2p/1p1n3P/2rP4/2P3R1/PK2RPP1/2B5/b Rc4xPc3! (Krogius_EofCM) #959 black_wins r1r3k1/p3qpp1/b1P4p/3p4/3Nn3/4P3/P1Q2PPP/1BR1K2R/b Qe7b4+ (Krogius_EofCM) #960 black_wins rn3rk1/4bppp/1q2p3/p2pP3/8/1PN2B1P/P4PP1/2RQ1RK1/w Bf3xPd5! (Krogius_EofCM) #961 white_wins 6rk/1p1br2p/pqp5/3pNP2/3Pp3/P5PR/5PKR/Q7/w Rh3xPh7+! (Krogius_EofCM) #962 white_wins 2b3k1/5p1p/7b/p2B3p/3P4/P2Q1N1P/1q3PP1/6K1/w Bd5xPf7+! (Krogius_EofCM) #963 white_wins r1b5/4k3/p7/3p1n2/3Bp3/2P2r1P/PPBK1P2/4R2R/w Bd4c5+ (Krogius_EofCM) #964 white_wins r4rk1/1b3Npp/p7/1p3Q2/3P4/1B2q3/P5PP/3n1R1K/b Bb7xPg2+! (Krogius_EofCM) #965 black_wins r1b2rk1/2q2ppp/2pbp3/p7/4Nn2/3B4/PPPBQ1PP/R4R1K/w Rf1xNf4! (Krogius_EofCM) #966 white_wins 3r2k1/1q1P1ppp/r2R2n1/p4Q2/1ppB2R1/6P1/PP3PP1/6K1/w Rg4xNg6! (Krogius_EofCM) #967 white_wins r2q1rk1/p3b1pp/2p5/1pn5/1n1Bp1b1/1P6/PQ1PPP2/2RNKBNR/b Bg4xPe2! (Krogius_EofCM) #968 black_wins 3r2k1/p2r1p1p/1p2p1p1/q4n2/3P4/PQ1R3P/1P2NPP1/3R2K1/b Nf5xPd4! (Krogius_EofCM) #969 black_wins 2bnr1k1/2q2ppp/p7/2p1b3/2N1B3/R7/1P2QPPP/2B3K1/w Nc4xBe5 (Krogius_EofCM) #970 white_wins r1b2r1k/3nN2p/p2Q1p2/8/4PP2/1R6/q1PK2PP/4R3/w Qd6d5! (Krogius_EofCM) #971 white_wins 1nk1r1r1/pp2n1pp/4p3/q2pPp1N/b1pP1P2/B1P2R2/2P1B1PP/R2Q2K1/w Nh5f6! (Krogius_EofCM) #972 white_wins 2r2bk1/4qp2/3n2p1/2R1p1Np/2p1N3/r6P/1Q3PP1/3R2K1/w Rc5xRc8 (Krogius_EofCM) #973 white_wins br1r2k1/1q4p1/p2ppb1p/2p2p2/2P1n3/Pn2P2P/QPR2PPB/2NRNBK1/b Nb3xNc1! (Krogius_EofCM) #974 black_wins 2k4r/ppp1n1p1/2n2qb1/2N5/Q1P3p1/P2r3P/1P3PB1/R1B2RK1/w Qa4b5 (Krogius_EofCM) #975 white_wins 8/6bk/1B1R4/6p1/2bNP3/4KP2/1r6/8/b Bg7e5 (Krogius_EofCM) #976 black_wins r1b1rnk1/1p3pb1/1qpp2p1/2n5/2PNP2p/1PN3PP/3R1PBK/BR1Q4/b Ra8xBa1! (Krogius_EofCM) #977 black_wins r1b2rk1/pp2b3/2pn1n1p/3pNppq/3P4/BP1N2P1/P3PPBP/R1Q2RK1/w Ne5xPc6! (Krogius_EofCM) #978 white_wins 5rk1/1b3ppp/p3p3/1p1q2N1/4n3/6P1/PP2PPBP/2Q2RK1/b Ne4xPg3! (Krogius_EofCM) #979 black_wins 2kr3r/pppq2p1/1bn1R3/6N1/1P6/1QN1B1p1/P4PP1/R5K1/b Pg3xPf2+ (Krogius_EofCM) #980 black_wins 2rr4/5pk1/p1q3p1/3bpP1p/1p4nR/1N4Q1/PPP3PP/3NR2K/b Bd5xPg2+! (Krogius_EofCM) #981 black_wins r4rk1/pp4pp/2nqb3/3p4/8/2NB4/PP1Q1PPP/4RRK1/w Bd3xPh7+! (Krogius_EofCM) #982 white_wins 3rk1r1/3b1p1p/p2BpQ2/8/2q5/2P5/PP3PPP/3R2K1/b Rg8xPg2+! (Krogius_EofCM) #983 draw 3r1rk1/4pp1p/p1QPb1p1/3N4/3b4/5B2/Pq3PPP/R4RK1/b Be6xNd5! (Krogius_EofCM) #984 black_wins 5bk1/1bqn1r1p/p3Q1p1/4p3/1PN1Pp2/P1N4P/5PP1/R1BR2K1/w Qe6xRf7+! (Krogius_EofCM) #985 white_wins 3rkb1r/1p3p2/p1n1p3/q5pp/2PpP3/1P4P1/P1Q1BPKP/R2N3R/b Pd4d3! (Krogius_EofCM) #986 black_wins 5rk1/1r1qbnnp/R2p2p1/1p1Pp3/1Pp1P1N1/2P1B1NP/5QP1/5R1K/w Qf2xNf7+! (Krogius_EofCM) #987 white_wins 2kr1b1R/1b3pp1/p2pp3/1pq3P1/2nQPP2/P1N5/1PP1BB2/1K6/w Rh8xBf8! (Krogius_EofCM) #988 white_wins 1k1r1b1r/p1p1q3/2p1p3/4Ppp1/4nP2/P2BQ3/1PP3PB/2KR3R/b Rh8xBh2! (Krogius_EofCM) #989 black_wins r3nb1Q/p1q2kr1/2p3p1/2ppnpP1/1P3N2/4P3/PB1P4/1R2KB1R/w Qh8xBf8+! (Krogius_EofCM) #990 white_wins r1bq1rk1/pp3pbp/2pp1np1/2n3B1/2PNP3/2N2P2/PP1QB1PP/R4RK1/b Nf6xPe4! (Krogius_EofCM) #991 black_wins 1rb1qn2/1p2nrbk/p2p2p1/P2Pp1Pp/NP2P2P/2RNB3/2QKB3/1R6/w Be3a7 (Krogius_EofCM) #992 white_wins 5r2/1b2k2p/3bp3/5PP1/Bn1Q3P/1N6/1Pr5/1K3R2/b Rc2xPb2+! (Krogius_EofCM) #993 draw r1b1r1k1/pp4bp/5np1/2qPB3/8/6NP/PPP1Q1B1/R4R1K/w Rf1xNf6! (Krogius_EofCM) #994 white_wins r1b2r1k/1pq3bp/8/3Qp2n/1P1n1pp1/2NP2P1/3BPPBP/1R2NRK1/b Qc7xNc3! (Krogius_EofCM) #995 black_wins 4qk2/pp3pp1/1nbr3p/2p5/5N2/2P1Q3/PPB2PPP/2K1R3/w Nf4g6+! (Krogius_EofCM) #996 white_wins 3q2k1/pb3p1p/4pbp1/2r5/PpN2N2/1P2P2P/5PP1/Q2R2K1/b Rc5d5! (Krogius_EofCM) #997 black_wins r4rk1/pp1bp1pp/3bpq2/3p1p2/2PPn3/PP1B4/1BQN1PPP/R4RK1/b Bd6xPh2+! (Krogius_EofCM) #998 black_wins r4rk1/1b3ppp/p2q1n2/1p2N3/3P4/1B6/P1Q2PPP/2R1R1K1/w Ne5xPf7! (Krogius_EofCM) #999 white_wins 2rq1r2/pp3pnk/2n1b1pp/3pQ3/3P1N2/P1N5/1P3PPP/1BR2RK1/w Bb1xPg6+! (Krogius_EofCM) #1000 white_wins 4nk2/r1r1bppp/pN2p3/2np4/8/BPN3PP/P3PPK1/2RR4/w Nc3xPd5! (Krogius_EofCM) #1001 white_wins r4r1k/2pqn1b1/p1bp2pp/1p2pn2/4N3/2PP1PPQ/PPB4P/R1B1RNK1/b Nf5d4! (Krogius_EofCM) #1002 black_wins r1bQ1nk1/bp3ppp/p7/3B4/1P6/P3P1P1/2P4P/q1B2RK1/b Ba7xPe3+! (Krogius_EofCM) #1003 black_wins 3r1rk1/1b2bppp/2q1pn2/pp4Q1/3B1P2/PBN5/1PP3PP/R2R3K/b Rd8xBd4! (Krogius_EofCM) #1004 black_wins 2nq2k1/2r3pp/p1p1rp2/PpQ1N3/1P1PR3/8/5PPP/2R3K1/w Ne5f7! (Krogius_EofCM) #1005 white_wins r1b2rk1/1p2bppp/p3pn2/4B3/1qBR4/2N5/P3QPPP/R5K1/w Bc4d3! (Krogius_EofCM) #1006 white_wins 3r4/p2nrpkp/2B1p3/2P2pP1/3R3Q/q7/6PP/6RK/w Pg5g6! (Krogius_EofCM) #1007 white_wins 5r1k/p6p/1p1p1qp1/2pQpr2/8/2PP2P1/PP2RPKP/5R2/b Pe5e4! (Krogius_EofCM) #1008 black_wins b1n1r1k1/2q2p1p/p4Pp1/1pBP4/4B1P1/2P1Q3/P4K1P/4R3/w Qe3h6! (Krogius_EofCM) #1009 white_wins 2r2rk1/5pbp/p5p1/3P2q1/1QbN4/5P2/P4BPP/2RR2K1/b Bc4f1! (Krogius_EofCM) #1010 black_wins r1bqnrk1/pp2ppb1/1np3pp/4P1N1/5P2/2NBB3/PPP3P1/R2Q1RK1/w Ng5h7! (Krogius_EofCM) #1011 white_wins 3nk3/3q1p2/1B3pr1/4p3/bP2P2p/r2B4/2Q2RPP/3R2K1/w Bd3b5! (Krogius_EofCM) #1012 white_wins 3rnr1k/pp3ppp/4b3/2p1qNP1/P2pPR2/1P1P2Q1/2P3BP/5RK1/w Nf5h6! (Krogius_EofCM) #1013 white_wins r1b2kr1/1p1p1pNp/p1n1p1p1/5P2/3QP3/2N5/PqP1B1PP/R4RK1/w Pf5xPg6! (Krogius_EofCM) #1014 white_wins 5rk1/3r1p1p/3b2pQ/8/4q3/4B2P/3R1PP1/4R1K1/w Rd2xBd6! (Krogius_EofCM) #1015 white_wins 4rrk1/1bp2ppp/p1q2b1B/1pn2B2/4N1Q1/2P4P/PP3PP1/3RR1K1/w Ne4xNc5! (Krogius_EofCM) #1016 white_wins 2rnrbnk/3q1ppp/p1p5/3p1P2/1p1PPN2/4BQ1R/PP1N2PP/3R2K1/w Nf4g6+! (Krogius_EofCM) #1017 white_wins 5r1k/pb2r1bp/1p2B1p1/n7/4qNQ1/4B3/P4PPP/2RR2K1/w Rd1d4! (Krogius_EofCM) #1018 white_wins Q7/p1r1ppk1/1qP4p/2Rb2p1/8/3N2P1/4PP1P/6K1/b Qb6b1+ (Krogius_EofCM) #1019 black_wins 1r3rk1/5pp1/1n2qn1p/1p1pPNb1/2pP2QP/2P5/1PB3P1/R1B1R1K1/w Pe5xNf6! (Krogius_EofCM) #1020 white_wins r2qr1k1/pp3pbp/3p1np1/2pP1bB1/2P1N3/3Q1PN1/PP4PP/R4RK1/b Nf6xNe4! (Krogius_EofCM) #1021 black_wins 4r1k1/1b4pp/p7/1prP3q/2P1B3/5P2/P3Q2P/3RR2K/w Be4g6! (Krogius_EofCM) #1022 white_wins r1br2k1/ppb1qpp1/2P4p/2n1p3/4B3/P1N2N2/1P3PPP/2RQ1RK1/w Nc3d5! (Krogius_EofCM) #1023 white_wins 2r3k1/1nqbrp2/p5pp/1p1Pp1N1/8/1P5P/P1B2PP1/2RQR1K1/w Ng5xPf7! (Krogius_EofCM) #1024 white_wins 2r1rbk1/1b3ppp/pp6/2q1pNP1/Pn1RP3/2N5/1PP2QBP/5R1K/w Nf5h6+ (Krogius_EofCM) #1025 white_wins r1b1rk2/3n1pbQ/2qp2p1/p2N2P1/2Bp3N/4P3/PP3PP1/2KR3R/w Nh4xPg6+! (Krogius_EofCM) #1026 white_wins r1r2qkb/4pp1p/pBbp3P/3Nn1P1/4Q3/1B6/PPP5/1K1R2R1/w Pg5g6! (Krogius_EofCM) #1027 white_wins r4k2/q4npp/P2P4/2p1R3/2N5/6PP/Q5K1/8/w Re5e7! (Krogius_EofCM) #1028 white_wins rn1q1r2/4bpk1/p3p3/1pN1N1np/2pP4/4PpBb/PPQ4P/1B1RK1R1/w Ne5c6! (Krogius_EofCM) #1029 white_wins 5rk1/6pp/8/2Q4q/N2pP3/4b1Pb/4PP1K/1R3R2/b Bh3xRf1+! (Krogius_EofCM) #1030 black_wins 2r4k/pp2Q1pp/5r2/P2P4/3Pb1P1/4Ppq1/1P1R3N/3R3K/b Qg3e1+! (Krogius_EofCM) #1031 black_wins 1r1rb1k1/2p3pp/p2q1p2/3PpP1Q/Pp1bP2N/1B5R/1P4PP/2B4K/w Qh5xPh7+! (Krogius_EofCM) #1032 white_wins r1b4k/p2n1Bpp/1p1Q1n2/5p2/3P4/P3BqP1/1P3P1P/R4RK1/b Bc8b7 (Krogius_EofCM) #1033 black_wins rn1r2k1/p4ppp/2p3b1/3PQ3/1B2Np1q/1B3P2/P1P3PP/4R1K1/w Qe5e8+! (Krogius_EofCM) #1034 white_wins 4r2k/5R1p/pp1Bq1pN/2p1P3/1n1b3Q/3P4/1P4KP/8/w Rf7xPh7+! (Krogius_EofCM) #1035 white_wins r2nk1r1/pb3q1p/4p3/3p2pQ/8/BP6/P4PPP/2R1R1K1/w Rc1c7! (Krogius_EofCM) #1036 white_wins 6k1/1pqb1p2/5bpB/r2n4/4N1P1/1P3P2/1P1Q4/1K5R/w Qd2xNd5! (Krogius_EofCM) #1037 white_wins rr4k1/2p1ppb1/3pbnpp/q1pP4/4P3/1PNNBP1P/P1KR2P1/2Q4R/b Qa5xNc3+! (Krogius_EofCM) #1038 black_wins 1r3rk1/3Q2pp/p3p3/6B1/3np3/6R1/PqP1B2P/3K2R1/w Qd7xPg7+! (Krogius_EofCM) #1039 white_wins 2r5/p4Q2/k1bBp3/4P3/p1nq4/5B2/2Pr2P1/1R1RK3/w Qf7b7+! (Krogius_EofCM) #1040 white_wins 5rk1/p1pb2pp/2p5/3p3q/2P3n1/1Q4BN/PP1Np1KP/R3R3/b Qh5xNh3+! (Krogius_EofCM) #1041 black_wins 2r1nk2/4qpbQ/4b3/1p2RpP1/4P3/p7/PBP5/1K5R/w Qh7xBg7+ (Krogius_EofCM) #1042 white_wins 2kr4/1bpr3p/4R3/1pQ5/8/6B1/3q2PP/2R4K/w Qc5xPc7+! (Krogius_EofCM) #1043 white_wins r4rk1/1pbb2pp/p1p1p2q/2Pp4/1P1Pn3/P3B2P/2Q1BPP1/R4RNK/b Qh6xBe3! (Krogius_EofCM) #1044 black_wins r1k4r/ppp1b3/5Npp/4pb1Q/8/1B2B3/PqP2PPP/2RR2K1/w Qh5xBf5+! (Krogius_EofCM) #1045 white_wins 6r1/p4rkp/3RQ1n1/1pp1p1B1/2p1P3/2P3R1/P4qPK/8/w Qe6xPe5+! (Krogius_EofCM) #1046 white_wins 2kr1r2/1pp3pp/1n2p1b1/pN2B3/P1q5/1Q1p3P/5PP1/R4R1K/w Ra1c1! (Krogius_EofCM) #1047 white_wins 2kr1bnr/1ppq4/p3bp2/6pp/4p3/2N2NBP/PP3PP1/2RQ1RK1/w Nc3a4! (Krogius_EofCM) #1048 white_wins r2q2rk/p3bp1p/4b1p1/3pP2R/1p1B4/3BQ3/PPP3PP/5R1K/w Rf1xPf7! (Krogius_EofCM) #1049 white_wins r1b1Q3/6pk/p6p/1pq1n3/4N3/8/PPP3PP/R6K/b Qc5c6! (Krogius_EofCM) #1050 black_wins q6r/pp3pkp/5np1/4Q3/4P3/6N1/P4PPP/5RK1/w Ng3h5+! (Krogius_EofCM) #1051 white_wins r1b1rk2/pp3ppQ/1np5/4q3/2B4N/4P3/PP3PP1/2R2K1R/w Qh7g8+! (Krogius_EofCM) #1052 white_wins r1bn1rk1/pp3p1p/6p1/2bR2N1/2B2B2/q1P1P3/2Q2PPP/4K2R/w Ng5xPh7! (Krogius_EofCM) #1053 white_wins r3r1k1/p2N1pp1/1pn1p3/q1n5/2PQ4/P3B3/4PPKP/R5R1/w Nd7f6+! (Krogius_EofCM) #1054 white_wins 4qbk1/1R5n/p2pr1p1/2pQpNPp/P1P1P3/2P2P2/3B4/5K2/w Nf5e7+! (Krogius_EofCM) #1055 white_wins 3qr1k1/1p1bppbp/p2p2p1/2rPn3/P2N4/4BP2/1PPQ2PP/R2R1BK1/w Nd4e6! (Krogius_EofCM) #1056 white_wins 2b2r2/1p2q1k1/r3pppp/4n2P/p3N3/1B4Q1/PPP3P1/3R1R1K/w Rf1xPf6! (Krogius_EofCM) #1057 white_wins 8/R5p1/6k1/pr2p1b1/4K3/7P/5P2/6R1/w Ph3h4! (Krogius_EofCM) #1058 white_wins 5rk1/1b1r1p2/p1q1pQp1/1p2P2p/8/1BP1NR2/PP1n2PP/5R1K/w Bb3xPe6! (Krogius_EofCM) #1059 white_wins 6k1/p1p2r2/1p1p1P1Q/3P4/2P5/5qr1/PP4RP/6RK/w Qh6h3! (Krogius_EofCM) #1060 white_wins 2b1rr1k/1p5p/1Ppp2q1/p3bN2/2P1n3/5R2/PBQ3BP/3R2K1/w Nf5xPd6! (Krogius_EofCM) #1061 white_wins 3b2rk/7p/p7/2pbqNrn/Pp1p1R2/1P1Q2P1/1BPN1R1P/6K1/w Rf4xPd4! (Krogius_EofCM) #1062 white_wins 1rbr2k1/1pq1bp1p/p1pNn1p1/2n1p3/2B1P2P/1NQ1BP2/PP4P1/1K1R3R/w Nd6xPf7! (Krogius_EofCM) #1063 white_wins r4rk1/1pp1b1pp/p1q5/3pPp2/3Pn3/P3N3/1P3PPP/R1BQR1K1/w Qd1b3 (Krogius_EofCM) #1064 white_wins rbbq1rk1/p3nppp/1p2p3/8/1B1pN3/P2B4/1P3PPP/2RQ1RK1/w Ne4f6+! (Krogius_EofCM) #1065 white_wins rn2qbr1/2p4k/p2p1nb1/1p1Pp2p/2P4P/2NBBPN1/PP1Q4/2KR2R1/w Ng3xPh5! (Krogius_EofCM) #1066 white_wins 5r1k/1p2qp1p/p4R1Q/P1p5/2Prp3/7P/1P4P1/5R1K/w Rf6e6! (Krogius_EofCM) #1067 white_wins r1bq1rk1/pp2bp1p/2p2np1/3p2B1/3P4/2NQ2N1/PPP2PPP/4RRK1/w Re1xBe7! (Krogius_EofCM) #1068 white_wins 2rq1rk1/pp2bppp/1npp1n2/3PpN1b/2P5/2N3PP/PP2PPB1/R1BQ1RK1/w Pc4c5! (Krogius_EofCM) #1069 white_wins rnbq1rk1/pp2b1pp/5n2/2pPp3/2P1N3/3B1N2/PP4PP/R1BQK2R/w Pd5d6! (Krogius_EofCM) #1070 white_wins 2n1rbk1/5pp1/7p/qP1pp3/4b1Q1/1B5P/1P1N1PP1/2B1R1K1/w Re1xBe4! (Krogius_EofCM) #1071 white_wins 4k3/2R2p2/5p1p/8/rb6/1N6/5PPP/5K2/w Rc7c4! (Krogius_EofCM) #1072 white_wins 2k3r1/pp2rp2/1np5/2Np1p2/P2P3p/1R2P1Pq/2Q2P1P/1R4K1/w Nc5xPb7! (Krogius_EofCM) #1073 white_wins 2r1k3/p3nrR1/1p1p4/2p1p1p1/2P1B3/2PP1P2/P5K1/7R/w Rh1h8+ (Krogius_EofCM) #1074 white_wins 8/1Qp3pk/7p/5p2/5Pqn/1P1r4/P5PP/2B2RK1/b Pc7c6! (Krogius_EofCM) #1075 black_wins 2rr1bk1/5p1p/pPN2np1/3Bp3/2Q1n3/1P2B1Pq/P3PP2/R2R2K1/b Rd8xBd5! (Krogius_EofCM) #1076 black_wins 3r2k1/1p4pp/p1q1p3/3p1B2/bP1B2P1/P4Q2/5PKP/2b2R2/w Rf1xBc1! (Krogius_EofCM) #1077 white_wins rnb1r1k1/pp5p/2pp2p1/4b3/2P1P2q/1NN1BPp1/PP1QB1P1/3RR1K1/b Be5f4! (Krogius_EofCM) #1078 black_wins 5n1r/1p2kp2/rB1Nb3/4p1Pp/4p2P/1PP5/8/1K1R1R2/w Rf1xPf7+! (Krogius_EofCM) #1079 white_wins b3r3/q2B2k1/3Q2p1/1p5p/3pP3/5P2/1p4PP/5RK1/b Pd4d3+ (Krogius_EofCM) #1080 black_wins 4r1k1/3R1ppp/p2p4/5PP1/2q2P2/2n2B2/P1P3QP/1r3R1K/w Rf1xRb1! (Krogius_EofCM) #1081 white_wins 2r3k1/pp2n3/6pQ/4q3/8/2P1p1P1/P5BP/3R2K1/w Bg2d5+! (Krogius_EofCM) #1082 white_wins 6k1/4ppbp/p5p1/1B1Q4/2P2Pn1/8/qr4PP/2B2RK1/b Bg7d4+! (Krogius_EofCM) #1083 black_wins 8/p3q1kp/1p2Pnp1/3pQ3/2pP4/1nP3N1/1B4PP/6K1/w Bb2a3! (Krogius_EofCM) #1084 white_wins r2b1rk1/5qp1/2p2P2/2p3Pp/p6P/2Q5/PPP5/2KR2R1/w Pg5g6! (Krogius_EofCM) #1085 white_wins 5r2/1b3pk1/pqrpp1p1/4n1Nn/1p2PP1P/8/PPPQB3/1NKR2R1/b Rf8c8! (Krogius_EofCM) #1086 black_wins 1r2k2r/p5bp/4p1p1/q2pn3/1p2N1P1/6QP/PPP5/1KBR3R/w Bc1h6! (Krogius_EofCM) #1087 white_wins rn1q1rk1/pp3p1p/2p5/3p4/5Q1P/2NP3R/PPP3P1/4RK2/w Rh3g3+ (Krogius_EofCM) #1088 white_wins 7r/kppQP1pp/p7/2qp1R2/4n3/1P2b2P/P1P3PK/R7/b Rh8e8! (Krogius_EofCM) #1089 black_wins r1b1kb1Q/qp2pp2/p3n1p1/2nN2Pp/2B4P/7N/PPP5/2KRR3/w Nd5c7+! (Krogius_EofCM) #1090 white_wins 8/1bq3kp/p5p1/1pb1p3/4P2P/2PQ2P1/1P5B/5N1K/b Qc7d8! (Krogius_EofCM) #1091 black_wins 2r1q1r1/6bk/p2pN1pp/1p1N4/4P3/3R3Q/PnP4P/1K4R1/w Nd5f6+! (Krogius_EofCM) #1092 white_wins 4r3/Q2bppkp/3p2p1/3Nn3/4P3/6PP/1qr2PB1/R3R1K1/b Re8a8! (Krogius_EofCM) #1093 black_wins 6k1/p1q2pp1/2n2b2/3B2Pp/2P2P2/5N1P/Pr1Q2K1/4R3/w Re1e8+ (Krogius_EofCM) #1094 white_wins r1r3k1/p4n2/3p4/5NpR/8/2q2P2/P1PQ4/2K4R/w Rh5h8+! (Krogius_EofCM) #1095 white_wins 8/p5Q1/2ppq2p/3n1ppk/3B4/2P2P1P/P5P1/6K1/w Pg2g4+ (Krogius_EofCM) #1096 white_wins r1r3k1/1p1b1nq1/6p1/pN1p4/P2Np2R/1P2P3/1Q3PP1/1K5R/w Nb5d6! (Krogius_EofCM) #1097 white_wins 1r2k2r/3q2pp/p3pp2/P7/2P1Q3/8/1nB3PP/1R3R1K/w Bc2a4! (Krogius_EofCM) #1098 white_wins r1bq3k/ppp2Qp1/2n1p2p/6N1/2BPN3/2P1n3/PP4PP/R5K1/w Ne4f6! (Krogius_EofCM) #1099 white_wins 3R4/1p2kp2/p1b1nN2/6p1/8/6BP/2r1qPPK/Q7/w Rd8d7+! (Krogius_EofCM) #1100 white_wins 6k1/p5p1/1p1p1nN1/1B1P4/4PK2/8/2r3b1/7R/w Rh1h8+ (Krogius_EofCM) #1101 white_wins 8/5P2/4K1kP/4R3/8/8/8/5r2/w Re5g5+! (Krogius_EofCM) #1102 white_wins 3r1rk1/p1p1qp1p/2p1b1p1/8/P2PRP2/2P1NQ2/6PP/R5K1/w Pf4f5! (Krogius_EofCM) #1103 white_wins 6k1/pr3ppp/1p3qn1/5NQ1/2p5/8/P4PPP/4R1K1/w Re1e8+! (Krogius_EofCM) #1104 white_wins Q7/1pq2kpp/4bp2/3r4/2B5/P3P3/1r3PPP/2R1K2R/b Rd5d1+ (Krogius_EofCM) #1105 black_wins 4r1k1/p4ppp/4q2r/1Q6/4p3/4P1P1/P4P1P/2RR2K1/w Rd1d6! (Krogius_EofCM) #1106 white_wins 8/5p1k/4p1p1/3p2K1/3P1Q1P/P4P2/7q/8/b Pf7f6+! (Krogius_EofCM) #1107 black_wins r4r2/6k1/3p4/2pPp2p/4Pqp1/3P1P2/1R2Q1KP/5R2/b Ra8a1! (Krogius_EofCM) #1108 black_wins 4r1k1/1np1r1pp/1ppp1q2/6N1/1P3P2/4RQP1/7P/4R1K1/w Qf3h5! (Krogius_EofCM) #1109 black_wins r4rk1/pp3p1p/3pq1p1/2nNp3/3R1P2/7Q/PP4PP/5RK1/w Pf4f5! (Krogius_EofCM) #1110 white_wins 3qn2k/1p3Bp1/rbn4p/2p5/p1P2p2/P2b2PP/1BQNRP2/1R4K1/w Qc2xBd3! (Krogius_EofCM) #1111 white_wins 3r1rk1/1pp4p/1q3bp1/p3p3/P2n1P2/2BB3P/1PP2QP1/R4RK1/b Bf6h4! (Krogius_EofCM) #1112 black_wins 4rrk1/2p2ppp/p2b4/1p1P4/3P2nq/2P4P/PPQ1RPP1/RNB3K1/b Qh4xPf2+! (Krogius_EofCM) #1113 black_wins 1q6/2rk1p2/p1n1b1rN/3p2p1/8/3Q4/PP1B1PPP/2R1R1K1/w Nh6xPf7! (Krogius_EofCM) #1114 white_wins r3kb1r/2q2p2/3p4/ppp1n1B1/P6P/1B3pQ1/1PP3b1/2KRR3/w Bb3d5 (Krogius_EofCM) #1115 white_wins r1b2rk1/1p4pp/p1n3q1/4ppN1/7Q/2P1B3/P1P2PPP/R2R2K1/w Rd1d6! (Krogius_EofCM) #1116 white_wins 1rb2r2/1pR1N2p/p2R2pk/5p2/4pP2/1P1nP3/P4P1P/5BK1/w Rd6f6! (Krogius_EofCM) #1117 white_wins r1b3k1/ppp2r2/6p1/3n3p/6qP/3BQ3/PBP5/2KR3R/w Bb2d4! (Krogius_EofCM) #1118 white_wins 3r2k1/p2q1r1p/1p1N2p1/1PpP4/3b1Bn1/1Q4Pb/1P2RP1P/R5KB/b Qd7xNd6! (Krogius_EofCM) #1119 black_wins 4r1k1/1pbb3p/2pp2q1/p1n5/2P2R2/1PN1n1P1/PB2Q1B1/5RK1/w Qe2xNe3! (Krogius_EofCM) #1120 white_wins 3r2k1/p2r1p1p/1pR1p1qP/3P1pP1/3R4/1P2Q3/P4K2/8/w Pd5xPe6! (Krogius_EofCM) #1121 white_wins 3r3k/p1Q3bp/2p3p1/8/2P1BRn1/1P4Pb/P1N1q2P/6BK/b Ng4f2+! (Krogius_EofCM) #1122 black_wins r4k2/p1pr1ppp/2q5/3PR2P/3Q4/8/6P1/5RK1/w Re5e7! (Krogius_EofCM) #1123 white_wins 1R3b2/3r3k/2p1bp1p/r1q1pNpQ/2PpP2P/6B1/P4PP1/1R4K1/w Nf5xPh6! (Krogius_EofCM) #1124 white_wins r1b4r/pp2ppk1/2np1np1/3N3p/2B1P3/q3BP2/P1PQ2PP/1R3RK1/w Nd5xPe7! (Krogius_EofCM) #1125 white_wins r3k2r/pb1n1pbp/4p1p1/q1n1P3/Bp1N1N2/4B3/PP3PPP/R2Q1RK1/w Nd4xPe6! (Krogius_EofCM) #1126 white_wins 5rk1/Q2nqppp/5n2/2p5/8/1B2PP1P/Pr1B1P2/R3K2R/b Nf6e4! (Krogius_EofCM) #1127 black_wins 5rk1/5pbp/b5p1/p1nNN3/1p2n3/1P4PP/P4PB1/2BR2K1/w Ne5d7 (Krogius_EofCM) #1128 white_wins 2k1r1r1/ppb2p2/6b1/2qP4/2P2P2/4pP1p/P3Q2P/2RBRN1K/b Bg6d3! (Krogius_EofCM) #1129 black_wins 5r1k/pp1n1p1p/1b1qpP2/8/1PrN4/P1N1Q1P1/7P/3R1R1K/w Qe3h6 (Krogius_EofCM) #1130 white_wins r2r1bk1/3qp2p/3pp1p1/p2n2N1/2N3Q1/BP4P1/P4PP1/2R3K1/w Nc4b6! (Krogius_EofCM) #1131 white_wins 1r3rk1/p4pbp/q1p2pp1/3p1b2/1n1P1P1B/PB3N2/1PPQR1PP/2KR4/b Bf5xPc2! (Krogius_EofCM) #1132 black_wins 1rbr2k1/4qp2/p1n2bpp/1pp1p1N1/4P3/2P1BQ1P/PPB2PP1/3RR1K1/w Be3xPc5! (Krogius_EofCM) #1133 white_wins 2r2rk1/1p1q1ppp/1p3n2/3p1N2/4n3/1N3Q2/PPP2PPP/R2R2K1/w Rd1xPd5! (Krogius_EofCM) #1134 white_wins rn3rk1/pp2ppbp/6p1/2R3N1/2B3b1/q3B3/P1P1Q1PP/5RK1/w Rf1xPf7! (Krogius_EofCM) #1135 white_wins r1k3r1/pppnb1p1/4N3/3QP2p/3P3q/4B3/PPP2P2/R3KB2/w Bf1a6! (Krogius_EofCM) #1136 white_wins r1nqr2k/1p1b1Q1p/p5p1/P1pPb3/5B2/2N5/BP4PP/R4RK1/w Qf7f8+! (Krogius_EofCM) #1137 white_wins 8/k3r1b1/Pp2rpp1/1qpQ4/4nB2/2P2NP1/7P/R4RK1/w Bf4b8+! (Krogius_EofCM) #1138 white_wins 1k1r4/ppq2p2/8/2pPb1r1/2P1Q1B1/6P1/PP3PK1/R4R2/b Pf7f5! (Krogius_EofCM) #1139 black_wins r1b2nk1/2qn1p1p/1ppR2p1/8/1PP1NP2/4r1PP/1Q2N1B1/3R2K1/w Pb4b5! (Krogius_EofCM) #1140 white_wins 8/5pk1/3q2p1/8/7P/5Q1K/6B1/6b1/b Qd6h2+! (Krogius_EofCM) #1141 black_wins 6r1/ppp4k/3p2rp/3Pb3/PPP1Np1q/5P1b/3QRRBP/6K1/b Be5d4! (Krogius_EofCM) #1142 black_wins 4br1k/pR4bp/2r1B1pN/4npB1/3p4/P7/5PPP/4R1K1/w Rb7xBg7! (Krogius_EofCM) #1143 black_wins r1bq1rk1/pppn2bp/3p2p1/3N1p2/8/BP1BRQ1P/P1PP1PP1/4R1K1/w Nd5xPc7! (Krogius_EofCM) #1144 white_wins r6r/1p2kp2/3p1b2/pPpPpQ1P/1nP1P2P/6R1/1P2K3/1B6/w Rg3g6! (Krogius_EofCM) #1145 white_wins 2q1r1k1/1b3pbp/3p2p1/1Ppn3n/5P2/5B2/1P1B2PP/R2NNQ1K/b Nd5xPf4 (Krogius_EofCM) #1146 black_wins 2r1r1k1/pp3pp1/3p3B/P2P1P2/2nb4/7R/1q3PQP/1B3R1K/w Rh3b3! (Krogius_EofCM) #1147 white_wins r2qr1n1/p4pk1/1p1p2p1/4p3/4PQ2/1PN2P2/1PP3P1/2KR3R/w Rh1h7+! (Krogius_EofCM) #1148 white_wins r4rk1/ppp3b1/3p1qp1/3Pp3/2P1Bn2/4BP2/PP1Q4/2K3RR/w Rg1xPg6! (Krogius_EofCM) #1149 white_wins 1k1r2r1/pp3p1p/B2q1n2/8/3Pb1p1/2Q5/PR3PPP/2B1R1K1/w Bc1f4! (Krogius_EofCM) #1150 white_wins k3r3/pR5p/PppR1p1p/4nP2/1PP5/8/4B1rP/2K5/w Rb7e7! (Krogius_EofCM) #1151 white_wins 1q3rk1/r5b1/pNp1bn1p/2Pp1n2/1P2p3/1N2P2P/PBQKB3/3R3R/b Nf5xPe3! (Krogius_EofCM) #1152 black_wins r4n1r/ppq1nk2/1bpRpN2/4PpQ1/8/2B4P/PPP2PP1/2KR4/w Rd6d7! (Krogius_EofCM) #1153 white_wins 3r2k1/p5pp/bpP1p3/3n1p2/2NQpP1q/P3P3/1B1R1R2/4KBr1/b Rg1xBf1+! (Krogius_EofCM) #1154 black_wins 1rq1r2k/5Rbp/p2p1p1B/2p1p3/2P1P2Q/1P6/P5PP/3b3K/w Bh6xBg7+ (Krogius_EofCM) #1155 white_wins 5Q2/5p1p/3p2p1/4p1k1/4P1P1/3R1P1K/r6P/4q3/w Pf3f4+! (Krogius_EofCM) #1156 white_wins 2b2r1k/ppq3pp/3b3r/n3NpN1/Q2PpP1B/2P1R3/PP5P/4R1K1/w Ng5f7+ (Krogius_EofCM) #1157 white_wins 2r1r1k1/1R4bp/p5p1/2pqn3/8/2B5/1PQ1B1PP/5RK1/w Be2c4! (Krogius_EofCM) #1158 white_wins 7k/pp1q2pp/3Nr1n1/3B2Q1/2pP4/B3P1Pb/P6P/6K1/w Qg5d8+! (Krogius_EofCM) #1159 white_wins r5k1/5p1p/bq1p2p1/r2Pp3/1p2N1P1/1P3P2/1KPQ3P/3R3R/b Ra5a2+! (Krogius_EofCM) #1160 black_wins 5Bk1/pr2pp1p/2b3pQ/2p1q3/8/2P4P/PP4P1/1B1Rb1K1/w Bf8g7! (Krogius_EofCM) #1161 white_wins 5nk1/2b1q1p1/2p5/3pP1pQ/1r1P2P1/3B1R2/5PP1/6K1/w Rf3xNf8+! (Krogius_EofCM) #1162 white_wins 1k1r3r/1pp2p2/p2b4/4n1p1/N3q1P1/1B2B3/PP3RP1/4RQK1/b Rh8h1+! (Krogius_EofCM) #1163 black_wins rnb1kr2/p4pQ1/8/1ppPpP2/2p1P3/N6P/Pq4B1/3R1RK1/w Na3xPb5! (Krogius_EofCM) #1164 white_wins 5r1k/2p3pp/3pQ3/3P1rN1/pp5q/5PR1/P4PKP/B7/w Ba1xPg7+! (Krogius_EofCM) #1165 white_wins 8/pR3Bk1/3p2p1/5b1p/2P4P/6P1/P4bQK/4q3/b Bf2g1+! (Krogius_EofCM) #1166 draw r1b1Rnk1/6pp/p4q2/1pp2P2/3r4/2NB4/PP1Q2PP/4R1K1/w Nc3d5! (Krogius_EofCM) #1167 white_wins 1Q6/pb3pk1/1p3qp1/1N3p1p/2Pr3P/3BR1PK/r7/6R1/b Ra2h2+! (Krogius_EofCM) #1168 black_wins rq3r1k/p2n1p2/1pbb1np1/2p2BB1/8/2N2N2/PP3QPP/3R1RK1/w Rd1xBd6! (Krogius_EofCM) #1169 white_wins 2kr3r/Qpp1n1p1/2b2pp1/4b3/8/6N1/PPP2P2/R1B2RK1/b Rh8h1+! (Krogius_EofCM) #1170 black_wins 8/2p2Q1p/1rp5/p3q1kp/P7/2P2RP1/5PK1/8/w Rf3f5+! (Krogius_EofCM) #1171 white_wins 1r2b3/1p2q1bk/p1p1p1p1/P1PpP2r/1P1KpPQP/4P2N/6R1/4B2R/b Rh5xPe5! (Krogius_EofCM) #1172 black_wins 6k1/3b1p1p/6p1/2BPR3/8/4Q2P/1q3rPK/8/w Re5e8+! (Krogius_EofCM) #1173 white_wins 2R5/4ppkp/6p1/p2P4/4P2P/p3B1P1/qbR2PK1/8/w Rc8g8+! (Krogius_EofCM) #1174 white_wins 3rr1k1/1b5p/p6p/1p3N2/6Pb/P1Q1p3/1PP4P/R5K1/b Bh4f2+ (Krogius_EofCM) #1175 black_wins 6k1/p4pq1/2n1p1p1/1p1pP1N1/3P1QPP/8/P3K3/8/w Qf4c1! (Krogius_EofCM) #1176 white_wins 3r1rk1/1pq1nppp/p7/2pB3Q/P4P2/1P2P3/6PP/2RR2K1/w Rc1xPc5!?,Bd5f3? (Krogius_EofCM) #1177 white_wins 8/p1r2q1k/1p1p3p/1Pp1nP2/P1P5/3R2PP/1Q4BK/8/w Rd3xPd6!? (Krogius_EofCM) #1178 white_wins 6k1/1pp2p2/p2p2q1/2PPb3/4r3/Pr4PK/2R5/2Q2NR1/b Re4h4+!? (Krogius_EofCM) #1179 black_wins 3r4/1pQ4R/p1b2kp1/P6p/2q5/7P/2P3P1/6K1/b Rd8d1+ (Krogius_EofCM) #1180 black_wins 6rr/1b3k1p/pbqppPn1/1p5Q/4PN2/P6R/1PP3BP/2B2R1K/w Qh5xPh7+!? (Krogius_EofCM) #1181 white_wins 4rrk1/3b1ppp/pb6/1pqP4/P1p1PP2/1P2NK2/3QB2P/R2R4/b Re8xPe4!? (Krogius_EofCM) #1182 black_wins 2r1r1k1/1p4bp/p2p1qp1/1n1P4/2P1B2P/1N1Q4/PP2R3/1K5R/b Rc8xPc4!? (Krogius_EofCM) #1183 black_wins 6rr/ppqb1pkp/2pb1pn1/3p3Q/3P1P1N/3B1RN1/PPP3PP/5RK1/w Qh5h6+!? (Krogius_EofCM) #1184 white_wins r2qr1k1/1pnb1pp1/p1n1p2p/8/P2P3P/B2B1NP1/6P1/R2Q1RK1/w Bd3h7+!? (Krogius_EofCM) #1185 white_wins r2q1rk1/1b1nbpp1/p1p1p2p/1pPpN3/3P1N2/P2BP3/1PQ2PPP/R4RK1/w Bd3h7+ (Krogius_EofCM) #1186 white_wins 2r2rk1/pb4pp/1p2p3/4Npq1/3P1n2/5P2/PP1R2PP/RB2Q1K1/b Rc8c1!? (Krogius_EofCM) #1187 black_wins 2r1rbk1/5pp1/bq5p/1pnBPN2/6Q1/N7/5PPP/R2R2K1/w Bd5xPf7+!? (Krogius_EofCM) #1188 white_wins 1k1r1r2/2b2R2/Bppp2p1/2q4p/Q2pP3/P2P4/2P3PP/1R4K1/w Ba6b7!? (Krogius_EofCM) #1189 white_wins r5k1/pp2ppb1/4qn2/r3B1p1/3P4/3QNP1R/PP2K1P1/7R/w Be5xNf6 (Krogius_EofCM) #1190 white_wins 1R2br1k/5r1p/p2p1P2/6RQ/3p1P2/4p2B/q6P/5N1K/w Rb8xBe8!? (Krogius_EofCM) #1191 white_wins kr1r4/7p/2bqp1p1/p7/1Pp1PP1P/K1B1nNPB/PP5R/RN2Q3/b Qd6xPb4+!? (Krogius_EofCM) #1192 black_wins 5r1r/1pkb4/5pB1/2P5/p3R2P/Pq6/1PQ2Pn1/K2R4/w Rd1xBd7+!? (Krogius_EofCM) #1193 white_wins kn5r/p2r2p1/1pqBp1np/1Q1pPp2/R2P4/1N6/2P2PPP/R5K1/w Ra4xPa7+!? (Krogius_EofCM) #1194 white_wins 4Rnk1/2p2pp1/3r3p/p2P4/P5Q1/1B5P/5PK1/q7/w Re8xNf8+!? (Krogius_EofCM) #1195 white_wins 4r3/2k1p2q/pp1nR1p1/2pP1pP1/2P2P2/1P6/P1K3B1/4Q3/w Re6xNd6!? (Krogius_EofCM) #1196 white_wins 2b3k1/p4ppp/7q/2Q5/8/P3r1P1/1r4BP/R3R1K1/b Rb2xBg2+!? (Krogius_EofCM) #1197 black_wins r1b1rbk1/7p/2p1pBp1/p2pP1P1/5P2/1PqB4/P1P1Q3/1K4RR/w Rh1xPh7 (Krogius_EofCM) #1198 white_wins 2rq4/5rbk/3p1n1p/p2Pp2P/1p2b3/4BNR1/PP1Q1P2/3BK1R1/w Be3xPh6!? (Krogius_EofCM) #1199 white_wins r2q1rkb/pp2p3/2p2pp1/3pPb2/3P3R/2N3P1/PPPQBPK1/3R4/w Rh4xBh8+!? (Krogius_EofCM) #1200 white_wins 3r2k1/p4rPp/1b1q3Q/n1p1pP2/1p6/3B1NR1/P4P1P/6RK/w Qh6xPh7+!? (Krogius_EofCM) #1201 white_wins r1bqrnk1/p4p2/1p5p/3pB1p1/P2P2n1/1P1B2N1/2Q3PP/R4RK1/w Bd3h7+!? (Krogius_EofCM) #1202 white_wins r2rn1k1/1bqn1ppp/p7/2bpP1P1/1p1N1Q2/1P3B2/PBP1NR1P/3R2K1/w Qf4xPf7+!? (Krogius_EofCM) #1203 white_wins r2r2k1/1bqpbpp1/ppn1p2p/2p1P1N1/P1B2B2/2P5/1PPRQPPP/3R2K1/w Ng5xPf7!? (Krogius_EofCM) #1204 white_wins r1b1r1k1/1p1n1p2/p1nBp1p1/q2pP1Np/P7/R2B3Q/2P2PPP/5RK1/w Ng5xPf7!? (Krogius_EofCM) #1205 white_wins r1b1k2r/ppp3pp/1qp5/2b1Pp2/3Qn3/5N2/PPPBNPPP/2KR3R/w Qd4d8+!? (Krogius_EofCM) #1206 white_wins 1k6/1p4p1/P1p5/5Q2/2q2r2/P7/8/4R2K/w Re1e8+ (Krogius_EofCM) #1207 white_wins 6k1/1p3p2/4r1p1/1PPrbq1p/2QN4/P2R1P1P/R4KP1/8/b Be5g3+!? (Krogius_EofCM) #1208 black_wins 4n1q1/1k1b4/2p4R/2Pp4/1p1N1rpQ/3B4/PPP2P2/2K5/w Nd4xPc6!? (Krogius_EofCM) #1209 white_wins r2qk2r/1pp2ppp/p3pnn1/6N1/1B1P2P1/1Q2P2P/PP3PK1/R6R/b Ng6h4+ (Krogius_EofCM) #1210 black_wins 2kr2r1/R2p3p/2n2p2/1R3P2/2P1p3/4BQ2/1Pq4P/4K3/w Ra7a8+ (Krogius_EofCM) #1211 white_wins r3r1k1/pp3pp1/2bb1q2/3p4/4n1Pp/2P1BB1P/PP2NPK1/R1Q4R/b Qf6xBf3+!? (Krogius_EofCM) #1212 black_wins r1br4/ppq2pk1/3bpN2/8/2P5/3n2B1/PP2QPPP/R4K1R/w Qe2g4+!? (Krogius_EofCM) #1213 white_wins 6kb/B1p2p2/5r2/1r1p2pR/6q1/3P2P1/P1P2PP1/2KR3Q/b Rb5b1+!? (Krogius_EofCM) #1214 black_wins rn4k1/pp2p1b1/4b3/q2p2Q1/2B2P2/8/P1P1K1P1/R6R/w Rh1h8+!? (Krogius_EofCM) #1215 white_wins 3k2r1/pp1b3Q/1b2pP1p/3pN2q/5B2/7B/PP2nP1K/2R5/b Rg8g2+!? (Krogius_EofCM) #1216 black_wins 2r2rk1/pp3qpp/8/3P1b2/3Q4/P1N1B3/5PKP/R2R4/b Rc8xNc3!? (Krogius_EofCM) #1217 black_wins r1b2rk1/1pqp1ppp/p1n1pn2/5N2/8/2PBB3/P1P2PPP/R2QR1K1/w Nf5xPg7!? (Krogius_EofCM) #1218 white_wins 4k2r/1bqnbppp/p3p3/1p2P1N1/2r2BB1/8/PPP3PP/R2Q1R1K/w Ng5xPf7!? (Krogius_EofCM) #1219 white_wins 5r1k/1pqb3p/2n5/p1pB4/2Pp1r1P/1P5P/R2N2K1/3Q1R2/b Bd7xPh3+!? (Krogius_EofCM) #1220 black_wins r4r2/pp2qk2/4pnp1/3pQ3/2p2P2/3B4/PPP2P2/2KR3R/w Bd3xPg6+!? (Krogius_EofCM) #1221 white_wins 3bq3/p1n2rk1/1pp1p1p1/3pPnPp/1P1P1N1P/2PN3K/P2BQR2/8/w Nf4xPg6!? (Krogius_EofCM) #1222 white_wins b6r/2q2k2/4pPp1/1p1n2Bp/2pPB1PP/2P2Q2/8/4R1K1/w Be4xPg6+!? (Krogius_EofCM) #1223 white_wins r1b2r2/3pNpkp/3pn1p1/2pN3P/2PnP3/q3QP2/4BKP1/1R5R/w Qe3h6+!? (Krogius_EofCM) #1224 white_wins 4k3/p4ppp/nb1P4/4p3/1P6/P4BP1/3q1r1P/2R2QKR/w Qf1b5+ (Krogius_EofCM) #1225 white_wins r2q1rk1/pp2pp2/3pb3/3Qb2R/4P1p1/1BN1Bn2/PPP2P2/2K4R/w Rh5h8+!? (Krogius_EofCM) #1226 white_wins 2r1r1k1/pp1nbpp1/4pn1p/q3NN1P/P1pP1B2/2P5/1PQ2PP1/R3R1K1/w Nf5xPg7!? (Krogius_EofCM) #1227 white_wins 1rbk2nr/p1pp2b1/7p/2qP1pp1/2Bn4/2NKBP2/PP2N1PP/R2Q3R/b Qc5xBc4+!? (Krogius_EofCM) #1228 black_wins 1r3rk1/6p1/p1pb1qPp/3p4/4nPR1/2N4Q/PPP4P/2K1BR2/b Rb8xPb2!? (Krogius_EofCM) #1229 black_wins 5rk1/ppp1q2p/1n1p1np1/3P2N1/1P1R2P1/2Q4P/P3r1B1/5RK1/b Re2xBg2+!? (Krogius_EofCM) #1230 black_wins 6k1/pp2p2p/3p2p1/4b1r1/2Pn1r1q/2B1N3/PP4B1/R3QRK1/b Qh4h2+!? (Krogius_EofCM) #1231 black_wins r2qnr2/pp3kbQ/2npb1p1/2pN1pP1/4P3/8/PPP1BP2/R1B1K1NR/w Qh7xPg6+!? (Krogius_EofCM) #1232 white_wins r2k3r/2pb1ppp/p1p1q3/2Q5/5B2/2N5/PPP2PPP/3R2K1/w Bf4xPc7+!? (Krogius_EofCM) #1233 black_wins 2r2r2/2N2pkp/2Q5/1N2p1b1/1p6/3P1qPb/PPR2P1P/4R1K1/b Pe5e4!? (Krogius_EofCM) #1234 black_wins 2r1qrk1/pp1b1ppp/4pn2/n1b5/8/2NQ1NP1/PP1BPPBP/R2R2K1/w Pb2b4!? (Krogius_EofCM) #1235 white_wins 2b1qr1k/7p/p1pR2p1/1pP1p1Q1/4P3/1B6/PP4PP/6K1/w Rd6e6!? (Krogius_EofCM) #1236 white_wins 1r2k2r/2p2p1b/q1Pppb1N/p2p2P1/Q2P4/P3B3/1P5P/2KRR3/b Rb8b4!? (Krogius_EofCM) #1237 black_wins 8/2b2k1p/2N2pp1/P2p4/3KnP2/6BP/P5P1/8/w Kd4xPd5!? (Krogius_EofCM) #1238 white_wins 4b1r1/1p3ppk/3r3p/p1p1qP1B/3pPN2/3P3R/nPPQ3P/6RK/w Nf4e6!? (Krogius_EofCM) #1239 white_wins 4b2k/7p/3q3P/1p1pRpr1/1P1B4/2P2Q2/7K/8/w Qf3g3!? (Krogius_EofCM) #1240 white_wins 2kr2r1/pbp4p/1p4p1/1NqpNp2/4nQ2/8/PPPR1PPP/2K5/w Ne5c6!? (Krogius_EofCM) #1241 white_wins 1rr3k1/1p1bqpbp/1R1p2p1/pN1P4/P3P1n1/1Q6/3NB1PP/2B1R1K1/b Rc8c3!? (Krogius_EofCM) #1242 black_wins r1br4/1p3k2/p2q1p2/3N1Pp1/3Q4/8/PP4P1/4RR1K/w Re1e6!? (Krogius_EofCM) #1243 white_wins r3kbnr/p4ppp/2p1p3/8/Q1B3b1/2N1B3/PP3PqP/R3K2R/w Bc4d5!? (Krogius_EofCM) #1244 white_wins 3r1rk1/2p1qp1p/pnP3p1/4n3/PP1NpR2/1BQ4P/6P1/5RK1/w Nd4e6!? (Krogius_EofCM) #1245 white_wins r1bq1k2/5pb1/p2p1n2/2pPrP2/2p4B/3B2R1/PP1Q2PP/R5K1/w Qd2g5 (Krogius_EofCM) #1246 white_wins 2bq1rk1/p4pbp/p2p2p1/3P4/2p1QP2/2Pr3P/PP1N2P1/R1B2RK1/b Bg7d4+!? (Krogius_EofCM) #1247 black_wins r5rk/1p1bqpnp/3p1b1B/pBnPp2P/4P3/2N2Q2/PP3P2/R3KNR1/b Ng7f5!? (Krogius_EofCM) #1248 black_wins r3rk2/p2q1b1p/1pnP1Qp1/5pN1/2p2P2/P1P5/7P/4RRK1/w Re1e7!? (Krogius_EofCM) #1249 white_wins r3r1k1/p1q2pp1/2p4p/7n/BPPP2N1/3Q1N2/P3n1P1/R1B4K/b Nh5g3+ (Krogius_EofCM) #1250 black_wins r2qrbk1/1p4pb/2n2p1p/pNpn4/2N5/PP1PPQPB/1B5P/2R2RK1/w Nb5d6!? (Krogius_EofCM) #1251 white_wins 5r1k/1p1b1p1p/p2ppb2/5P1B/1q6/1Pr3R1/2PQ2PP/5R1K/w Qd2h6 (Krogius_EofCM) #1252 white_wins r1b2rk1/p3bppp/2q5/8/2p1NR2/PnB1P3/1PB1Q1PP/3R2K1/w Rd1d6!? (Krogius_EofCM) #1253 white_wins r1rbb3/1R3pkp/2pBp1p1/p3P3/q6P/6P1/P2Q1P2/1R3BK1/w Rb1b4!? (Krogius_EofCM) #1254 white_wins 4r3/pp1b3k/2p2qpp/2Pp4/1P6/PBbP1N1P/2R3P1/3Q3K/b Re8e1+!? (Krogius_EofCM) #1255 black_wins 1rb2rk1/p1p2ppp/2q5/3R4/2P1N3/bP4B1/P1Q2P1P/1K5R/w Bg3d6!? (Krogius_EofCM) #1256 white_wins 8/5k1p/5PpB/3PR3/2r4P/1p3K2/2b5/8/b Rc4e4!? (Krogius_EofCM) #1257 black_wins 4r2k/3b3p/p2p4/2pP1p2/q1B2Q1P/2PK1P2/Pr1R4/7R/b Re8e4!? (Krogius_EofCM) #1258 black_wins rnb2rk1/pp2bppp/2p5/q7/4NN2/4B1QP/PPP3P1/2KR3R/w Rd1d5!? (Krogius_EofCM) #1259 white_wins 2R5/2R4p/5p1k/6n1/8/1P2QPPq/r7/6K1/w Rc7xPh7+!? (Krogius_EofCM) #1260 white_wins r1b1r1kb/p1qn1pnp/2p1p1p1/4P1N1/2p1NPP1/4B3/PPPQ3P/3RK2R/w Qd2xNd7!? (Krogius_EofCM) #1261 white_wins 5k1r/ppqnnp2/3b2p1/2pB2Qp/3p3N/1P1P2P1/P1P2P2/2B1R1K1/w Re1xNe7!? (Krogius_EofCM) #1262 white_wins 5rk1/5p1p/8/3pNp2/RPrqn3/1Q5P/1P3PP1/4R1K1/w Re1xNe4!? (Krogius_EofCM) #1263 white_wins 2rr2k1/4qppp/bn6/p1bB4/4N3/6P1/PB2PP1P/2RQ1RK1/w Rc1xBc5!? (Krogius_EofCM) #1264 white_wins 3r1rk1/pbqn1pp1/1pp2n1p/2b1p1B1/P1B1P2N/2N4P/1PP1QPP1/3R1RK1/w Rd1xNd7 (Krogius_EofCM) #1265 white_wins 5rk1/r2nqpp1/p3p3/1p2P3/4N1pP/8/PPP3Q1/1K1R3R/w Rd1xNd7!? (Krogius_EofCM) #1266 white_wins 1rr3k1/4ppb1/2q1bnp1/1p2B1Q1/6P1/2p2P2/2P1B2R/2K4R/w Qg5h6!? (Krogius_EofCM) #1267 white_wins 2r2r1k/1pq1b1p1/p1b1Qn1p/8/3B4/2NB4/PPP3PP/3R1R1K/w Rf1xNf6!? (Krogius_EofCM) #1268 white_wins 3rqb2/1pR3pk/p3n1pp/3p4/3B4/PP6/1P4PP/4RQK1/w Re1xNe6!? (Krogius_EofCM) #1269 white_wins rkb2qr1/1p5p/pQ1bp3/3p2B1/5n2/3B1N2/PP3PPP/2R2RK1/w Rc1xBc8+!? (Krogius_EofCM) #1270 white_wins 2r2rk1/1bq2ppp/p7/1p1pNN2/1b1PnB2/3Q3P/PP4P1/R3R1K1/w Re1xNe4!? (Krogius_EofCM) #1271 white_wins r3r1k1/1p3pPp/p1p5/3bb2N/7q/1P1Q4/2PB2PP/4RRK1/w Re1xBe5!? (Krogius_EofCM) #1272 white_wins 8/5p2/4p1k1/4P1p1/2rBRbK1/5P2/r4P2/7R/b Rc4xBd4!? (Krogius_EofCM) #1273 black_wins r1bqr1k1/pp3pp1/2p4p/3PN1n1/3P1b2/2NB4/PPQ2PPP/3R1RK1/b Re8xNe5!? (Krogius_EofCM) #1274 black_wins r3r1k1/pbqn1ppp/1p3n2/1Pb5/2p5/5N1P/PBQ1BPP1/1N1R1RK1/b Re8xBe2!? (Krogius_EofCM) #1275 black_wins 2r2rbk/6bp/5qp1/1N1p1n2/4p3/1p5P/1P3PP1/RBBQ1RK1/b Nf5g3!? (Krogius_EofCM) #1276 black_wins r1b1r1k1/pp3p1p/1q2p1pQ/2b1P1B1/8/P2B3P/1P3PP1/2R1R1K1/w Rc1xBc5!? (Krogius_EofCM) #1277 white_wins 1k2r2r/1bpQN2p/1p6/P3p2q/4np2/2P2N2/2P2PPP/R3R1K1/b Re8xNe7!? (Krogius_EofCM) #1278 black_wins r1k2n1r/2pb4/1p1p1qpp/p2P1p2/3N1P1P/2Q3P1/PPP1R3/2K1RB2/w Re2e8+ (Krogius_EofCM) #1279 white_wins r1b2r1R/1p2bpk1/4p1p1/4P1N1/p2p4/5Q2/qPP2PP1/1NKR4/w Qf3f6+!? (Krogius_EofCM) #1280 white_wins rnb2rk1/3n1ppp/p3p3/1p2P1q1/3N4/1BN5/PPP3PP/R2Q1RK1/w Nd4xPe6!? (Krogius_EofCM) #1281 white_wins 4q1r1/5kpp/2p1nb2/2PpQp2/r4P2/1N3P2/1BP1R2P/6RK/w Rg1xPg7+!? (Krogius_EofCM) #1282 white_wins 2r1k2r/1pq1bppp/p3bn2/4N3/2pPN3/2P5/P3QPPP/R1B1R1K1/w Ne4xNf6+ (Krogius_EofCM) #1283 white_wins 1r3k1r/4Rn1p/pb1p1P2/1p1q2P1/5p2/7Q/PPP1B1RP/2K5/w Re7xNf7+ (Krogius_EofCM) #1284 white_wins 4rrk1/ppn3pp/2pb1n1q/3p4/1P1P4/P3BNP1/2P1BPKP/R2Q1R2/b Re8xBe3!? (Krogius_EofCM) #1285 black_wins 2b1r2k/2Q4p/4q3/1pp5/3b4/4NP2/1P3BP1/3R2K1/w Rd1xBd4!? (Krogius_EofCM) #1286 white_wins r3r1k1/pp3ppp/1qp5/2bbNQ2/5B2/2P5/PP3PPP/3RR1K1/w Rd1xBd5!? (Krogius_EofCM) #1287 white_wins 7r/3qbk1r/3p1n2/p1pPp1p1/Pp1nPpP1/1P1Q1P1B/1NP3K1/R3B2R/b Nf6xPg4!? (Krogius_EofCM) #1288 black_wins r2qn1k1/1p1b3p/2pp1b2/6pQ/p1P1P3/P1N3PB/1P6/3R1R1K/w Rf1xBf6!? (Krogius_EofCM) #1289 white_wins 2rq3r/5p2/p3pkbQ/3p4/3N4/2P4R/P4PP1/4R1K1/w Rh3f3+ (Krogius_EofCM) #1290 white_wins r4k1r/pp2pp2/3p1b2/q2PnQpp/3N4/1BP3P1/PP3PP1/3RR1K1/w Re1xNe5!? (Krogius_EofCM) #1291 white_wins 5rk1/2p3pp/p1p4r/2P1p3/3pPnq1/1P3R1P/PN1Q3K/R5N1/b Qg4xRf3 (Krogius_EofCM) #1292 black_wins r1b3rk/pp1n3p/2p2b1n/4pp1q/2P5/1P3NPP/PBQ1NPB1/3RR1K1/w Rd1xNd7!? (Krogius_EofCM) #1293 white_wins 2r2rk1/p3p1bp/3qP1p1/1Q1p4/P4P2/3R4/1P4PP/2B2RK1/b Rc8xBc1 (Krogius_EofCM) #1294 black_wins r3r1k1/4pp1p/b5pB/q1pP4/3b4/2N4P/PP4P1/R2RQ2K/w Rd1xBd4!? (Krogius_EofCM) #1295 white_wins 1r6/3b1pk1/pr1p1q1p/2pPb1p1/2B1P1P1/2N2PP1/1PQ3K1/RR6/b Rb6xPb2!? (Krogius_EofCM) #1296 black_wins 2r2rk1/5ppp/1p2p3/p7/1n1R4/P1NnPN2/1P3PPP/1R4K1/b Nd3xPb2 (Krogius_EofCM) #1297 black_wins 2r3k1/p1r1ppb1/2bp1np1/q5N1/1p1BP2Q/3P4/PP2N1PP/2R2R1K/w Bd4xNf6!? (Krogius_EofCM) #1298 white_wins r3r1k1/p4ppp/2pp1b2/8/q2n1P2/2BQ3P/PPP3P1/1K1R2NR/b Re8e3!? (Krogius_EofCM) #1299 black_wins rn1kr3/pppb4/3p1q2/3P1pNn/2P2P1p/1P2Q2P/P2NR1B1/4R1K1/w Qe3xRe8+!? (Krogius_EofCM) #1300 white_wins r2q1rk1/ppp1b1pp/1nn1p3/4P3/2PP4/2N1B2P/PP1Q4/2KR1B1R/b Rf8xBf1!? (Krogius_EofCM) #1301 black_wins r3k3/1pqb1p2/p3p3/4n2r/3N1Q2/2P5/PP4B1/4RRK1/w Re1xNe5!? (Krogius_EofCM) #1302 white_wins 1rb2bk1/q4r2/pB1p1nn1/3Pp3/N3PpP1/8/1PQ1BNP1/R1R3K1/b Rb8xBb6!? (Krogius_EofCM) #1303 black_wins 2rbr2k/1pq2ppp/p3bn2/4p1B1/P3P3/2N3Q1/1PP1B1PP/3R1R1K/w Rd1xBd8!? (Krogius_EofCM) #1304 white_wins r4rk1/5p2/p1b1pQpq/8/1B2P3/2NR4/PPP3PP/1K6/w Rd3d5!? (Krogius_EofCM) #1305 white_wins 3nr1k1/p6p/2n1pRpB/3pP3/2pP2P1/q1P4P/6BK/5Q2/w Rf6xPg6+!? (Krogius_EofCM) #1306 white_wins 2rr2k1/5ppp/p1b1pn2/q1p5/P1B1PQ2/R1PN1P2/6PP/1R4K1/b Rd8xNd3!? (Krogius_EofCM) #1307 black_wins 1r2r1k1/1pqb2pp/p2bp1n1/2p3BQ/3pN3/1P1P2P1/P1P3BP/4RRK1/w Bg5d8!? (Krogius_EofCM) #1308 white_wins 1k2rb1r/pbp1q1pp/2pp4/2PnpP2/Q7/1P3NP1/PB5P/2KR1B1R/w Rd1xNd5!? (Krogius_EofCM) #1309 white_wins 7k/p1p1r2p/1p1pnr1q/5pp1/2PPPp2/2PB1P1P/P2Q1PRK/7R/b Pg5g4!? (Krogius_EofCM) #1310 black_wins 5qk1/p4p2/1p3Pp1/2p4Q/3rr3/7R/PP6/6RK/b Re4h4!? (Krogius_EofCM) #1311 draw 5r1k/5Bb1/3p2Pp/p1pP4/1p2Q3/4P1P1/q7/3K3R/w Rh1xPh6+!? (Krogius_EofCM) #1312 white_wins 2b4B/1pp2k2/1p6/3P3n/5p1P/1P4p1/P2r2P1/R5KR/b Pf4f3!? (Krogius_EofCM) #1313 black_wins r3k2N/pppbq1pp/5n2/3Ppn2/2BP4/2P3bP/PP2Q1P1/RNB2K1R/b Bg3h2!? (Krogius_EofCM) #1314 black_wins r2q1r2/p1pbppbk/1p3npp/n2P2B1/7Q/2NB1N2/PPP3PP/4RRK1/w Pd5d6!? (Krogius_EofCM) #1315 white_wins 5n2/3bp1r1/1r1p3k/p1p2pNp/1nP2P1P/1PN1PB1K/P5R1/6R1/w Ng5f7+!? (Krogius_EofCM) #1316 white_wins r3bb2/P1q3k1/Q2p3p/2pPp1pP/2B1P3/2B5/6P1/R5K1/w Bc3xPe5+!? (Krogius_EofCM) #1317 white_wins r1b1qbk1/7p/4p1p1/1p2Bp2/p1B2Q2/P3P3/1P3PPP/3R2K1/w Be5c3!? (Krogius_EofCM) #1318 white_wins 2r1k2r/3b1pb1/p2ppp2/2q2P2/2p1P2p/P1N2N2/1PP1Q1PP/3R1R1K/w Pe4e5!? (Krogius_EofCM) #1319 white_wins 3r1rk1/1pq1bppp/p7/n2RN3/P7/1P6/1B2QPPP/R5K1/w Ne5d7!? (Krogius_EofCM) #1320 white_wins q1r3k1/2r4p/2p3pP/2Qp1p2/PRn5/4P1P1/5PB1/1R4K1/w Rb4xNc4!? (Krogius_EofCM) #1321 white_wins r3bknr/1p4pp/p3Q3/q4pb1/P1Bn4/8/1PP2PPP/R1B1R1K1/w Qe6d6+!? (Krogius_EofCM) #1322 white_wins r1b1nrk1/p2n3p/2pp4/8/2P2q1N/1PB4P/P4PB1/R2QR1K1/w Bg2d5+!? (Krogius_EofCM) #1323 white_wins 7k/5rp1/p1bQB2p/1p4nN/4P3/1Pq5/P5PP/3R3K/b Bc6xPe4!? (Krogius_EofCM) #1324 black_wins r4r1k/1bq4p/p4bp1/3pn3/NP6/Q1PBB2P/6P1/3R1RK1/b Pd5d4!? (Krogius_EofCM) #1325 black_wins r2r2k1/1bq2pb1/6pp/2P1p3/1nBpN2N/6PP/2Q2P2/3RR1K1/w Ne4f6+!? (Krogius_EofCM) #1326 white_wins r3rbk1/p1q2pp1/1n5p/2pp4/4N3/1PQ3P1/PB2PP1P/3R1RK1/w Ne4f6+!? (Krogius_EofCM) #1327 white_wins 2k1r3/Qp3pb1/2p4p/6q1/8/1P4PN/PBPn1P2/K2R4/b Qg5e5!? (Krogius_EofCM) #1328 black_wins r3r1k1/1pp2p1b/7p/2Q5/2PP2p1/2P1NpPq/P2R1P1P/6RK/b Re8xNe3!? (Krogius_EofCM) #1329 black_wins 5bk1/5p1p/Q5p1/1B4n1/8/2q1p3/6PP/3R2K1/b Pe3e2!? (Krogius_EofCM) #1330 black_wins r5k1/1p3pp1/1p3q1p/1P1bQ3/P2P3n/8/3B1PPP/R3R1K1/b Nh4f3+!? (Krogius_EofCM) #1331 black_wins 2k2r1r/1pp1nqbp/p2p1p2/5P2/2PBN3/1P3Q2/1P4PP/R4RK1/w Ra1xPa6!? (Krogius_EofCM) #1332 white_wins r5kr/p3PR1p/1p1p2pq/4n3/8/3B4/P4QPP/4R1K1/w Re1xNe5!? (Krogius_EofCM) #1333 white_wins 2bq1b2/1p3k2/1r1p1p1p/pNpP1PpP/P1P3P1/6B1/1P5Q/2K1R3/w Re1e6!? (Krogius_EofCM) #1334 white_wins 2kr3r/pp3p1p/2b1p3/q3Q3/5P2/2P1B3/P1P3PP/1R3RK1/b Rh8g8 (Krogius_EofCM) #1335 black_wins 2br1rk1/2qnQ2p/p4pp1/4p3/P1p1P1N1/2Pn1N1P/2B2PP1/1R1R1K2/w Rd1xNd3!? (Krogius_EofCM) #1336 white_wins 2r2nk1/6pp/p1rPqp2/1pP1p3/1P6/2B3R1/1P2Q1PP/5RK1/w Rf1xPf6!? (Krogius_EofCM) #1337 white_wins 3r2k1/pb3p1p/1q4p1/2b1P3/1Pp5/2P1p1P1/P3Q1BP/R1B4K/b Qb6c6!? (Krogius_EofCM) #1338 black_wins r2rnbk1/pp3ppp/1q4n1/3p1N2/5P2/1PQB4/PBP3PP/4RR1K/w Nf5h6+!? (Krogius_EofCM) #1339 white_wins r3nrk1/p1pb1qpp/3p1p2/2pP1N2/2P1PR2/P1PB4/4Q1PP/5RK1/w Pe4e5!? (Krogius_EofCM) #1340 white_wins r1b2rk1/pp2qp2/2nRp1p1/6Pn/1Pp5/P1N1P3/1BQ2PP1/2K2B1R/w Rh1xNh5!? (Krogius_EofCM) #1341 white_wins 5rr1/pp1kq1bp/2bppn2/2p3B1/4N3/2NP2P1/P1P4P/R3QRK1/b Nf6xNe4!? (Krogius_EofCM) #1342 black_wins 1r1q1k2/R4pp1/5p1r/1p1p1n1p/3Pb2N/1BP5/2P1Q1PP/4R1K1/w Qe2xBe4!? (Krogius_EofCM) #1343 white_wins R2b2k1/2rq1n1p/3p2p1/1p1Ppp1n/1P6/1B1PQN1P/1B3PP1/6K1/w Nf3xPe5!? (Krogius_EofCM) #1344 white_wins r1b3kr/bp3ppp/p1nNp3/4P3/P1Q2P2/BBP5/5qPP/R2R3K/w Nd6xBc8 (Krogius_EofCM) #1345 white_wins 6k1/5rb1/6pp/1p2p3/2b5/4B1P1/r4PBP/1RR3K1/w Rc1xBc4!? (Krogius_EofCM) #1346 white_wins 4r1k1/1p5p/5ppP/1qnP4/r4R2/P6P/1B1Q2K1/5R2/w Rf4xPf6!? (Krogius_EofCM) #1347 white_wins r2q1rnk/1p1bb1pp/p2p4/3NP1P1/P2Bp3/3Q3R/1PP1B2P/6RK/w Pe5e6!? (Krogius_EofCM) #1348 white_wins r4rk1/1b4bp/p1npq1P1/R3p3/8/1N2BP2/1PPQ2P1/4KB1R/w Qd2xPd6!? (Krogius_EofCM) #1349 white_wins 6k1/pbq2pp1/4r2p/8/3prb2/1P1Q3P/PN2BPP1/3RRK2/b Bf4d2!? (Krogius_EofCM) #1350 black_wins 6k1/2p3p1/2b4p/p4P2/2pR2PK/2P1r2P/1B6/8/b Bc6g2 (Krogius_EofCM) #1351 black_wins r1b2rk1/pp2ppbp/2np1np1/q7/4P3/2N1BN2/PPPQBPPP/2KR3R/b Nf6xPe4!? (Krogius_EofCM) #1352 black_wins 3r1rk1/p1q4p/1p3bp1/3bnp2/3B4/1NPB3P/P1PQ2P1/1R2R2K/b Ne5f3!? (Krogius_EofCM) #1353 black_wins r2q1rk1/p5pp/bn1p1p2/2pP4/1bP1NP2/3B1R2/PBQ3PP/R5K1/w Ne4g5!? (Krogius_EofCM) #1354 white_wins 1r1q2k1/7p/2p3p1/1P1n1b1r/2BQ4/4B3/P6P/1R3RK1/w Pb5xPc6!? (Krogius_EofCM) #1355 white_wins r3kbnr/1ppb3p/p1q1pp2/3p4/3P4/2N2N2/PPP2PPP/R1BQ1RK1/w Nf3e5!? (Krogius_EofCM) #1356 white_wins r1b1qbk1/pp3r1p/2pR1np1/5p2/2P1pP2/1PN1Q1PP/PB2P1B1/5RK1/w Rd6xNf6!? (Krogius_EofCM) #1357 white_wins 3rr1k1/1p1qb2p/pP4p1/2p2p2/4RQ2/3P4/1PPB2PP/4R1K1/w Bd2c3!? (Krogius_EofCM) #1358 white_wins 2b2r2/rpp2pkp/3pq3/2pR2P1/2n1P1N1/2P2B2/1P3Q1P/1K5R/b Qe6xRd5!? (Krogius_EofCM) #1359 black_wins 6k1/rnqb3p/5ppQ/2pPp3/p1N1P3/2PB3P/5PP1/1R4K1/w Pf2f4 (Krogius_EofCM) #1360 white_wins 7r/pp4k1/3pn1p1/q1pB1b2/2P5/5NR1/1P3PP1/2Q3K1/w Pb2b4!? (Krogius_EofCM) #1361 white_wins 5r2/4prkp/3q2p1/2pP1n2/N1Q2R2/1P4PP/P5K1/4R3/b Pg6g5!? (Krogius_EofCM) #1362 black_wins B1b1rbk1/5ppp/pq6/1p2n3/2p2P2/6PP/PPQ4K/R1BR4/b Ne5g4+!? (Krogius_EofCM) #1363 black_wins 8/2R4p/2R3bk/8/5N1P/1p3PP1/2pqP1K1/8/w Pg3g4!? (Krogius_EofCM) #1364 white_wins 6k1/p4p1p/3p1p2/2p1r3/2Pnr1N1/P6P/1P1Q1PP1/3R1RK1/b Nd4e2+ (Krogius_EofCM) #1365 black_wins 1kqr3r/p1p4p/RpQP4/2P1p3/4B3/4Bp2/P4P1P/6K1/b Rd8g8+ (Krogius_EofCM) #1366 black_wins 6k1/3Q1pp1/4p2p/p2pP3/1p1P2P1/nP3N2/q1r2PKP/8/w Qd7e8+ (Krogius_EofCM) #1367 white_wins 6k1/5pp1/p5r1/3Np2q/4P2p/1r3P1Q/n4P1P/3R2RK/w Rg1xRg6 (Krogius_EofCM) #1368 white_wins nr2rb2/3q1kpp/3p4/pnpPpNBP/2N1P3/3Q4/PP3P2/2K3RR/w Nf5h6+!? (Krogius_EofCM) #1369 white_wins r3k1r1/1pp2ppp/pb1p1qn1/4p2b/2B1P3/N1PP1NPP/PP2QPK1/R4R2/b Ng6h4+!? (Krogius_EofCM) #1370 black_wins 1n2n1r1/r3qppk/p2p3p/3PpP1P/1P2P3/3B2RQ/3B1P1K/6R1/w Bd2xPh6!? (Krogius_EofCM) #1371 white_wins r2b4/pb2q1k1/np1p2r1/1N1Pp2Q/PPN1Pp2/8/2R2BPp/2R4K/w Nc4xPd6!? (Krogius_EofCM) #1372 white_wins r7/2qnb1kp/p2p1nP1/1p1Pp1p1/6N1/3BB2Q/PPP4P/5RK1/w Qh3xPh7+!? (Krogius_EofCM) #1373 white_wins n1rqk3/1p2p3/1n1pP1p1/pP1P1p1r/3B3P/1BN3p1/3Q4/R3K2R/w Qd2g5!? (Krogius_EofCM) #1374 white_wins rn2kr2/pp1b1pQp/3Pp3/qB1n4/3N4/P7/1PP2PPP/2KR3R/w Nd4xPe6!? (Krogius_EofCM) #1375 white_wins 3r1r2/1b4bk/p1n3pp/1p2p3/4P3/q1P1QNB1/B4RPP/5RK1/w Bg3h4 (Krogius_EofCM) #1376 white_wins r1r3kb/1pqbpp2/p2p1npB/n7/3NP3/1BN2P2/PPPQ2P1/2KR3R/w Bh6f8!? (Krogius_EofCM) #1377 white_wins 4rr1k/pbp3bp/3p4/1p5q/3n4/1B1Q2B1/PP1N1N1P/4RRK1/b Rf8f3!? (Krogius_EofCM) #1378 black_wins r3k2r/pp2ppbp/1qp5/2n2b2/2P5/4BN2/PP1QBP1P/2KR3R/b Nc5b3+!? (Krogius_EofCM) #1379 black_wins 4qn1k/1b3rpp/pb2pB2/1pp1P2P/3p1NQ1/P2P2PB/1PP4K/5R2/w Nf4g6+!? (Krogius_EofCM) #1380 white_wins 2b5/2qrrpk1/5Rp1/2p4p/1pB1PR1P/1P1P2P1/5Q1K/8/w Qf2b2 (Krogius_EofCM) #1381 white_wins 2r3k1/n3qppp/1B1r1n2/N7/N4P2/1Q4PP/P5B1/R1b4K/b Qe7e1+ (Krogius_EofCM) #1382 black_wins 7r/2p1q1k1/1p3r1p/p1pPpPp1/2P1P1P1/PP6/3Q2KR/7R/w Qd2xPg5+!? (Krogius_EofCM) #1383 white_wins rnb2k2/ppbp2p1/2p2pB1/8/1PN5/2P5/P4PPP/R1B3K1/w Bc1f4!? (Krogius_EofCM) #1384 white_wins 2k5/1p1b4/2n1p1r1/7q/4RP2/3BQN2/2P2K1P/8/w Pf4f5!? (Krogius_EofCM) #1385 white_wins 2k3r1/1ppr3p/p1pB2q1/6n1/N3Pp2/8/PPP1Q1PP/3R1RK1/b Pf4f3!? (Krogius_EofCM) #1386 black_wins r3q2r/2p1k1p1/p5p1/1p2Nb2/1P2nB2/P7/2PNQbPP/R2R3K/b Rh8xPh2+!? (Krogius_EofCM) #1387 black_wins 6r1/6rk/3p3p/p2Rp3/R1PqPp1b/2N2Q2/6PP/7K/b Rg7xPg2!? (Krogius_EofCM) #1388 black_wins 4r1k1/1p2rq1p/2bQpp2/p1Pp4/3P4/P3RN2/5PPP/4R1K1/w Nf3e5!? (Krogius_EofCM) #1389 white_wins b2b1r1k/3R1ppp/4qP2/4p1PQ/4P3/5B2/4N1KP/8/w Pg5g6!? (Krogius_EofCM) #1390 white_wins 1k4q1/1p2Rprp/p1p5/2Pp4/1P1Q3P/6P1/P5K1/8/w Qd4e5+ (Krogius_EofCM) #1391 white_wins r2r3k/ppq3pp/2p1n3/4NQ2/3P4/1B6/PP3PPP/6K1/w Ne5g6+!? (Krogius_EofCM) #1392 white_wins r4r1k/p2bN2p/1p1p1p2/2q4P/3Q4/1P6/1PP3P1/1K2R2R/w Ne7g6+!? (Krogius_EofCM) #1393 white_wins 2kr3r/p5b1/Pp2R1p1/2q2p1p/2p2Pn1/2P2BP1/1PQB2P1/5R1K/b Ph5h4 (Krogius_EofCM) #1394 black_wins r1b2k1r/1p2qp2/pN1p1n2/2pP2pp/P2bP1P1/2N5/1P2BPP1/R2Q1RK1/b Ph5xPg4!? (Krogius_EofCM) #1395 black_wins 6nk/p4rrp/1p1p1p2/1q1Pp2R/4B1P1/1PP2Q1R/P6P/7K/w Pg4g5!? (Krogius_EofCM) #1396 white_wins r1b1k2r/6pp/p1p1p3/3np1B1/1b2N3/8/q1PQB1PP/3RK2R/w Qd2xBb4!? (Krogius_EofCM) #1397 white_wins 3qrbk1/1r3p2/p1bp1Pp1/1p2p1Pp/4P2R/1P2BB1Q/P1P4P/R6K/w Bf3xPh5!? (Krogius_EofCM) #1398 white_wins 2r3k1/4qpp1/2p1r3/pbQpN1Pp/3P1P1P/4P3/PP6/1KR3R1/w Qc5xBb5!? (Krogius_EofCM) #1399 white_wins 4r2k/p2Q3p/2p1r1pR/4NpR1/3P4/2P1PP1b/P4q1P/6RK/w Ne5xPg6+!? (Krogius_EofCM) #1400 white_wins 4r1kb/p2r4/1np1p1p1/3nP1Bp/1p3P1R/1B2qP2/PPPN3Q/2K4R/w Rh4xPh5!? (Krogius_EofCM) #1401 white_wins 2rq2k1/pp1bpp1p/3p1np1/8/3NPPnQ/1BP5/P1P3P1/1K1R3R/w Pe4e5!? (Krogius_EofCM) #1402 white_wins r1b3k1/3nqp1p/p1n1p1pP/3pP1N1/Pp3QN1/1Pr3P1/2PR1P2/4RBK1/w Rd2xPd5!? (Krogius_EofCM) #1403 white_wins 2r1kr2/p1qbbp1Q/3pp3/5p2/1p1N1PB1/6P1/PPP4P/K2RR3/w Bg4xPf5!? (Krogius_EofCM) #1404 white_wins r6k/ppr1qpp1/4n2p/3pP3/3P2R1/2pBQ2P/P5PK/5R2/w Rf1f6!? (Krogius_EofCM) #1405 white_wins 2rr2k1/5pn1/1b2q1pp/pP1pP3/2pP1PP1/2R1B2P/2Q3B1/3R3K/w Pf4f5!? (Krogius_EofCM) #1406 white_wins 2Q2bkr/5p2/1rb5/1pN1n1qB/1P1pPN2/6P1/5P2/R1R3K1/w Nc5e6!? (Krogius_EofCM) #1407 white_wins 2r4r/1q1kb1p1/4p2p/3pP3/np6/3RBP2/NPP2Q1P/1K2R3/b Na4c3+!? (Krogius_EofCM) #1408 black_wins 2r4r/3bk1b1/1q2pp2/3pPp1p/1p1N1P1P/1P1R1BP1/P2Q4/1K1R4/w Nd4xPf5+!? (Krogius_EofCM) #1409 white_wins 1rb3k1/2r2pbp/p2q1npn/P1pPp1N1/2B1P3/2P1B1NP/5QP1/3R1RK1/w Ng5e6!? (Krogius_EofCM) #1410 white_wins r7/pp4pk/2n3qp/5p2/3p4/P4QB1/1PP1RPPP/6K1/b Pd4d3!? (Krogius_EofCM) #1411 black_wins 2r2r1k/1p3p1p/p2p1Pp1/3Pp3/1q2Bn1Q/8/1PP3PP/4RR1K/w Rf1xNf4!? (Krogius_EofCM) #1412 white_wins r4rk1/5ppp/p7/4PR2/P1qnp2Q/4B3/1P4PP/5RK1/w Rf5h5 (Krogius_EofCM) #1413 white_wins 4r3/pb3pk1/6p1/8/6P1/1PNrB2K/P4P1P/2R5/b Re8xBe3+!? (Krogius_EofCM) #1414 black_wins 1r3kr1/p3q1b1/3p2Q1/2p2p2/2P2N2/4Pn2/PB6/K2R3R/w Nf4e6+!? (Krogius_EofCM) #1415 white_wins 5r1k/6bp/3p1q2/3Q1nP1/8/6P1/PP3BKP/R2N4/b Nf5e3+!? (Krogius_EofCM) #1416 black_wins 1r1q1k1r/Q4ppp/2B2n2/8/Pbbp4/1P4P1/2PP1P1P/R1B1K2R/b Qd8e8+!? (Krogius_EofCM) #1417 black_wins 5rk1/p1p1R1p1/1p5p/8/2pP1P2/3n2P1/PP2Q2P/5KNq/b Nd3xPf4!? (Krogius_EofCM) #1418 black_wins r5k1/1N3ppp/4b3/1Nq5/Pn3pn1/5B2/1PPQ3P/R6K/b Qc5xNb5!? (Krogius_EofCM) #1419 black_wins 1r2k2r/1bq2pp1/pn2p2p/1p2P1b1/3N4/2N3Q1/PPP3PP/1K1R1BR1/w Bf1xPb5+!? (Krogius_EofCM) #1420 white_wins r1bqn1r1/p2k1pp1/1p5p/n1pPpN2/2P1P3/P1PBB2P/4Q1P1/R4RK1/w Nf5xPh6!? (Krogius_EofCM) #1421 white_wins 2r2r2/p4p1k/1p2pBpn/2p5/6N1/8/P4P2/R3R1K1/w Kg1g2 (Krogius_EofCM) #1422 white_wins r4rk1/p1p2pp1/bp1p1q1p/n1nPpN2/2P1P2P/2PB4/P2BQPP1/R3K2R/w Bd2g5!? (Krogius_EofCM) #1423 white_wins 3rn1k1/pp3ppp/6b1/2p1Q3/2P1P3/P4P2/1B1qBP1P/1R5K/w Rb1d1!? (Krogius_EofCM) #1424 white_ahead 4r1k1/5ppp/p1q3b1/1ppNr3/2P1P3/1P4QP/P4PP1/4RRK1/w Pf2f4!? (Krogius_EofCM) #1425 white_wins 2kr2r1/2pqbp1p/p1n1b3/1P1pP3/4n3/1BP1BN2/1P4PP/RN1Q1RK1/b Be6h3 (Krogius_EofCM) #1426 black_wins 2b3k1/5qp1/p2r1n1p/3p4/3B4/1RP3QP/P2Nr1P1/3R2K1/b Nf6e4!? (Krogius_EofCM) #1427 black_wins 6k1/5rp1/4Nb1p/2p5/4Q3/1r5P/q5P1/3R1R1K/w Rf1xBf6!? (Krogius_EofCM) #1428 white_wins 1r2r1k1/p4ppb/q1pbnn1p/4p3/N1P1P3/pPB2NP1/2Q1RPBP/R5K1/b Nf6xPe4!? (Krogius_EofCM) #1429 black_wins r4r2/1pnqb2k/3p1p1p/p1pPpPpP/2P1N1P1/4BP2/PP1Q4/R2R2K1/w Be3xPc5!? (Krogius_EofCM) #1430 white_wins rnb3kr/ppp2ppp/1b6/3q4/3pN3/Q4N2/PPP2KPP/R1B1R3/w Ne4f6+!? (Krogius_EofCM) #1431 white_wins 6kr/1p1r1p1p/p2pnPpQ/3Np2R/2q1P3/5P2/PPP5/2KR4/w Rh5xPe5!? (Krogius_EofCM) #1432 white_wins 3Rq1k1/1pp1Ppbp/r1b3p1/p7/P1N5/1P4P1/1B2PP1P/2R3K1/w Nc4d6!? (Krogius_EofCM) #1433 white_wins r2q1rk1/pp1n2pp/2pb4/1P1p3n/P1PPpP2/4P2b/1BNNBP1P/R2QR1K1/b Nh5xPf4!? (Krogius_EofCM) #1434 black_wins rq1r2k1/3nbp1p/p2p2p1/1p1Pp1P1/3B1P2/3B3Q/PPP4P/2KR2R1/w Pf4f5!? (Krogius_EofCM) #1435 white_wins r4rk1/1bq1bppp/8/p2pPR2/3B4/1NnP3Q/1P4PP/4R1K1/w Rf5h5!? (Krogius_EofCM) #1436 white_wins r4rk1/1nqb1pbn/6pB/pppPp2p/8/1PP2NNP/P1BQ2P1/R4RK1/w Ng3xPh5!? (Krogius_EofCM) #1437 white_wins r1b2rk1/pp4bp/2p3p1/4q2n/NQPN1p1P/1P5n/P3PPB1/2BRRK2/b Pf4f3!? (Krogius_EofCM) #1438 black_wins 4rqk1/p5b1/3p3p/3Pn1p1/1pP1NrP1/4NP2/P3Q1P1/1K1RR3/b Ne5xPf3!? (Krogius_EofCM) #1439 black_wins r2qkr2/1p3pQp/2p1b3/1B1pN3/1p6/8/1P1K1PPP/2B1R3/w Ne5xPc6!? (Krogius_EofCM) #1440 white_wins r3rk2/pb2bpp1/1n5p/q1pP1B2/1p3B2/5N2/PPQ2PPP/R2R2K1/w Bf5c8!? (Krogius_EofCM) #1441 white_wins r1bqr2k/ppp2p1p/5b2/3Pn1p1/1PP1Bp2/8/PB2N1PP/R2Q1RK1/w Ne2xPf4!? (Krogius_EofCM) #1442 white_wins 1q4k1/p3rppp/3b1n2/8/5P2/4P3/PP1B3P/RNQ3K1/b Bd6xPf4!? (Krogius_EofCM) #1443 black_wins r3k2r/1p1b1p2/p3p3/2b3p1/4N1n1/1B5P/PPP3P1/R1B2R1K/b Bd7c6 (Krogius_EofCM) #1444 black_wins r3kb1r/npqbpp1p/p3n1p1/P3P3/6N1/3B1NB1/1PP3PP/R3QRK1/w Nf3g5!? (Krogius_EofCM) #1445 white_wins 7k/p6p/4bppb/1N6/P2p1p2/1PrP2P1/2r1P2P/1R1Q2K1/b Pf4f3!? (Krogius_EofCM) #1446 black_wins 2kr4/pp1r1pp1/4n1p1/4R3/2Pp1qP1/3P2QP/5PB1/1R4K1/w Re5c5+!? (Krogius_EofCM) #1447 white_wins 3r1qk1/5p1p/4b1pP/1pRp4/1P1Q4/r5P1/5P2/4RBK1/w Re1xBe6!? (Krogius_EofCM) #1448 white_wins r2qkn1r/pb2bp2/1pp1p3/5p1p/2BPN3/5NQ1/PPP2PPP/1K1RR3/w Pd4d5!? (Krogius_EofCM) #1449 white_wins 2rr1nk1/pp2q1b1/4p1p1/5p2/1nB5/2B1N1QP/PP4P1/4RRK1/w Ne3xPf5!? (Krogius_EofCM) #1450 white_wins 3r3k/p4npp/1p2qpb1/4P3/5P2/P3N3/1B2QP1P/6RK/w Pe5xPf6 (Krogius_EofCM) #1451 white_wins 6rk/1b2bp1p/ppq1p3/2p1Pp2/P1Br1P2/1PNR2P1/2P1QK1P/6R1/b Rd4xPf4+!? (Krogius_EofCM) #1452 black_wins r3r1k1/p1q2pp1/b1pb3p/n7/B3n3/2P1BN2/PP1N1PPP/R2QK2R/b Ne4xPc3!? (Krogius_EofCM) #1453 black_wins 4qrk1/pp1bbppp/4pn2/2r1Q1B1/7P/2N3R1/PPP2PP1/2KR1B2/w Bg5xNf6!? (Krogius_EofCM) #1454 white_wins r5n1/pppb1B2/2k1pb2/3p2B1/5P2/2N5/PPP3P1/2KR4/w Nc3xPd5 (Krogius_EofCM) #1455 white_wins 2b2q2/r2n2kp/1n1p1pp1/p1pP4/1pP1NPN1/1P1B4/P5PP/Q3R1K1/w Ne4xPf6!? (Krogius_EofCM) #1456 white_wins 1k1r2r1/p1p3q1/2p2p2/3pn3/1P1b2bB/1QN5/P4PPP/1R2RBK1/b Ne5f3+!? (Krogius_EofCM) #1457 black_wins r3k2r/1bq1bp1p/p2p1np1/1p2p3/3NP3/P1N2QB1/1PP2PPP/3RR1K1/w Nd4xPb5!? (Krogius_EofCM) #1458 white_wins r2q4/5p1P/2p1bR2/ppk1p1P1/3pB2Q/8/PPP5/6K1/w Pg5g6!? (Krogius_EofCM) #1459 white_wins r3kb1r/pp1b1pp1/4p3/2q3Qp/5B2/2PB4/P4PPP/R3R1K1/w Re1xPe6+!? (Krogius_EofCM) #1460 white_wins 1rbr2k1/p4pp1/5b1p/2p1p3/3qPP2/1PNB2PP/PKP2Q2/5R1R/b Pc5c4!? (Krogius_EofCM) #1461 black_wins r3r1k1/p6p/bp4p1/2bPN3/6n1/6P1/PB2RPB1/3R2K1/w Pd5d6!? (Krogius_EofCM) #1462 white_wins 2bk3r/3r2pp/p2nQ3/q2R2P1/1p6/8/PPP2P1P/1K3B1R/b Qa5xRd5!? (Krogius_EofCM) #1463 black_wins 3r1k2/1q1r1pp1/3p2bp/p2N4/8/2P1RQ1P/P4PP1/4R1K1/w Nd5f6 (Krogius_EofCM) #1464 white_wins 3q3r/p2r1pkp/bp1N1np1/n2p4/5Q2/B1P5/P4PPP/R3R1K1/w Nd6f5+ (Krogius_EofCM) #1465 white_wins r4Nk1/1p2pp1p/p1np2p1/3N4/P3PPn1/8/1bPKBqPP/R2Q1R2/b Qf2d4+ (Krogius_EofCM) #1466 black_wins 1kb3rr/1p2n2q/1Np2p2/1p6/1P1N1P1p/8/2P1RQPP/R6K/w Nd4xPb5!? (Krogius_EofCM) #1467 white_wins r3r1k1/p3Rp1p/1qp1bQ2/8/1p1P4/3R4/PP3PPP/6K1/w Rd3g3+ (Krogius_EofCM) #1468 white_wins rn4k1/pp2rpb1/2pNb1pp/4p3/P3Pq2/2P2N1P/1PB1QPP1/R3R1K1/w Nd6f5!? (Krogius_EofCM) #1469 white_wins 3r1rk1/pp3ppp/8/2p5/4PB1n/P1P2qPP/Q3RP1K/6R1/b Qf3g2+!? (Krogius_EofCM) #1470 black_wins r4rn1/ppp1q3/2bp2kp/6P1/3QpP2/2N5/PPP1B3/2KR3R/w Pf4f5+ (Krogius_EofCM) #1471 white_wins 3qr2r/1p1bppk1/3p2p1/p1nP1PQp/3N3R/1P4PP/P1P3BK/4R3/w Nd4e6+!? (Krogius_EofCM) #1472 white_wins 2rq1rk1/1b1nbpp1/1p5p/p2pNB2/3p1N2/4P3/PPQ2PPP/2RR2K1/w Bf5h7+ (Krogius_EofCM) #1473 white_wins 8/5pkp/2pp2p1/4P3/1P2P3/2QBq2P/2PnNnPK/8/b Nd2f1+ (Krogius_EofCM) #1474 black_wins r3r2k/pb2q1p1/1p2Nn1p/2b5/2B5/2P2P2/PPQ3PP/4RR1K/w Ne6f4!? (Krogius_EofCM) #1475 white_wins r1b2nk1/ppq2ppp/8/1BP1p1NQ/5p2/8/PP3PPP/3R2K1/w Rd1d7!? (Krogius_EofCM) #1476 white_wins 6k1/5qp1/pN5p/3pRp2/3QnP2/2r4P/r5P1/6RK/b Qf7h5!? (Krogius_EofCM) #1477 black_wins 5r1n/r2q1pkp/3p1npN/NppPp2P/1P2P3/2P1Q1P1/5P2/R3K2R/w Nh6f5+!? (Krogius_EofCM) #1478 white_wins 6rk/p2b4/3p1Nqp/2pPpn2/P1P4p/5P1P/Q2B1NP1/6RK/b Nf5g3+ (Krogius_EofCM) #1479 black_wins r4r1k/pppb2pp/8/3q4/2N5/P1P2nQ1/BP2R2P/R6K/b Nf3e1+ (Krogius_EofCM) #1480 black_wins r5rk/1pp1n1pp/p1n1b1q1/3p1p2/7R/2QB1N2/PB3PPP/4R1K1/w Re1xBe6!? (Krogius_EofCM) #1481 white_wins 8/4Ppk1/6p1/1p6/1Pb1Q3/6pq/8/6K1/w Qe4e5+ (Krogius_EofCM) #1482 draw 3R4/4Qpk1/4p1p1/7p/7K/5rP1/5P2/2q5/w Qe7f8+ (Krogius_EofCM) #1483 draw 8/5pk1/p6p/2R5/3q2p1/6P1/2Q3PK/4r3/w Rc5g5+!? (Krogius_EofCM) #1484 draw 1Q4R1/8/P1b2p2/2p2k2/2P5/5p2/1r5P/4R1K1/b Pf3f2+ (Krogius_EofCM) #1485 white_ahead 5r1k/1q2R3/8/6Q1/8/8/6P1/7K/b Rf8f1+ (Krogius_EofCM) #1486 draw 8/4p3/8/3P3p/P2pK3/6P1/7b/3k4/w Pd5d6!? (Krogius_EofCM) #1487 draw 3Q4/k3K3/q7/2N1P3/1P6/5r2/8/8/b Rf3f7+!? (Krogius_EofCM) #1488 draw 3k4/p1p5/8/2p1p3/4P3/PpPP2K1/1P6/8/b Pc5c4!? (Krogius_EofCM) #1489 draw 6r1/5p1k/4p3/3pQp2/1p1P1P1q/1P3RR1/7r/5K2/w Rg3xRg8 (Krogius_EofCM) #1490 draw r1b2rk1/ppp2ppp/2n3q1/b2N2N1/2BP4/4p2P/PPP3P1/R2Q1RK1/w Ng5xPf7!? (Krogius_EofCM) #1491 white_wins 1r4k1/3qb2p/pr1pppn1/2p2N2/2P2PQ1/1P4P1/P2R2B1/R5K1/w Bg2d5!? (Krogius_EofCM) #1492 white_wins r6r/pR1nqkpp/2p1p3/3p4/6Q1/2b4P/P1PP1PP1/2B1R1K1/w Re1xPe6!? (Krogius_EofCM) #1493 white_wins 1k1r3r/ppq2pnp/1npbb1p1/3p4/3P1NP1/2NBP2P/PPQ2P1B/1KR4R/w Nc3b5!? (Krogius_EofCM) #1494 white_wins 5rk1/p1p1br2/1p1p2qp/4p3/2PPn1pP/3Q2P1/PPN1P1K1/2RR2B1/b Be7xPh4!? (Krogius_EofCM) #1495 black_wins r5r1/4q2k/p2p3p/5p2/4p3/P2QR3/1PP2PPP/4R1K1/w Re3xPe4!? (Krogius_EofCM) #1496 white_wins r1b2rk1/4bnpp/2p5/pp2q3/4N3/PQ2B1P1/1PP3BP/4RRK1/w Ne4g5!? (Krogius_EofCM) #1497 white_wins 2rr2k1/1p3p2/p2n2p1/P2PnNq1/3QP1p1/1RN5/6PP/5RK1/b Ne5f3+!? (Krogius_EofCM) #1498 black_wins r3k1r1/pb1qpp1p/1pnp1n1B/2p2R2/3PP3/2P3PN/P1P3BP/R2Q3K/b Nf6xPe4!? (Krogius_EofCM) #1499 black_wins 2r2rk1/pp2bppp/3q1n2/3nNRB1/3P4/1B5Q/PP4PP/3R2K1/w Ne5xPf7!? (Krogius_EofCM) #1500 white_wins r1bq1rk1/1pp2ppn/1pnp3p/3N4/2B1PN2/3P4/PPP3PP/R2Q1RK1/w Nf4g6!? (Krogius_EofCM) #1501 white_wins r1b2rk1/pp3p1p/2pq2pn/2nNN3/2B1QP2/8/P1PP2PP/R1B1K2R/w Ne5xPf7!? (Krogius_EofCM) #1502 white_wins 1r2r1k1/1bn2pbp/pp1q1np1/2pPN1B1/P1B5/2N4P/1P1Q1PP1/R3R1K1/w Ne5xPf7!? (Krogius_EofCM) #1503 white_wins 1rb2bk1/2n2qp1/p2p3p/R1pP1p2/2B5/1PBQ1N1P/2P2PP1/6K1/w Ra5xPc5!? (Krogius_EofCM) #1504 white_wins r1b3k1/2pq2pp/p4p2/1p1Nr3/2n2R2/1B6/PPQ2PPP/R5K1/w Rf4xNc4!? (Krogius_EofCM) #1505 white_wins 2rq1rk1/3bbppp/p3pn2/1p1pN3/2nP1B2/P1NBP2Q/1P3PPP/2R2RK1/w Nc3xPd5!? (Krogius_EofCM) #1506 white_wins 2r1r1k1/pp1b1ppp/1q6/3P4/7N/Pn1Q4/1P3PPP/1RB2RK1/b Nb3xBc1 (Krogius_EofCM) #1507 black_wins 1r4nk/3b2bp/3p4/3P3p/2pNPq2/P1N2p1P/1P3Q2/1R4KR/b Rb8xPb2!? (Krogius_EofCM) #1508 black_wins 2r5/p3kpp1/P2p4/1P2pP1p/1P2PqnP/6R1/r2N2P1/3RQ1K1/b Ra2xNd2!? (Krogius_EofCM) #1509 black_wins 2br2k1/1p2qppp/r1n1p3/pQ1nN3/P2P4/2B3P1/1P3PBP/2RR2K1/w Qb5xRa6!? (Krogius_EofCM) #1510 white_wins 5rk1/3q2bp/3pb2r/1p1n1p2/3p1P2/P2B1QN1/1P1B2PP/2R1R1K1/w Ng3xPf5!? (Krogius_EofCM) #1511 white_wins 4r1k1/1ppQr1p1/1p1p1pP1/3P3p/8/1P3q2/P1P5/1KRR4/w Rd1e1!? (Krogius_EofCM) #1512 white_wins 2Rr2k1/7p/4pqp1/p4p2/1p1P1Q1P/8/PP3PP1/6K1/w Qf4e5!? (Krogius_EofCM) #1513 white_wins 4r1kb/5p1p/6pB/3Np3/4n3/P3Q1PP/2q2P2/R5K1/w Ra1c1 (Krogius_EofCM) #1514 white_wins 5rk1/bp4p1/p2rp2p/8/8/2PN4/PP1R1PPP/3R2K1/b Pe6e5!? (Krogius_EofCM) #1515 black_wins 2q1rk2/QR3ppp/1pPpb3/1P2p1b1/4P3/6P1/3N1PBP/6K1/w Bg2h3!? (Krogius_EofCM) #1516 white_wins n1bq3k/pp4bp/6p1/5pP1/3p1P2/1B1P4/PB3Q1P/4R1K1/w Bb2xPd4!? (Krogius_EofCM) #1517 white_wins r3r1k1/p2n4/3p1pp1/qnp3B1/1p2P1P1/1P3P2/PP2N2Q/1K1R1B2/w Ne2f4 (Krogius_EofCM) #1518 white_wins 6k1/pb3ppp/1p2p3/4P3/5P2/P1r5/1q4PP/1B2Q1RK/b Rc3c1!? (Krogius_EofCM) #1519 black_wins 2rq1kbR/4R1p1/3p3r/pp1P1Pp1/6P1/3B4/PPP1Q3/6K1/w Pf5f6!? (Krogius_EofCM) #1520 white_wins 2r5/5kb1/4ppp1/pp1qB3/2rP4/1RP2R1Q/P4PP1/6K1/b Rc8h8!? (Krogius_EofCM) #1521 black_wins 4k3/4Bp2/1p2nP1P/2p5/2K1b1B1/8/P7/8/w Bg4f3!? (Krogius_EofCM) #1522 white_wins 3rr1k1/ppp1qp1p/3b2p1/4np1P/1P1N1Pn1/P1P4R/1B1NB3/R2Q1K2/b Ne5f3!? (Krogius_EofCM) #1523 black_wins 1k1r3r/ppqb4/5Ppp/3p4/P2np3/3BR1Q1/2PB1PPP/R5K1/w Re3xPe4!? (Krogius_EofCM) #1524 white_wins r2q1rk1/pb1nbpp1/1pp1pn1p/3pN3/2PPP3/2N1B1P1/PP3PBP/R2Q1RK1/w Ne5xPc6!? (Krogius_EofCM) #1525 white_wins 8/2R2pbk/6pp/1p2pq2/1P2Qn2/3P3P/3B1PP1/r3N1K1/b Nf4xPd3!? (Krogius_EofCM) #1526 black_wins 2r2rk1/pp2pp1p/2np2p1/q4P2/2PBP1b1/2N5/PP1Q2PP/R4RK1/w Ph2h3!? (Krogius_EofCM) #1527 white_wins r2b1rnk/1p4qp/p1p1b1p1/2PpNp2/PP1PnP1Q/3BB2R/4N1PP/R6K/w Qh4xPh7+!? (Krogius_EofCM) #1528 white_wins r1b2rk1/1p3pbp/2p3p1/p1q5/1P6/1Q4P1/1P2PPBP/R1B1R1K1/b Bc8e6!? (Krogius_EofCM) #1529 black_wins 4r1k1/r1q2p1p/p5pB/1pbBpN1n/1n2P3/5Q2/PP3PPP/R1R3K1/w Rc1xBc5!? (Krogius_EofCM) #1530 white_wins r1r3k1/ppnbb1pp/2ppp1q1/1P3p2/P1PPn3/2N2NP1/2Q1PPBP/1RB2RK1/w Nc3xNe4 (Krogius_EofCM) #1531 white_ahead r1b1k2r/2q1bppp/p3p3/1p1nP1B1/3Q4/2N5/PPP1B1PP/2KR3R/w Bg5xBe7 (Krogius_EofCM) #1532 white_ahead 1rb1r1k1/p1p1qppp/2pb4/8/2P3n1/4P1P1/PB2BP1P/R1QN1RK1/b Ng4xPh2!? (Krogius_EofCM) #1533 black_wins 2rqk1nr/pp3ppp/2n1p3/2b5/3N4/2NQB1P1/PP2PPKP/R4R2/w Nd4xPe6!? (Krogius_EofCM) #1534 white_wins rnb2rk1/pp4pp/2pb1n2/3N1p1q/2P5/3N2P1/P1Q1PPBP/R1B2RK1/w Bc1f4!? (Krogius_EofCM) #1535 white_wins 8/8/1p1k4/5ppp/PPK1p3/6P1/5PP1/8/b Pf5f4!? (Krogius_EofCM) #1536 black_wins 8/5pp1/7p/5P1P/2p3P1/2k5/5P2/2K5/w Pf5f6!? (Krogius_EofCM) #1537 white_wins 7k/8/1p1ppp1p/1Pp5/2P2P2/8/3P2PP/6K1/w Pf4f5!? (Krogius_EofCM) #1538 white_wins 8/p5k1/2p2p2/4p1p1/1p2P3/1P4PP/1PP5/5K2/b Pg5g4!? (Krogius_EofCM) #1539 draw 8/5K2/kp6/p1p5/P2p4/1P3P2/2P5/8/b Pb6b5!? (Krogius_EofCM) #1540 black_wins 8/2k3p1/2p4p/5P2/2K3PP/8/8/8/w Pg4g5!? (Krogius_EofCM) #1541 white_wins 8/1kp1b3/1p4K1/4P2p/P1P3p1/5pP1/P4P2/4B3/b Ph5h4!? (Krogius_EofCM) #1542 black_wins 8/8/4b1p1/2Bp3p/5P1P/1pK1Pk2/8/8/b Pg6g5!? (Krogius_EofCM) #1543 black_wins 8/8/3K1k2/5p1p/4p1p1/4P1P1/5PP1/8/b Pf5f4!? (Krogius_EofCM) #1544 black_wins r1b5/p2k1r1p/3P2pP/1ppR4/2P2p2/2P5/P1B4P/4R1K1/w Bc2xPg6!? (Krogius_EofCM) #1545 white_wins 6r1/1p3k2/pPp4R/K1P1p1p1/1P2Pp1p/5P1P/6P1/8/w Rh6xPc6!? (Krogius_EofCM) #1546 white_wins 1k2b3/4bpp1/p2pp1P1/1p3P2/2q1P3/4B3/PPPQN2r/1K1R4/w Pf5f6!? (Krogius_EofCM) #1547 white_wins 2kr3r/ppp1qpp1/2p5/2b2b2/2P1pPP1/1P2P1p1/PBQPB3/RN2K1R1/b Rh8h1!? (Krogius_EofCM) #1548 black_wins 1r3qk1/pb3p1p/1pn2PpQ/2pN4/3r4/5B2/PPP4P/4RRK1/w Nd5e7+!? (Krogius_EofCM) #1549 white_wins 4r1k1/5p1p/3q2p1/1p1P4/1P6/2p4P/2Q1nPB1/4RK2/b Ne2g3+!? (Krogius_EofCM) #1550 black_wins 6k1/2q3p1/1n2Pp1p/pBp2P2/Pp2P3/1P1Q1KP1/8/8/w Pe4e5!? (Krogius_EofCM) #1551 white_wins 5r2/pp1RRrk1/4Qq1p/1PP3p1/8/4B3/1b3P1P/6K1/w Qe6xRf7+ (Krogius_EofCM) #1552 white_wins 6k1/1q2rpp1/p6p/P7/1PB1n3/5Q2/6PP/5R1K/w Pb4b5!? (Krogius_EofCM) #1553 white_wins r5r1/8/bRP1pk1p/3pNp2/5P2/7P/PR4P1/6K1/w Rb6xBa6!? (Krogius_EofCM) #1554 white_wins 3r2k1/p6p/b2r2p1/2qPQp2/2P2P2/8/6BP/R4R1K/w Ra1xBa6!? (Krogius_EofCM) #1555 white_wins 8/p3q1k1/6p1/1p3nP1/2pp1QBr/P2P4/1PP2K2/R7/b Qe7e3+!? (Krogius_EofCM) #1556 black_wins 7k/4b2p/5p1P/5PP1/1pNp1P2/1P1B4/2P2K2/r7/w Pg5g6 (Krogius_EofCM) #1557 white_wins 5r1k/1p1b2rP/p2p4/3P3B/P2P4/5pP1/1P2pP2/R3R1K1/b Rg7xPg3+!? (Krogius_EofCM) #1558 black_wins 6B1/2p2pp1/2p5/p3K3/1k6/nP4P1/5P1P/8/b Na3c4+!? (Krogius_EofCM) #1559 black_wins 3q1k2/5p2/p5pN/1b2Q2P/8/8/5PPK/8/w Qe5h8+ (Krogius_EofCM) #1560 white_wins 6k1/p3b1pp/4p3/4Pp2/Pp1r1P1P/1P4P1/2p2R2/5RK1/b Rd4c4!? (Krogius_EofCM) #1561 black_wins 4r2k/3n1Qpp/1pRP1p2/p4P2/1p1P2P1/6rP/P3q1B1/6RK/w Qf7e6!? (Krogius_EofCM) #1562 white_wins 2r2rk1/p1N2p1p/2P1p1p1/1Pp3q1/3b4/5Q2/P1P3PP/4RR1K/w Nc7xPe6!? (Krogius_EofCM) #1563 white_wins 3r1r2/pp1P3k/4Rbp1/1BP2p1p/8/7P/P4KP1/3R4/w Bb5a6!? (Krogius_EofCM) #1564 white_wins 3rr1k1/pppRn1pp/4Pp2/1P5q/1QB5/4P3/P4P1P/4K1R1/w Qb4xNe7!? (Krogius_EofCM) #1565 white_wins rn1q2k1/pp3pb1/3p2pp/2pP2N1/3r1P2/7Q/PP4PP/R1B2RK1/w Ng5xPf7!? (Krogius_EofCM) #1566 white_wins 8/6Bp/6p1/2k1p3/4PPP1/1pb4P/8/2K5/b Pb3b2+ (Krogius_EofCM) #1567 black_wins 5bk1/r4ppp/1r1P1n2/2p2N2/b7/2B3P1/5PBP/R3R1K1/w Bc3xNf6 (Krogius_EofCM) #1568 white_wins 8/8/8/P2k1p2/2N5/1pb2P2/4P3/2K5/w Pa5a6!? (Krogius_EofCM) #1569 white_wins 3qr1k1/p4ppp/1p1P4/2r1nN2/4P2n/P7/1B4P1/3QRRK1/w Pd6d7!? (Krogius_EofCM) #1570 white_wins 6k1/5pbp/6p1/2p1r3/1pPr4/3n2NP/1PB2PP1/1R1R2K1/b Nd3xPb2!? (Krogius_EofCM) #1571 black_wins 4r3/p4pk1/6p1/P1pB2Pp/2P3b1/2p1N1P1/Qb1r1P2/6K1/b Re8xNe3!? (Krogius_EofCM) #1572 black_wins 2r1rbk1/p1Bq1ppp/Ppn1b3/1Npp4/B7/3P2Q1/1PP2PPP/R4RK1/w Nb5xPa7!? (Krogius_EofCM) #1573 white_wins r4rk1/ppq3pp/2p1Pn2/4p1Q1/8/2N5/PP4PP/2KR1R2/w Rf1xNf6!? (Krogius_EofCM) #1574 white_wins r3qr1k/1b4pp/p2RQ3/Bp2p3/4p3/6P1/PPP2P1P/3R2K1/b Qe8h5!? (Krogius_EofCM) #1575 black_wins 8/6kP/6p1/1p1pP3/pP6/P1n2K2/2N5/8/w Pe5e6!? (Krogius_EofCM) #1576 white_wins 8/Pb6/8/8/7K/5k1p/6pB/8/b Pg2g1=Q!? (Krogius_EofCM) #1577 black_wins 8/pR4pk/1b6/2p5/N1p5/8/PP1r2PP/6K1/b Rd2xPb2!? (Krogius_EofCM) #1578 black_wins 6k1/p4pp1/Pp2r3/1QPq3p/8/6P1/2P2P1P/1R4K1/w Pc5xPb6!? (Krogius_EofCM) #1579 white_wins 6k1/p4pbp/Bp2p1p1/n2P4/q3P3/B1rQP3/P5PP/5RK1/w Pd5xPe6!? (Krogius_EofCM) #1580 white_wins 5r2/R4p2/5P1k/4PK2/1p6/8/8/8/w Ra7xPf7!? (Krogius_EofCM) #1581 white_wins 4r2k/pppb2pp/2np2q1/3B4/2P2P2/1PB1R1P1/PQ5P/6K1/w Pf4f5 (Krogius_EofCM) #1582 white_wins 1r6/3r1Pk1/p2p1np1/5q2/1p3P2/1B5R/PPP4Q/1K1R4/w Rh3h8!? (Krogius_EofCM) #1583 white_wins 8/2k5/2p5/2pb2K1/pp4P1/1P1R4/P7/8/b Bd5xPb3!? (Krogius_EofCM) #1584 black_wins 2r5/1r5k/1P3p2/PR2pP1p/4P2p/2p1BP2/1p2n3/4R2K/b Ne2d4!? (Krogius_EofCM) #1585 black_wins 4r2k/p2qr1pp/1pp2p2/2p1nP1N/4R3/1P1P2RP/1PP2QP1/7K/w Rg3xPg7!? (Krogius_EofCM) #1586 white_wins 6k1/p4p2/5Ppp/3RP3/Pr4P1/2p2K2/7P/8/w Rd5d8+ (Krogius_EofCM) #1587 white_wins 8/1R2P3/6k1/3B4/2P2P2/1p2r3/1Kb4p/8/w Bd5e6!? (Krogius_EofCM) #1588 white_wins 2kr2r1/pp2bQ1p/2b1P3/2qN4/8/1B2p2P/PPP3P1/3R1R1K/b Pe3e2!? (Krogius_EofCM) #1589 black_wins r1b2rk1/1p2qppp/p3p3/2n5/3N4/3B1R2/PPP1Q1PP/R5K1/w Bd3xPh7+ (Krogius_EofCM) #1590 white_wins 3r1rk1/pp1q1ppp/3pn3/2pN4/5PP1/P5PQ/1PP1B3/1K1R4/w Be2b5!? (Krogius_EofCM) #1591 white_wins r2qrbk1/5ppp/pn1p4/np2P1P1/3p4/5N2/PPB2PP1/R1BQR1K1/w Bc2xPh7+!? (Krogius_EofCM) #1592 white_wins 6rk/3nrpbp/p1bq1npB/1p2p1N1/4P1PQ/P2B3R/1PP1N2P/5R1K/w Ng5xPh7!? (Krogius_EofCM) #1593 white_wins 1rb2rk1/3nqppp/p1n1p3/1p1pP3/5P2/2NBQN2/PPP3PP/2KR3R/w Bd3xPh7+ (Krogius_EofCM) #1594 white_wins 2k5/ppp3pp/8/NQ2n2q/2Pp1n2/R4bP1/1P3P1P/4R1K1/b Qh5xPh2+ (Krogius_EofCM) #1595 black_wins 5rrk/1p3qpp/p3pn2/2PpBp2/3P1P1Q/P1P1R2R/2b1B1PP/6K1/w Qh4xPh7+!? (Krogius_EofCM) #1596 white_wins r4rk1/1bq2ppp/p1p1p3/2b1P1B1/3p2Q1/3B4/PPP2PPP/R3R1K1/w Bd3xPh7+ (Krogius_EofCM) #1597 white_wins r4rk1/pb1q1ppp/2N1p3/2Rn4/3P4/3BPQ2/1P3PPP/2R3K1/w Bd3xPh7+!? (Krogius_EofCM) #1598 white_wins r5rk/1p1q1p1p/5pn1/p2p1N1Q/3P2P1/PP2R3/5P1P/5RK1/w Qh5xPh7+!? (Krogius_EofCM) #1599 white_wins 2r2r2/p2qppkp/3p2p1/3P1P2/2n2R2/7R/P5PP/1B1Q2K1/w Rh3xPh7+!? (Krogius_EofCM) #1600 white_wins 1r1qr1k1/5p1p/1n2p1p1/pp1pP1P1/2pP1BB1/PnP3P1/1P3PK1/1R1Q3R/w Rh1xPh7!? (Krogius_EofCM) #1601 white_wins 4rrk1/2q1bppp/p2p4/1p1Pn3/3B1R2/P2B2Q1/1PP3PP/5R1K/w Bd3xPh7+!? (Krogius_EofCM) #1602 white_wins r1b2rk1/2q1bppp/p1n1p3/1p1np1P1/5P2/1NNBBQ2/PPP4P/R4RK1/w Bd3xPh7+!? (Krogius_EofCM) #1603 white_wins 5r1k/ppp2qnp/1n1p1N1Q/3Ppb2/2P4P/7B/PP6/2KR2R1/w Nf6xPh7!? (Krogius_EofCM) #1604 white_wins r4rk1/pp2q1p1/4b2p/2ppb3/6n1/2P3N1/PPQBBPPP/R4RK1/b Ng4xPh2!? (Krogius_EofCM) #1605 black_wins b3r1k1/2rN1ppp/2n1p3/p7/P3BP2/1R6/q1P2QPP/3R2K1/w Be4xPh7+!? (Krogius_EofCM) #1606 white_wins 2r1qrk1/3n3p/b3pPp1/4P3/1pp1nBN1/pP4PQ/P1P2PK1/3RR3/w Qh3xPh7+!? (Krogius_EofCM) #1607 white_wins r1b1rnk1/pp1nb1pp/2p1pp2/q3N3/2PP1P2/3BP1N1/PBQ3PP/R4RK1/w Bd3xPh7+!? (Krogius_EofCM) #1608 white_wins 4r1k1/2q2r1p/p3bQ2/1p4Bp/2np4/8/PPB2PP1/3RR1K1/w Bc2xPh7+!? (Krogius_EofCM) #1609 white_wins 5rk1/pbrn1ppp/1ppN1q2/2P1p3/3P4/1PRB4/P3QPPP/5RK1/w Bd3xPh7+!? (Krogius_EofCM) #1610 white_wins 2rqr1k1/1p1bbppp/p3p3/n7/3P2Q1/2PB1N2/P4PPP/R1B1R1K1/w Bd3xPh7+!? (Krogius_EofCM) #1611 white_wins r1b2r1k/ppppq1pp/2n1n3/6N1/2B2P2/4B3/PPP3PP/R2Q1RK1/w Ng5xPh7!? (Krogius_EofCM) #1612 white_wins rn1q1rk1/pb1p1ppp/4p3/2pnP3/1bp5/2N2N2/PP3PPP/RBBQK2R/w Bb1xPh7+!? (Krogius_EofCM) #1613 white_wins r2r2k1/p1p2p1p/4pPp1/1Pqb4/8/7R/1PB2PPP/3QR1K1/w Rh3xPh7!? (Krogius_EofCM) #1614 white_wins r1b2rk1/1pq2ppp/p1p1p3/2n1P3/2N2P2/3B4/PPP3PP/R2Q1RK1/w Bd3xPh7+!? (Krogius_EofCM) #1615 white_wins rnq3rk/4bp1p/p1p3pQ/1p1pP3/1P1N1B2/2P3R1/1P3PPP/R5K1/w Pe5e6!? (Krogius_EofCM) #1616 white_wins rn3rk1/pp1bppbp/1qp3p1/4P1N1/PP1PB3/2P1B3/4Q1PP/R4RK1/w Ng5xPh7!? (Krogius_EofCM) #1617 white_wins 3rr1k1/1pq1nppp/p1p2b2/4pB2/2QPP3/P1P1B3/1P4PP/3R1RK1/w Bf5xPh7+!? (Krogius_EofCM) #1618 white_wins 1r2nrkb/2n2p1p/p2p1Pp1/P1pPp1P1/1pP1P1q1/1P1BB1N1/3Q4/2KR3R/w Rh1xPh7 (Krogius_EofCM) #1619 white_wins 2rrn1k1/2q2ppp/p2pp3/1p2P1P1/4B3/P5Q1/1PP3PP/R4R1K/w Be4xPh7+!? (Krogius_EofCM) #1620 white_wins r2q3r/2pkb1p1/p2p1n2/4p1p1/Pp2P1P1/1QP5/1P1P2PP/RNB2RK1/b Rh8xPh2!? (Krogius_EofCM) #1621 black_wins 2rq1rk1/pp1bnpbp/4p1p1/3pP1N1/3P2Q1/2PB4/P4PPP/R1B1R1K1/w Ng5xPh7!? (Krogius_EofCM) #1622 white_wins 2rq1bk1/1br2p1p/p2p2p1/1p1P4/4Q3/PP3N2/1BP5/1K1R3R/w Rh1xPh7!? (Krogius_EofCM) #1623 white_wins r2qn1k1/pb4Pp/1pn5/2p5/2P2p2/P1PB4/5PPP/R2Q1RK1/w Bd3xPh7+!? (Krogius_EofCM) #1624 white_wins r4rk1/pp1n1ppp/3qp3/3nN1P1/b2P4/P2B1Q2/3B1P1P/1R2R1K1/w Bd3xPh7+!? (Krogius_EofCM) #1625 white_wins r2r2k1/ppqbbppp/4pn2/6N1/n1P4P/3B1N2/PP2QPP1/1KBR3R/w Ng5xPh7!? (Krogius_EofCM) #1626 white_wins r5k1/6bp/2q1p1p1/p2pP3/3P4/1rP2QP1/3B1PK1/2R4R/w Rh1xPh7!? (Krogius_EofCM) #1627 white_wins r6r/4ppk1/p2p1bp1/B2p4/3P2p1/QP2P3/P1R1qPPP/2R3K1/b Rh8xPh2!? (Krogius_EofCM) #1628 black_wins 4nrk1/r4p1p/p2p2pQ/2pPpNPP/qpn1P3/5P1R/PPP1N3/2K3R1/w Qh6xPh7+!? (Krogius_EofCM) #1629 white_wins r3k2r/1b1n1p2/pq1p1bp1/1p4p1/P3P3/1NN5/1PP3PP/R2QRB1K/b Rh8xPh2+!? (Krogius_EofCM) #1630 black_wins r2qrnk1/4bppp/b1p5/1p1p2P1/p2P1N1P/2NBP3/PPQ2P2/2K3RR/w Bd3xPh7+!? (Krogius_EofCM) #1631 white_wins rn1q1rk1/pppbb1pp/4p3/3pP1p1/3P3P/2NB4/PPP2PP1/R2QK2R/w Bd3xPh7+!? (Krogius_EofCM) #1632 white_wins 1r2nr1k/6pp/pp1p1p2/2pPnN2/q1P1PB2/5PR1/4K1P1/2Q4R/w Bf4xNe5 (Krogius_EofCM) #1633 white_wins 3r1rk1/4qp1p/p1bb2p1/2p5/3P4/1P6/PBQN1PPP/2R2RK1/b Bd6xPh2+!? (Krogius_EofCM) #1634 black_wins r2q1rk1/3n1ppp/8/1pbP2P1/p1N4P/PnBBPQ2/5P2/R3K2R/w Bd3xPh7+!? (Krogius_EofCM) #1635 white_wins 2k3r1/ppq2p1p/n1Pb1p2/8/6r1/4BN1b/PPQ2PPP/R3RBK1/b Bd6xPh2+!? (Krogius_EofCM) #1636 black_wins 3qr1k1/1br2ppp/p2b4/8/PpNp4/3P4/1PP2PPP/R1BQ1RK1/b Bd6xPh2+!? (Krogius_EofCM) #1637 black_ahead 3r2k1/p1R2p2/4pQp1/1q5p/5P1P/1PR5/2Pr2P1/6K1/b Rd2xPg2+!? (Krogius_EofCM) #1638 black_wins r1b4r/3p1kp1/pp3q1p/4RP2/8/B7/P5PP/4QRK1/w Qe1e4!? (Krogius_EofCM) #1639 white_wins 1r2rnk1/2R2bpp/p2q4/1p1N2R1/5P2/1Q1B3P/PP4P1/7K/w Rg5xPg7+!? (Krogius_EofCM) #1640 white_wins 3r2k1/pb5p/1p2qpp1/8/2p5/1P1nP3/P1N2PPP/1Q1R1R1K/b Bb7xPg2+!? (Krogius_EofCM) #1641 black_wins 4rrk1/2qb2pp/p5P1/1p2p3/1b2P3/2N5/PPPQ4/1K1R2R1/w Pg6xPh7+ (Krogius_EofCM) #1642 white_wins 3q1k2/pp3ppn/2p1n2p/4pN1N/P3P2P/5Q2/1PP2PP1/6K1/w Nh5xPg7 (Krogius_EofCM) #1643 white_wins 2r2r1k/3b1pb1/p3pp1p/q2p1P1B/8/2N2RR1/P1PQ2PP/7K/w Rg3xBg7!? (Krogius_EofCM) #1644 white_wins 5bk1/1p4p1/4N1R1/3p4/p1r2P1q/Pr1QP2P/1P6/1K4R1/w Rg6xPg7+!? (Krogius_EofCM) #1645 white_wins 2r1r1k1/5ppp/p3pn2/1pb1N3/2P5/1PQ3R1/PB2qPPP/3R2K1/w Rg3xPg7+!? (Krogius_EofCM) #1646 white_wins 7k/1bp1P1p1/3p2rp/1pb2p1q/5P2/1BP2N1P/1P4P1/R1B2R1K/b Rg6xPg2!? (Krogius_EofCM) #1647 black_wins r1q1bk1r/1p3pp1/4pn1p/p3Q3/P1P2N2/1B4R1/1P3PPP/4R1K1/w Rg3xPg7!? (Krogius_EofCM) #1648 white_wins r4rk1/p2n2p1/1q1Qpn1p/1P6/P6B/2p5/2B1KP1P/R5R1/w Rg1xPg7+!? (Krogius_EofCM) #1649 white_wins r2qr1k1/1p3ppp/2pb4/2Np4/1P1P2bn/3BP3/2QN1PPP/1RR3K1/b Nh4xPg2!? (Krogius_EofCM) #1650 black_wins r3r1k1/pp3pp1/3p4/2q4p/2P5/1PB2Q1P/n4PP1/3R1RK1/w Bc3xPg7!? (Krogius_EofCM) #1651 white_wins r5k1/pn1q1rpp/2pp4/5R1N/bP6/4BQ2/P4PPP/2R3K1/w Nh5xPg7!? (Krogius_EofCM) #1652 white_wins 3r1rk1/5pp1/pq1n1n1p/2pPR3/2B2P2/1PBQ2RP/P5P1/6K1/w Rg3xPg7+!? (Krogius_EofCM) #1653 white_wins rn3rk1/ppq2ppp/2pb1nb1/5N2/2BP4/8/PPP1N1P1/R1B1QR1K/w Nf5xPg7!? (Krogius_EofCM) #1654 white_wins r1qb1r1k/2p3pp/p1n1bp2/1p1Np2Q/P3P3/1BP3R1/1P3PPP/R1B3K1/w Rg3xPg7!? (Krogius_EofCM) #1655 white_wins r4rk1/5ppp/p2pbb2/3B3Q/qp2p3/4B3/PPP2P1P/2KR2R1/w Rg1xPg7+!? (Krogius_EofCM) #1656 white_wins 4q1k1/1b3r1p/p4pp1/1p6/2P2n2/1P3N2/1B3PPP/R2Q3K/b Nf4xPg2 (Krogius_EofCM) #1657 black_wins r2r3k/5bp1/2p2N2/5P1p/3q3Q/3B2R1/n5PP/3R3K/w Rg3xPg7!? (Krogius_EofCM) #1658 white_wins 4rrk1/2pn2pb/p1p1qp2/1pb1pN2/P3P1PN/1P1P4/1BP2PK1/R2Q3R/w Nf5xPg7!? (Krogius_EofCM) #1659 white_wins r3r1k1/p3bppp/q1b2n2/5Q2/1p1B4/1BNR4/PPP3PP/2K2R2/w Rd3g3!? (Krogius_EofCM) #1660 white_wins r4rk1/1p1q1ppp/p1b4B/8/2R3R1/P2P4/1b1N1QPP/6K1/w Bh6xPg7!? (Krogius_EofCM) #1661 white_wins rq3rk1/3b1ppp/p2bp3/3pB2Q/8/1B5P/PP3PP1/2RR2K1/w Be5xPg7!? (Krogius_EofCM) #1662 white_wins 4kbr1/pp1bpp1p/3p1p2/3N4/1PBQP3/q7/P1r2PPP/R4RK1/b Rg8xPg2+!? (Krogius_EofCM) #1663 black_wins 2r3k1/1p2R1p1/p3n2p/2pq4/7P/1P1P2P1/PB1Q3K/8/w Bb2xPg7!? (Krogius_EofCM) #1664 white_wins 2rr2k1/4bppp/p1n1p3/3q4/1p1P2N1/2P3R1/P3QPPP/2B2RK1/w Ng4h6+!? (Krogius_EofCM) #1665 white_wins rq1r1bk1/1b3pp1/3pn2p/1n2BN1P/1P2P3/3R1NP1/3Q1PB1/2R3K1/w Be5xPg7!? (Krogius_EofCM) #1666 white_wins r1b5/ppqn2bk/3R2pp/2p2p2/2P1rN2/4BN2/PPQ2PPP/4R1K1/w Rd6xPg6!? (Krogius_EofCM) #1667 white_wins 3q1r2/1p1b1pk1/pn5p/3pN1pQ/3P3P/2r3B1/P4PP1/3RR1K1/w Ne5xPf7!? (Krogius_EofCM) #1668 white_wins r1bqkbnr/pp2ppp1/2p4p/3n2N1/2BP4/5N2/PPP2PPP/R1BQK2R/w Ng5xPf7!? (Krogius_EofCM) #1669 white_wins r2qr1k1/1ppb1p1p/p1np2p1/7Q/3PP2b/1B2N2P/PP3PP1/R1B2RK1/w Bb3xPf7+!? (Krogius_EofCM) #1670 white_wins 2r3k1/pbq1np1p/1p1b1Bp1/8/6QP/2P2N2/B4PP1/4R1K1/w Ba2xPf7+!? (Krogius_EofCM) #1671 white_wins r3r1k1/1bqn1ppp/1pp2p2/8/3P4/1B4N1/PP3PPP/R2QR1K1/w Bb3xPf7+!? (Krogius_EofCM) #1672 white_wins r3r1k1/pp3ppp/8/1Nbp3q/3NnBn1/2P5/PPQ2PPP/3R1RK1/b Ng4xPf2!? (Krogius_EofCM) #1673 black_wins r2r2k1/1b2qpp1/1p2n3/p1b1p2p/4P1n1/PP1B2PP/1B1NQP2/R3NRK1/b Ng4xPf2!? (Krogius_EofCM) #1674 black_wins r2qr1k1/1b2bp1p/p3p1p1/1p2N1Bn/3P4/P6Q/1P3PPP/RB2R1K1/w Ne5xPf7!? (Krogius_EofCM) #1675 white_wins r5k1/1pp3pp/1b1p1r2/pN1P1n2/P1P3nq/6N1/1P1B1PQP/4RRK1/b Ng4xPf2!? (Krogius_EofCM) #1676 black_wins 2rqnk1r/pp2bpp1/2p1pn1p/2P1N2P/3P1BP1/3BQ3/PP6/2K2R1R/w Ne5xPf7!? (Krogius_EofCM) #1677 white_wins 2rq1rk1/1b2bppp/p1n5/1p1BN3/5B2/P7/1P3PPP/R2Q1RK1/w Ne5d7 (Krogius_EofCM) #1678 white_wins 3r1qrk/p1p5/bbp3pp/4p3/4Pp1N/2Pn3P/PPQN1PPB/R4RK1/b Nd3xPf2!? (Krogius_EofCM) #1679 black_wins r2qr1k1/pb2bp1p/1pn1p1pB/8/2BP4/P1P2N2/4QPPP/3R1RK1/w Pd4d5 (Krogius_EofCM) #1680 white_wins r3r1k1/1bq1nppp/p1np4/1ppBpN2/4P3/2PP1N2/PP3PPP/R2QR1K1/w Bd5xPf7+!? (Krogius_EofCM) #1681 white_wins r5k1/p4ppp/3qpb2/1P2N3/1nBP4/1P5P/4QPP1/4R1K1/w Ne5xPf7!? (Krogius_EofCM) #1682 white_wins r2qr1k1/1b1nbp1p/p3pp2/1p2N3/3P4/3B1N2/PP2QPPP/R2R2K1/w Ne5xPf7!? (Krogius_EofCM) #1683 white_wins r3k2r/p1qb1p2/1p2p2p/3pPpN1/P1nP3Q/8/2P2PPP/R1B1R1K1/w Ng5xPf7!? (Krogius_EofCM) #1684 white_wins 3qNk2/5p1p/1r3p2/2p5/Q1pb4/3b2P1/P4PBP/4R1K1/b Bd4xPf2+!? (Krogius_EofCM) #1685 black_wins 2r1r1k1/1pq1bp1p/p3pnp1/P2n2N1/7R/2P4P/1PB1QPP1/2B1R1K1/w Ng5xPf7!? (Krogius_EofCM) #1686 white_wins r1bq2k1/pp1n1ppp/3b1n2/PQ1B3r/3N1P2/2N5/1PP3PP/R1B2RK1/w Bd5xPf7+!? (Krogius_EofCM) #1687 white_wins 2r1r1k1/5ppp/pq3b2/2pB1P2/2p2B2/5Q1P/Pn3PP1/2R1R1K1/w Bd5xPf7+!? (Krogius_EofCM) #1688 white_wins r4rk1/ppRn1p2/6pb/2P1pq1p/3N4/P1QPn1Pb/1B1NPP1P/4R1KB/b Qf5xPf2+!? (Krogius_EofCM) #1689 black_wins r3kr2/1b2qp2/pp2p2N/4p2Q/8/2n5/P3B1PP/3R1R1K/w Nh6xPf7!? (Krogius_EofCM) #1690 white_wins b2r1rk1/pq2bpp1/1p2p2p/4N2n/2P2R2/1PB2N2/1P2QPPP/4R1K1/w Rf4xPf7!? (Krogius_EofCM) #1691 white_wins rqb1k2r/1p1nbp1p/p4pp1/8/1PBN1P2/P1N1P3/7P/2RQ1RK1/w Bc4xPf7+!? (Krogius_EofCM) #1692 white_wins r2r2k1/4ppbp/5np1/p1q5/QnB1P3/5N2/1P3PPP/R1B2RK1/w Bc4xPf7+!? (Krogius_EofCM) #1693 white_wins 1r2q1k1/p3pp2/3p1bp1/2pP2N1/8/P5PB/2Q2PK1/1rBR4/w Ng5xPf7!? (Krogius_EofCM) #1694 white_wins 2rqrbk1/pb1n1p1p/1p2pnp1/4N3/2BP1N2/1P2Q3/PB3PPP/3R1RK1/w Ne5xPf7!? (Krogius_EofCM) #1695 white_wins 1r4k1/p4pp1/bqnrpn1p/2ppN3/2P2P1B/P3P3/1P2B1PP/1Q1R1RK1/w Bh4xNf6 (Krogius_EofCM) #1696 white_wins r1bqrbk1/5p1p/2pp2nB/pp5Q/4P3/PBNPR2P/1P4P1/R5K1/w Bb3xPf7+!? (Krogius_EofCM) #1697 white_wins r1bqkb1r/1p3ppp/pn1P1n2/4p3/2B5/2N2N2/PP3PPP/R1BQ1RK1/w Bc4xPf7+!? (Krogius_EofCM) #1698 white_wins 2rqr1k1/pp2nppp/3p2b1/6B1/2BNn1Q1/P7/1PP2PPP/2KRR3/w Bc4xPf7+!? (Krogius_EofCM) #1699 white_wins r3r1k1/pbq1ppbp/1pp2np1/4N3/3P4/2P5/PPB1QPPP/R1B1R1K1/w Ne5xPf7!? (Krogius_EofCM) #1700 white_wins r1b2rk1/p6p/2p3Pb/3pp1q1/8/2PB4/PP3PP1/RN1Q1K1R/b Rf8xPf2+!? (Krogius_EofCM) #1701 black_wins r2rn3/1p3pk1/p1pNn1pp/q3P3/P7/1PN4P/2QN1PP1/3R2K1/w Nd6xPf7!? (Krogius_EofCM) #1702 white_wins r1bqr1k1/1p1nnpb1/p5pp/2P1p1B1/B3N3/5N2/P4PPP/2RQR1K1/w Ne4d6!? (Krogius_EofCM) #1703 white_wins r1b1r1k1/pp2qpbp/2p3p1/2P5/3NnB2/7P/PPQ1PPB1/2RR2K1/b Ne4xPf2!? (Krogius_EofCM) #1704 black_wins rn2r1k1/pp3p1p/3P2p1/2p1bbB1/2B5/2N5/Pq4PP/R2Q1RK1/w Bc4xPf7+!? (Krogius_EofCM) #1705 white_wins 5rk1/r2qnppp/p1nN4/2Q5/3PB3/4P3/6PP/R4RK1/w Nd6xPf7!? (Krogius_EofCM) #1706 white_wins 1bq2k2/1b1n1pp1/pp5p/2pBpN2/P3P2B/3Q1P2/1PP3PP/4K3/w Bd5xPf7!? (Krogius_EofCM) #1707 white_wins rnb2rk1/pp3pbp/2p3pB/2q5/4P3/1BN5/PPP3PP/R2Q1R1K/w Rf1xPf7!? (Krogius_EofCM) #1708 white_wins 3qr1k1/1br1bp1p/p3p1pB/1p1nN3/3PB3/7Q/PP3PPP/3RR1K1/w Ne5xPf7 (Krogius_EofCM) #1709 white_wins 1qr1b1k1/4bpp1/pn2p2p/1p1nN3/3P4/P2BBN1Q/1P3PPP/4R1K1/w Be3xPh6!? (Krogius_EofCM) #1710 white_wins rr1q2k1/1p2bpp1/2p1p2p/P1Pn4/2NP4/3Q1RP1/5PKP/2B1R3/w Bc1xPh6!? (Krogius_EofCM) #1711 white_wins r2r2k1/pb1nbpp1/1qp1pn1p/1p2N3/3P1B2/P1N1P3/BPQ2PPP/2R2RK1/w Bf4xPh6!? (Krogius_EofCM) #1712 white_wins 2r5/1p4bk/3p2rp/4pN2/1P2P1pR/2P2q2/QP6/1K5R/w Rh4xPh6+!? (Krogius_EofCM) #1713 white_wins r1b1r3/pp2Npbk/3pp2p/q5p1/2QNPP2/6P1/PPP3P1/2KR3R/w Nd4f5 (Krogius_EofCM) #1714 white_wins r1q3r1/1ppQ2pk/3bNp1p/p3pP2/P3P3/7R/1PP3PP/3R2K1/w Rh3xPh6+!? (Krogius_EofCM) #1715 white_wins 4r1k1/p1pq1pp1/2p5/3p1b2/Q7/2P1B2P/P1P1rPP1/2R2RK1/b Bf5xPh3!? (Krogius_EofCM) #1716 black_wins 1rbqnr2/5p1k/p1np3p/1p1Np3/4P2P/1Q2B3/PPP1BP2/2KR3R/w Be3xPh6!? (Krogius_EofCM) #1717 white_wins r1br2k1/p1q2pp1/4p1np/2ppP2Q/2n5/2PB1N2/2P2PPP/R1B1R1K1/w Bc1xPh6!? (Krogius_EofCM) #1718 white_wins 3r1r1k/p5p1/n1p2p1p/1qp2b2/N1R4R/1PB1P1P1/P2P3P/3Q2K1/w Rh4xPh6+!? (Krogius_EofCM) #1719 white_wins r4rk1/2q1b1p1/p4p1p/n3pP2/1p2Q1N1/4B3/PPP3PP/4RR1K/w Ng4xPh6+!? (Krogius_EofCM) #1720 white_wins 6rk/3b1n1p/1p1q3b/1PpNp3/2P1Pp2/2Q2NrP/5RP1/2R2B1K/b Bd7xPh3!? (Krogius_EofCM) #1721 black_wins r2q1rk1/ppp2pp1/1b2b2p/3n3Q/2Bp4/3P1N2/PPP2PPP/R1B1R1K1/w Bc1xPh6!? (Krogius_EofCM) #1722 white_wins r3rbk1/1bp1qpp1/p6p/np2p2Q/4P2N/1BP4P/PP3PP1/R1B1R1K1/w Bc1g5!? (Krogius_EofCM) #1723 white_wins 4q3/p2r1ppk/R6p/3n4/3B1Q2/4P2P/5PP1/6K1/w Ra6xPh6+!? (Krogius_EofCM) #1724 white_wins 7r/1p2qk2/pQ1p2p1/3Ppp2/P4b2/2P2PrP/1P2R1B1/4R2K/b Rh8xPh3+ (Krogius_EofCM) #1725 black_wins 5rk1/Qp5p/3pp1p1/4n3/2P1P2q/5r1P/P3NPP1/3R1RK1/b Rf3xPh3!? (Krogius_EofCM) #1726 black_wins 2r1r1k1/pb1n1pp1/1p1qpn1p/4N1B1/2PP4/3B4/P2Q1PPP/3RR1K1/w Bg5xPh6!? (Krogius_EofCM) #1727 white_wins 3q1rk1/p2bbpp1/1rn4p/1pp2P2/3pBBP1/3P3P/PPPQ3N/R4RK1/w Bf4xPh6!? (Krogius_EofCM) #1728 white_wins 2br2k1/4qppp/p5r1/2pBp3/2P1Pn2/4Q2P/RP3PPK/1N4R1/b Bc8xPh3!? (Krogius_EofCM) #1729 black_wins r2qr3/2p1b1pk/p5pp/1p2p3/nP2P1P1/1BP2RP1/P3QPK1/R1B5/w Bc1xPh6!? (Krogius_EofCM) #1730 white_wins r5r1/pbn4k/1p1p1Ppp/2pPn3/4BQq1/1PN3P1/PB3PK1/3R1R2/w Qf4xPh6+!? (Krogius_EofCM) #1731 black_wins r1b2rk1/pp2bpp1/4p2p/2q4Q/5nNB/2PB4/PP3PPP/2KR3R/w Ng4xPh6+!? (Krogius_EofCM) #1732 white_wins 6k1/p4ppp/1pn1b1rr/8/PBpPp2q/2P1P1NP/5PP1/RR3QK1/b Be6xPh3!? (Krogius_EofCM) #1733 black_wins r1b2rk1/1p3pp1/p5Pp/2bpPp1Q/3N4/1Pq1B1R1/2P4P/3R2K1/w Be3xPh6 (Krogius_EofCM) #1734 white_wins r2r2k1/pp1n1bp1/2p2p1p/b4N2/q2BR3/2QB2PP/1PP5/2KR4/w Nf5xPh6+!? (Krogius_EofCM) #1735 white_wins 3r2bk/1q4p1/p2P1N1p/2p1rP2/pb5R/7P/1P4P1/2Q2RK1/w Rh4xPh6+!? (Krogius_EofCM) #1736 white_wins 2b1rk2/r6p/1pP1p1p1/p2pNnR1/5Q2/P1B4q/1PP2P1P/1K4R1/w Ne5xPg6+!? (Krogius_EofCM) #1737 white_wins 6R1/6Q1/3q2p1/5p1p/P3p1k1/1P1r2P1/5PK1/8/b Rd3xPg3+!? (Krogius_EofCM) #1738 black_wins r6r/ppnqpk2/3pbpp1/5N2/1PP1P3/5RR1/P2QB1PP/6K1/w Nf5h6+ (Krogius_EofCM) #1739 white_wins 3r3r/p4pk1/5Rp1/3q4/1p1P2RQ/5N2/P1P4P/2b4K/w Rf6xPg6+!? (Krogius_EofCM) #1740 white_wins 2b2r1k/2p3pp/2Nb4/pP5q/2PP4/P4pP1/5P1P/R1BQ2K1/b Bd6xPg3!? (Krogius_EofCM) #1741 black_wins r1bq2k1/pp3r1p/2n1p1p1/3pP3/6Q1/2PB2P1/P4PK1/R1B4R/w Bd3xPg6!? (Krogius_EofCM) #1742 white_wins 3q1rk1/2r4p/n1p1n1pQ/p2pP3/Np1P2R1/5PN1/PP3KP1/2R5/w Rg4xPg6+!? (Krogius_EofCM) #1743 white_wins 2Nq1rk1/6pp/b1p2b2/p6Q/np1p4/6P1/PB3PBP/R3R1K1/w Bg2e4!? (Krogius_EofCM) #1744 white_wins r2r4/p4pk1/2p3p1/1p1nPR2/5p1Q/2N5/PPPq4/1K4R1/w Pe5e6!? (Krogius_EofCM) #1745 white_wins 2kr3r/pbq3p1/1p2pp2/2b4n/2P1B3/1P1N2Pp/PB2QP1P/R4RK1/b Nh5xPg3!? (Krogius_EofCM) #1746 black_wins r5k1/1p2Rpb1/3p1np1/2nP2B1/1qP5/1pN1Q2P/P5P1/1B4K1/w Bb1xPg6!? (Krogius_EofCM) #1747 white_wins 2rqr1k1/pb2bp1p/1pn1pnpB/4N3/3P4/P1N3R1/1P3PPP/RB1Q2K1/w Rg3xPg6+!? (Krogius_EofCM) #1748 white_wins 2r5/pp2qr1k/1nb3pp/2ppBp2/2P4P/3B2R1/P3QPP1/1R4K1/w Rg3xPg6!? (Krogius_EofCM) #1749 white_wins 3rr3/3q1p1k/p2P2pp/1bp1b3/5N2/6QP/P1B3P1/3RR1K1/w Bc2xPg6+!? (Krogius_EofCM) #1750 white_wins r2q1rk1/pp2ppb1/3pn1pQ/3R4/2P3B1/4BR2/PP4PP/6K1/w Qh6xPg6!? (Krogius_EofCM) #1751 white_wins 1n1b1rk1/r4p1p/p1p2qpQ/P3Np2/2BP4/2P1R3/5PPP/R5K1/w Ra1b1 (Krogius_EofCM) #1752 white_wins 6rk/pb3p1p/3bpPq1/3P4/1p1B3r/1B4P1/PPRQ1R1P/6K1/b Bd6xPg3!? (Krogius_EofCM) #1753 black_wins 3rr1k1/pb2bp1p/3qp1pB/1p2N3/3P2Q1/2P1R3/P4PPP/4R1K1/w Ne5xPg6!? (Krogius_EofCM) #1754 white_wins r2q1rk1/pb1nbp1p/1p2p1p1/4N1BQ/2PP4/P7/5PPP/RB2R1K1/w Ne5xPg6!? (Krogius_EofCM) #1755 white_wins 1Q4R1/r2qbp2/3p1kp1/3Bp2p/8/3PP1P1/5PKP/8/w Rg8xPg6+!? (Krogius_EofCM) #1756 white_wins r3r1k1/b1p2pn1/p2q1Bp1/1p1bN1Qp/3P4/2P4P/PPB2PP1/R3R1K1/w Ne5xPg6!? (Krogius_EofCM) #1757 white_wins 3r2k1/p1rn1p1p/1p2pp2/6q1/3PQNP1/5P2/P1P4R/R5K1/w Nf4xPe6!? (Krogius_EofCM) #1758 white_wins k2r3r/ppq2p1p/n1pb1Pp1/4p3/2Q5/1R2B1P1/PPP2PBP/R5K1/w Rb3xPb7!? (Krogius_EofCM) #1759 white_wins 1rb2rk1/p1p1qppp/2p2n2/3P4/1b3P2/2NB4/PPPBQ1PP/2KR3R/b Bb4a3!? (Krogius_EofCM) #1760 black_wins k7/pp1N4/4P3/5P2/8/5p2/1R6/B4Knq/w Nd7b6+!? (Krogius_EofCM) #1761 white_wins 4rrk1/p5pp/1p4q1/3p2n1/2pP2P1/P1P1PP2/3B2K1/1R2QR2/b Ng5xPf3!? (Krogius_EofCM) #1762 white_wins 1q1r3k/3P1pp1/ppBR1n1p/4Q2P/P4P2/8/5PK1/8/w Rd6xNf6!? (Krogius_EofCM) #1763 white_wins 1rbq2k1/b1p3pp/p1Pp4/3Ppr2/8/5N2/PPQ2PPP/R1B2RK1/b Rf5xNf3!? (Krogius_EofCM) #1764 black_wins 1r1q1r1k/2p3pp/1p1bQ3/p7/1PP5/Pn3B2/1B3PPP/R4RK1/b Rf8xBf3!? (Krogius_EofCM) #1765 black_wins r4rk1/2p1qpp1/p1p5/2Ppn2b/2PQ1N1p/4P3/PB3PPP/R4RK1/b Ne5f3+!? (Krogius_EofCM) #1766 black_wins r1bq1rk1/1p2bppp/p3p3/n3P3/4N3/1P1P1N2/PB4PP/R3QR1K/w Ne4f6+!? (Krogius_EofCM) #1767 white_wins 1n2r3/p1pq1kp1/1b1pNpp1/3P4/5RP1/3Q3P/1B3P2/6K1/w Bb2xPf6!? (Krogius_EofCM) #1768 white_wins r1bq1rk1/ppp3p1/7p/3P2n1/2PQ1p2/1N5P/PPP2PPK/R1B2R2/b Ng5f3+!? (Krogius_EofCM) #1769 black_wins 3r1b2/p4bkp/1p1P1p2/r3p1p1/2q1N3/2N2P2/1P1R2PP/2QR3K/w Ne4xPf6 (Krogius_EofCM) #1770 white_wins rqbn1rk1/1p3ppp/p3p3/8/4NP2/8/PPP1BQPP/1K1R3R/w Ne4f6+!? (Krogius_EofCM) #1771 white_wins r1b1kb1r/1p4pp/p2ppn2/8/2qNP3/2N1B3/PPP3PP/R2Q1RK1/w Rf1xNf6!? (Krogius_EofCM) #1772 white_wins 1rn5/p3Bk1p/1pq1bpp1/P3p3/1Q2P2P/2P3P1/5PB1/1R4K1/w Be7xPf6!? (Krogius_EofCM) #1773 white_wins 2nr2k1/1pq1bppp/p1p5/2p1P1PQ/2P1NP2/1PNR4/P6P/6K1/w Ne4f6+!? (Krogius_EofCM) #1774 white_wins 6nk/pn2qr1r/1pbp1p1p/2p1pPpN/P1P1P1PP/2PP3R/7Q/2BBK2R/w Nh5xPf6!? (Krogius_EofCM) #1775 white_wins 7r/4p1k1/p3Pppp/1p6/3N1R2/3PQ2P/qr4b1/5RK1/w Rf4xPf6!? (Krogius_EofCM) #1776 white_wins r3k2r/1bq1bp2/p3p1pp/1p2P3/3NpP2/4B1Q1/PPP3PP/1K1R3R/w Nd4xPe6!? (Krogius_EofCM) #1777 white_wins rnbqkb1r/pp1n1p2/4p1p1/1N1pP2p/1P4Q1/3B1N2/P1PB1PPP/R3K2R/w Qg4xPe6+!? (Krogius_EofCM) #1778 white_wins r1b1kb1r/1p1n1ppp/p2ppn2/6BB/2qNP3/2N5/PPP2PPP/R2Q1RK1/w Nd4xPe6!? (Krogius_EofCM) #1779 white_wins r1b1k1nr/3n1p1p/1qpBp1p1/pp2b3/4PN2/PBN2Q2/1PP2PPP/2KR3R/w Nf4xPe6!? (Krogius_EofCM) #1780 white_wins 2r2rk1/1b3ppp/pq2p3/1pbn2N1/3B3P/1B4P1/P1P1QP2/2KRR3/w Qe2h5 (Krogius_EofCM) #1781 white_wins r3k2r/pp1n1pb1/1qn1p1p1/2p3Pp/4R2P/2NP2QB/PPPB1P2/2K1R3/w Re4xPe6+!? (Krogius_EofCM) #1782 white_wins r3k2r/1q3ppp/p3p3/2b1P3/p2N1Q2/P7/1PP3PP/3R1R1K/w Nd4xPe6!? (Krogius_EofCM) #1783 white_wins 3qr1k1/rp3pbp/2p3p1/3p1b2/N1nP4/P2NP3/1PQ2PPP/1BRR2K1/b Re8xPe3!? (Krogius_EofCM) #1784 black_wins rnbqkb1r/1p1n1pp1/p3p2p/3pP3/3p1NQP/2N5/P1PB1PP1/R3KB1R/w Nf4xPe6!? (Krogius_EofCM) #1785 white_wins 3r1b1R/3bkpp1/1p1np3/1BqpPPP1/PQ1N4/8/1PP5/1K6/w Pf5f6+!? (Krogius_EofCM) #1786 white_wins 4r1k1/pp2n2p/1r1n1bp1/q2p1pB1/3P3N/P1NQ1P1P/1PP3R1/1K5R/b Rb6xPb2+!? (Krogius_EofCM) #1787 black_wins 3r2k1/2p1bppp/4b3/p2pP3/qr1N1B1P/8/1PPQ2P1/1K1RR3/b Rb4xPb2+!? (Krogius_EofCM) #1788 black_wins 1k1r3r/ppR2ppp/1q2b3/1N6/4Q3/8/PP3PPP/4R1K1/w Rc7xPb7+!? (Krogius_EofCM) #1789 white_wins 1r3rk1/5pbp/p2Pp1p1/q1n3P1/2p2P1P/2N1Q2R/PP6/1BKR4/b Rb8xPb2!? (Krogius_EofCM) #1790 black_wins rr4k1/5p1p/n2p1npQ/q1pP4/6P1/2N2P1N/PP1R3P/2K4R/b Rb8xPb2!? (Krogius_EofCM) #1791 black_wins 1k2bb1r/1p3p1p/p2qpP1p/3pN3/3P1Q2/2RB2P1/PP3P1P/6K1/w Qf4c1 (Krogius_EofCM) #1792 white_wins 1r4k1/1r3p2/p1p1b1pQ/q3P3/P7/bPN1R1P1/2P4P/1K1R1B2/b Be6xPb3!? (Krogius_EofCM) #1793 black_wins 5rk1/5rp1/p2qb3/R2Np2Q/3bP2B/7P/P5PK/1R6/b Rf7f1!? (Krogius_EofCM) #1794 draw 6k1/5p2/R3p1p1/1pq1PpB1/4nP2/5Q1P/P2r2PK/8/w Ra6a8+ (Krogius_EofCM) #1795 draw 3r1rk1/p3q1pp/2Rb4/3P4/8/1P2Qp2/PB3PPP/3R2K1/b Bd6xPh2+!? (Krogius_EofCM) #1796 draw 1r6/5pk1/p1b2qpp/P1P1n3/1N6/Q5NP/5PP1/3R2K1/b Bc6xPg2!? (Krogius_EofCM) #1797 draw 1r4k1/1q3pb1/r1b3p1/pp1Qp3/P3P3/1B2BP2/1PP3P1/1K1R3R/w Qd5d8+!? (Krogius_EofCM) #1798 draw 2R5/p3q1kp/6p1/3p4/b2P2p1/Pr4N1/5Q2/3K3R/w Ng3f5+!? (Krogius_EofCM) #1799 draw 3r4/kb6/pp6/4R1pr/PPpq4/2N3Q1/2P3PP/3R3K/b Rd8f8!? (Krogius_EofCM) #1800 draw 4r1k1/5p1p/4q1p1/8/Q5n1/3B2P1/P4P1P/2R3K1/b Ng4xPf2!? (Krogius_EofCM) #1801 draw 8/2q1np1k/6p1/1PPn3p/8/P2Q3P/6P1/2R4K/b Ne7f5!? (Krogius_EofCM) #1802 draw r1bq1rk1/ppp1n1bn/3p2p1/3Pp1Pp/1PP1Pp1P/2NN1P2/P3B3/R1BQ1RK1/b Nh7xPg5!? (Krogius_EofCM) #1803 draw 7R/1p1r4/2b2p2/2Pp1qk1/3P1bp1/3N4/2Q2PB1/6K1/w Rh8g8+ (Krogius_EofCM) #1804 draw r6r/1pn1b1k1/2p1pq2/2Pp3p/p2P1Pp1/P2BP1P1/1P2QB2/3R2KR/w Rh1xPh5!? (Krogius_EofCM) #1805 draw 1r4k1/pp4pp/2n1b3/1Rq1p3/2P2r2/P1B2P2/2Q1B1PP/3R1K2/b Rf4xPf3+!? (Krogius_EofCM) #1806 draw 7k/1p4p1/2p4r/5p2/p1QP1q2/2P2PR1/r4P1P/4R2K/b Rh6xPh2+!? (Krogius_EofCM) #1807 draw 1r3r2/6kp/3p1pp1/qnp1pP2/1p2P2N/3P4/PPPQ1P1P/1K1R2R1/w Pf5xPg6!? (Krogius_EofCM) #1808 draw 5rk1/1rP3pp/p4n2/3Pp3/1P2Pq2/2Q4P/P5P1/R3R1K1/b Rb7xPc7!? (Krogius_EofCM) #1809 draw 2rq1rk1/5ppp/2b1pb2/np6/6N1/2NBB3/PP3PPP/R2Q2K1/w Be3b6!? (Krogius_EofCM) #1810 draw 5r2/p2p2kp/3PnNp1/1qr1Pp2/2p5/P1R5/6PP/2Q1R1K1/w Qc1h6+!? (Krogius_EofCM) #1811 draw 2Qbq1k1/6p1/1p4Np/4p2P/3rP3/8/3p2PK/3R4/w Rd1f1!? (Krogius_EofCM) #1812 draw 2kr1br1/ppp2p1p/2n1p1q1/2Nn4/3P4/1Q2PB2/PP1B1P1P/2R1K2R/b Qg6g1+!? (Krogius_EofCM) #1813 draw 2K5/6p1/kp2P3/1p6/1P6/2P1P2p/8/1r6/w Pe6e7 (Krogius_EofCM) #1814 draw 2kr3r/1Rp1bpp1/p6q/Q3P3/2P5/3p1NP1/P3P2P/1R4K1/b Qh6e3+ (Krogius_EofCM) #1815 draw 6k1/1R4pp/2p5/8/P1rNp3/6Pb/4PK2/8/w Pa4a5!? (Krogius_EofCM) #1816 draw r2r2k1/pp3ppp/2q5/2p5/2P1P1n1/P4P1b/1BQ1BP1P/R3R2K/b Rd8d2!? (Krogius_EofCM) #1817 draw gnuchess-4.0.pl70/test/CHESSTEST/hortjan.fin100644 21542 13 30472 5527662451 17524 0ustar cracraftuser#Positions from HORT AND JANSA: "The best move" RHM Press NY 1980. # #Contributed by Hans Berliner, partially checked by him and HITECH. #Note: all analysis is due to Berliner, HITECH, and/or Hort+Jansa. In 4 #cases so far Berliner/HITECH have found errors in H+J's solution. #("Books are full of errors," says Berliner, in the same breath adding #that he thinks H+J is an "excellent" book...) There also seem to be #plenty of typos in this file, presumably corresponding to cases #berliner has not gotten to checking yet (or berliner has caused his #own typos?) namely: # #Possible typos and BUGS: #move d1a1 illegal; 0 matches; HJ.T25 I fixed this to be d1h1, which I think is correct #move e7d6 illegal; 0 matches; HJ.010 #move f3e5 illegal; 0 matches; HJ.021 I fixed to be f4xe5, think this is correct #move e3c3 illegal; 0 matches; HJ.025 # #HJ.053 has no indicated solution!! I do not understand Berliner's analysis line for it! # #neither do # HJ.M02 HJ.M03 HJ.M04 HJ.M05 HJ.M06 HJ.M07 HJ.M08 HJ.M09 HJ.M10 #have solutions typed in. # #At present I am incapable of fixing these bugs since I cannot obtain a #copy of the H+J book. I would sure appreciate it if somebody who has a #copy of the book would figure out what is going on here. Berliner says #he is too busy to help. # #Note our 3-field forsythe format. The first position has: white on move #(note the "/w") and solution (2nd field) is d5. Label (the 3rd field) #is "HJ.A01". # #POSITIONS START: # 3r1k2/4npp1/1ppr3p/p6P/P2PPPP1/1NR5/5K2/2R5/w Pd4d5 HJ.A01 2q1rr1k/3bbnnp/p2p1pp1/2pPp3/PpP1P1P1/1P2BNNP/2BQ1PRK/7R/b Pf6f5 HJ.A02 rnbqkb1r/p3pppp/1p6/2ppP3/3N4/2P5/PPP1QPPP/R1B1KB1R/w Pe5e6 HJ.A03 r1b2rk1/2q1b1pp/p2ppn2/1p6/3QP3/1BN1B3/PPP3PP/R4RK1/w Nc3d5,Pa2a4 HJ.A04 2r3k1/pppR1pp1/4p3/4P1P1/5P2/1P4K1/P1P5/8/w Pg5g6 HJ.A05 1nk1r1r1/pp2n1pp/4p3/q2pPp1N/b1pP1P2/B1P2R2/2P1B1PP/R2Q2K1/w Nh5f6 HJ.A06 4b3/p3kp2/6p1/3pP2p/2pP1P2/4K1P1/P3N2P/8/w Pf4f5 HJ.A07 2kr1bnr/pbpq4/1pn1pp2/3p3p/3P1P1B/2N2N1Q/PPP3PP/2KR1B1R/w Pf4f5 HJ.A08 3rr1k1/pp3pp1/1qn2np1/8/3p4/PP1R1P2/2P1NQPP/R1B3K1/b Nc6e5 HJ.A09 2r1nrk1/p2q1ppp/bp1p4/n1pPp3/P1P1P3/2PBB1N1/4QPPP/R4RK1/w Pf2f4 HJ.A10 r2q1rk1/4bppp/p2p4/2pP4/3pP3/3Q4/PP1B1PPP/R3R1K1/w Pb2b4 HJ.A11 r1bqkb1r/4npp1/p1p4p/1p1pP1B1/8/1B6/PPPN1PPP/R2Q1RK1/w Nd2e4 HJ.A12 r2q1rk1/1ppnbppp/p2p1nb1/3Pp3/2P1P1P1/2N2N1P/PPB1QP2/R1B2RK1/b Ph7h5 HJ.A13 r1bq1rk1/pp2ppbp/2np2p1/2n5/P3PP2/N1P2N2/1PB3PP/R1B1QRK1/b Nc5b3 HJ.A14 r4k2/pb2bp1r/1p1qp2p/3pNp2/3P1P2/2N3P1/PPP1Q2P/2KRR3/w Pg3g4 HJ.A15 r1bqk2r/pp2bppp/2p5/3pP3/P2Q1P2/2N1B3/1PP3PP/R4RK1/b Pf7f6 HJ.A16 r2qnrnk/p2b2b1/1p1p2pp/2pPpp2/1PP1P3/PRNBB3/3QNPPP/5RK1/w Pf2f4 HJ.A17 3r1k2/4npp1/1ppr3p/p6P/P2PPPP1/1NR5/5K2/2R5/w Pd4d5 HJ.P01 2q1rr1k/3bbnnp/p2p1pp1/2pPp3/PpP1P1P1/1P2BNNP/2BQ1PRK/7R/b Pf6f5 HJ.P02 rnbqkb1r/p3pppp/1p6/2ppP3/3N4/2P5/PPP1QPPP/R1B1KB1R/w Pe5e6 HJ.P03 2r3k1/pppR1pp1/4p3/4P1P1/5P2/1P4K1/P1P5/8/w Pg5g6 HJ.P04 4b3/p3kp2/6p1/3pP2p/2pP1P2/4K1P1/P3N2P/8/w Pf4f5 HJ.P05 2kr1bnr/pbpq4/1pn1pp2/3p3p/3P1P1B/2N2N1Q/PPP3PP/2KR1B1R/w Pf4f5 HJ.P06 2r1nrk1/p2q1ppp/bp1p4/n1pPp3/P1P1P3/2PBB1N1/4QPPP/R4RK1/w Pf2f4 HJ.P07 r2q1rk1/4bppp/p2p4/2pP4/3pP3/3Q4/PP1B1PPP/R3R1K1/w Pb2b4 HJ.P08 r2q1rk1/1ppnbppp/p2p1nb1/3Pp3/2P1P1P1/2N2N1P/PPB1QP2/R1B2RK1/b Ph7h5 HJ.P09 r4k2/pb2bp1r/1p1qp2p/3pNp2/3P1P2/2N3P1/PPP1Q2P/2KRR3/w Pg3g4 HJ.P10 r1bqk2r/pp2bppp/2p5/3pP3/P2Q1P2/2N1B3/1PP3PP/R4RK1/b Pf7f6 HJ.P11 r2qnrnk/p2b2b1/1p1p2pp/2pPpp2/1PP1P3/PRNBB3/3QNPPP/5RK1/w Pf2f4 HJ.P12 8/p1q2pkp/2Pr2p1/8/P3Q3/6P1/5P1P/2R3K1/w Qe4e5+,Qe4f4 HJ.T01 r1bqr1k1/pp1nb1p1/4p2p/3p1p2/3P4/P1N1PNP1/1PQ2PP1/3RKB1R/w Nc3b5 HJ.T02 r3r1k1/pppq1ppp/8/8/1Q4n1/7P/PPP2PP1/RNB1R1K1/b Qd7d6 HJ.T03 r1b1qrk1/2p2ppp/pb1pnn2/1p2pNB1/3PP3/1BP5/PP2QPPP/RN1R2K1/w Bg5xNf6 HJ.T04 r4rk1/1bn2qnp/3p1B1Q/p2P1pP1/1pp5/5N1P/PPB2P2/2KR3R/w Pg5g6 HJ.T05 2k4r/1pr1n3/p1p1q2p/5pp1/3P1P2/P1P1P3/1R2Q1PP/1RB3K1/w Rb2xPb7 HJ.T06 r1bq4/1p4kp/3p1n2/p4pB1/2pQ4/8/1P4PP/4RRK1/w Re1e8 HJ.T07 6k1/6p1/2p4p/4Pp2/4b1qP/2Br4/1P2RQPK/8/b Be4xPg2 HJ.T08 3r2k1/p1rn1p1p/1p2pp2/6q1/3PQNP1/5P2/P1P4R/R5K1/w Nf4xPe6 HJ.T09 2rqrn1k/pb4pp/1p2pp2/n2P4/2P3N1/P2B2Q1/1B3PPP/2R1R1K1/w Bb2xPf6 HJ.T10 2b2rk1/p1p4p/2p1p1p1/br2N1Q1/1p2q3/8/PB3PPP/3R1RK1/w Ne5f7 HJ.T11 4r1k1/pq3p1p/2p1r1p1/2Q1p3/3nN1P1/1P6/P1P2P1P/3RR1K1/w Rd1xNd4 HJ.T12 3q1rk1/4bp1p/1n2P2Q/3p1p2/6r1/Pp2R2N/1B4PP/7K/w Nh3g5 HJ.T13 r1b2rk1/p4ppp/1p1Qp3/4P2N/1P6/8/P3qPPP/3R1RK1/w Nh5f6+ HJ.T14 4r3/1Q1qk2p/p4pp1/3Pb3/P7/6PP/5P2/4R1K1/w Pd5d6+ HJ.T15 3r3k/1r3p1p/p1pB1p2/8/p1qNP1Q1/P6P/1P4P1/3R3K/w Bd6f8,Nd4f5 HJ.T16 r1b2rk1/2q1b1pp/p2ppn2/1p6/3QP3/1BN1B3/PPP3PP/R4RK1/w Nc3d5,Pa2a4 HJ.T17 1nk1r1r1/pp2n1pp/4p3/q2pPp1N/b1pP1P2/B1P2R2/2P1B1PP/R2Q2K1/w Nh5f6 HJ.T18 2kr3r/pp1q1ppp/5n2/1Nb5/2Pp1B2/7Q/P4PPP/1R3RK1/w Nb5xPa7+ HJ.T19 8/p3k1p1/4r3/2ppNpp1/PP1P4/2P3KP/5P2/8/b Re6xNe5 HJ.T20 r4rk1/1p2ppbp/p2pbnp1/q7/3BPPP1/2N2B2/PPP4P/R2Q1RK1/b Be6xPg4 HJ.T21 5rk1/p5pp/8/8/2Pbp3/1P4P1/7P/4RN1K/b Bd4c3 HJ.T22 5bk1/1rQ4p/5pp1/2pP4/3n1PP1/7P/1q3BB1/4R1K1/w Pd5d6 HJ.T23 r1q2rk1/p3bppb/3p1n1p/2nPp3/1p2P1P1/6NP/PP2QPB1/R1BNK2R/b Nf6xPd5 HJ.T24 3r1rk1/pp1q1ppp/3pn3/2pN4/5PP1/P5PQ/1PP1B3/1K1R4/w Rd1h1 HJ.T25 8/6k1/5pp1/Q6p/5P2/6PK/P4q1P/8/b Qf2f1+ HJ.T26 2k1r3/1p2Bq2/p2Qp3/Pb1p1p1P/2pP1P2/2P5/2P2KP1/1R6/w Rb1xBb5 HJ.T27 6k1/p1B1b2p/2b3r1/2p5/4p3/1PP1N1Pq/P2R1P2/3Q2K1/b Rg6h6 HJ.T28 r2r2k1/1R2qp2/p5pp/2P5/b1PN1b2/P7/1Q3PPP/1B1R2K1/b Ra8b8 HJ.T29 2r1r1k1/pp1q1ppp/3p1b2/3P4/3Q4/5N2/PP2RPPP/4R1K1/w Qd4g4 HJ.T30 r1r2bk1/5p1p/pn4p1/N2b4/3Pp3/B3P3/2q1BPPP/RQ3RK1/b Bf8xBa3 HJ.T31 3r1rk1/p3qp1p/2bb2p1/2p5/3P4/1P6/PBQN1PPP/2R2RK1/b Bd6xPh2+ HJ.T32 2k2b1r/1pq3p1/2p1pp2/p1n1PnNp/2P2B2/2N4P/PP2QPP1/3R2K1/w Pe5xPf6 HJ.001 berliner says soln is Qxf4; Nxe6,Nxe6; Qxe6,Kb8 (Kc7; Qd7+,Kb6; Qd8+); Ne2!,Qg4; Qe5+ r7/pp1n1pbk/3p1qpp/2pP1b2/2P1r3/3BBN1P/PP1Q1PP1/1R3RK1/w Be3g5 HJ.002 white_wins 1B2r3/p4k2/bpq3p1/3p1p1p/3P4/P1N2RQ1/1nPK1PPP/8/b Ba6e2 HJ.003 4r1k1/p5pp/2Q1pb2/4N3/P2p1P2/6P1/4q1KP/1R6/w Kg2g1 HJ.004 white_wins r4rk1/1bp2ppp/p1nb4/1p2N3/P7/1BP4P/1P1B1PP1/R3R1K1/w Ne5xPf7 HJ.005 white_ahead Nxf7,Rxf7; axb,Ne7(Ne5; Bf4); Bf4 4rrk1/pbq3p1/7p/Q4p2/2N1n3/3B3P/PBP2PPb/R4R1K/b Ne4g3+ HJ.006 Ng3+; fxg3,Qxg3; Rf3 (Qd2,Qxh3; or Ne3,Qxh3; Bc4+,Kh7; Bd5,Qh4),B\xf3; gxf3;Bg1; Qd2,Bf2 8/2B2p1p/8/3K4/6k1/8/7P/8/b Pf7f5 HJ.007 f5; Ke5,f4; Ke4,f3; Ke3,h5; Kf2,h4; Bd6,Kh3 equal r3k2r/3bbp1p/p1nppp2/5P2/1p1NP3/5NP1/PPPK3P/3R1B1R/b Be7f8 HJ.008 black_ahead 3rk2r/2qbbppp/p7/2p2PP1/1pN2P2/1P6/P1PQ3P/2KRR3/w Qd2d6 HJ.009 Qd6,Qxd6; Nxd6+,Kf8; Nb7 white_wins r3k2r/1p1b1p2/p2bpnnp/q7/2BNP3/2N5/PPPQ2PP/3R1RK1/w e7d6 HJ.010 Nd5,Nxd5; Qa5,Bb4; exd5,Bxa5; dxe6 equal ILLEGAL r1r2k2/4bp1p/2p1b1p1/B2p4/5Pn1/1NPB4/PP4PP/R1R3K1/w Ba5b6 HJ.011 allegedly black_ahead but berliner says after Bb6; h3! is better and white_ahead 2r2rk1/1p3pp1/q6p/3p4/pQ1bn3/P2NB2N/BP3PPP/1K1R4/b Bd4c3 HJ.012 Bc3!; Qb6,Nd2+; Rxd2,Qxb6; Bxb6,Bxd2; Bxd5 white_ahead r4r1k/p1n2pp1/4b2p/2ppP3/7Q/q1PB4/P3N1PP/1R3R1K/w Rf1f6 HJ.013 Rf6! Kg8; Rbf1 2kr1bnr/pbpq4/1pn1pp2/3p3p/3P1P1B/2N2N1Q/PPP3PP/2KR1B1R/w Pf4f5! HJ.014 white_ahead r5k1/pp2q1p1/3bp2p/2p1p2Q/4Pr2/3P1N2/PPP3PP/R4RK1/w Nf3xPe5 HJ.015 Nxe5,Rh4; Qg6,Bxe5; g3 white_wins r3k2r/1b1nbppp/p2pp3/6P1/1q1NPP2/2N2Q1B/1PP4P/2KRR3/w Nc3d5 HJ.016 white_wins 3r2k1/p3b2p/3pbpp1/7R/1r2P3/1P1B2Q1/q5PP/B4R1K/w Rh5xPh7 HJ.017 white_wins r1bq1r1k/5p1p/p1pp1npQ/1p2n3/2PNP1P1/2NB1P2/PP6/R3K2R/w Nd4xPc6 HJ.018 white_wins rnbq2k1/pp2p1b1/5pQ1/3Np1pB/2Pp2P1/5N2/PP3PP1/R3K3/b Bc8e6 HJ.019 r1r5/pp2ppkp/2npbBp1/8/1q2P3/2NBQP2/PPP3PP/R4RK1/b Pe7xBf6 HJ.020 exf6; if Kxf6; Qh6 4rr1k/p2qn1np/1p1p1ppb/2pPp3/2P1PP2/1P1N1QP1/1B2NRKP/5R2/w Pf4xPe5 HJ.021 white_wins fxe,fxe?; Qxf8+,Rxf8; Rxf8+,Ng8; Bxe5. Actually 1.-- dxe; Bxe5,Nef5! was best defense. 3n2r1/k1p1bp2/1p6/pq1bPR2/2p2Q2/P3NN2/1P1B1P2/2K5/w Pe5e6 HJ.022 white_ahead e6,Nxe6 (fxe; Qxc7+); Qe5 5Q2/pp1b2pk/1b1p2rp/2pP1p2/2P2P2/q1BB4/6PP/4R1K1/w Bc3xPg7 HJ.023 white_wins Qxa3; Bxg7,Rxg7; Bxf5+,Bxf5; Qxf5+ r1bqk2r/pp2bppp/2p5/3pP3/P2Q1P2/2N1B3/1PP3PP/R4RK1/b Pf7f6,Bc8f5 HJ.024 berliner: f6!; Bf5! also works since g4 Bxg4; f5 h5 is not clear at all. 1r4k1/3bppb1/3p1n1p/q1rP4/4PP2/P1N1R3/B2Q1RPN/6K1/b e3c3 HJ.025 black_ahead Rxc3,Nxe4; Rxc8+,Rxc8; Qxa5,Bd4 =3; Nc1! leads to white_ahead, but 1...Qxa3! ILLEGAL r5k1/5ppp/p5q1/Q3p1b1/R1Br4/8/1P3PPP/4R1K1/w Qa5xPe5 HJ.026 Qxe5,Rdd8; Rxa6 white_wins 2r2bk1/pprn1ppb/4p2p/3pP3/q2p2PP/3P1N1B/PPP1RP2/R1BQ2K1/b Rc7xPc2 HJ.027 allegedly equal but 1...Rxc2!!; Bf4 = 3, Bxd3!!; Qxd3,Rxe2; Qxe2,d3! black_ahead. r6k/pp3ppp/2p1p3/8/PPBrN1R1/7P/1Bn2PP1/6K1/b Pf7f5 HJ.028 f5; Bxd4,Nxd4; Rh4,fxe4; Rxe4,Rd8; Bxe6 equal 8/P4pk1/2Np1b2/3P2p1/8/2p5/rr3RPP/5RK1/b Rb2xRf2 HJ.029 Rxf2; Rxf2,Rxa7; Nxa7,Bd4 black_wins 8/R6R/1p1r1kp1/5r2/7P/8/P5PK/8/w Ra7e7 HJ.030 white_wins 2r3k1/2Pr1pp1/p1R2b1p/8/P4P2/6R1/4N1PP/6K1/b Rd7d1+ HJ.031 Rd1+; Kf2,Bh5 black_ahead 7k/R6p/3p1K2/4rP2/6P1/1p2r3/4p3/4R3/b Re5e8 HJ.032 allegedly equal with line Kg8?; Rg7+,Kf8; Rxh7,Ke8; Ra1!,Re7; Ra8+,Kd7; Rxe7+,Rxe7; Ra7+,Kc6; Rxe7,b2; Rxe2,b1=Q; g5; Actually, black_wins with 1...Re8!, and if Rh1,Rf8+; Kg5,Kg8! and now White must play Re1, as Rhxh7 loses to Rxf5+; 2r1k3/3p1pp1/p2Pp3/1p3n2/5P2/1PP2qPK/P2B4/R5Q1/b Rc8c5 HJ.033 Rc5; Rf1,Ne3 2k3rr/pp1b3q/2n5/3ppnp1/P1pP2B1/2P2Q1N/2PB2PP/R4R1K/b Nf5h4 HJ.034 5rk1/ppq1rpp1/7p/2bBp2Q/4P3/2P4R/PP4PP/5R1K/w Rf1f6 HJ.035 2r2rk1/1ppQ1pbp/p4qp1/n7/2B1R3/2P2N1P/PP3PP1/4R1K1/w Bc4xPf7+ HJ.036 Bxf7+ white_ahead r1q2rk1/pp2pp1p/2np1npb/2pN4/2PP2b1/1P2P1P1/P2QNP1P/R1B1R1KB/b Nf6xNd5 HJ.037 Nxd5; cxd5,Nxd4 black_ahead 2r3k1/6p1/p2p1b2/5Qp1/1pqP4/2n1B1P1/P3P1BP/2R3K1/w Bg2d5+ HJ.038 Bd5+ 2kr4/pbp1qp2/1pn3p1/1B1pPp1r/3P1P2/2N2Q2/PPP4P/2KR3R/w Nc3xPd5 HJ.039 Nxd5 = 2; PV Nxd5,Rxd5; Qxd5,Na5; Ba6,Bxa6; Qa8+,Kd7; d5 8/1b1k1p2/p2pp3/1p2b1p1/P2NP1P1/2R1KP2/1PP1N2r/8/b Be5f4+ HJ.040 black_wins K7/2P5/8/4B1k1/8/7p/8/1q6/b Qb1f5 HJ.041 Qf5; Kb7,Qxe5; c8=Q,Qd5+; Ka7,h2; Qc1+,Kh5 = 4; Other sequences exist. 8/2b5/1pP1p3/1P3k2/1N5p/4KPp1/6P1/8/b Bc7e5 HJ.042 white_wins Be5!; f4,Bxf4+; Kf3,e5; Nd5,e4+; Ke2,Bd6; c7,Bxc7; Nxc7,Ke5; Na8,Kd5; Nxb6+,Kc5; Nc4,Kxc4; b6,h3; gxh,g2; Kf2,Kd3; b7,e3+; Kxg2,e2; b8=Q; e1=Q; Qg3+; or 1...h3; gxh,Kg5; Na6,Kh4; Nxc7, Kxh3; Ne6,g2; Nf4+; 1.-- Bf4+; Ke2,Kf6; Nd3,Bc7; f4,Ke7; Kf3,Kd6; Nb4 2k1r3/pp1br3/5pp1/3pn3/2n5/1NP4P/PPB1R1P1/1K1R2N1/b Nc4xPb2 HJ.043 1rbr4/2q1n1kp/1p1R1pp1/3Pp3/pQ2N1P1/P7/1P3PBP/4R1K1/w Ne4xPf6 HJ.044 white_wins r2q1rk1/pp3p1p/2n3p1/2QN4/4R3/3P2bP/PPP3B1/5RK1/b Bg3d6 HJ.045 white_ahead r1b1qrk1/pp1n2b1/3p2pp/2pPp3/2P1BP2/P2N2P1/1P5P/R1BQR1K1/b Pb7b5 HJ.046 berlinersays 1...b5 just does not fly!! b5; cxb,c4; Nb4!,Nc5; Nc6 and Black has nothing to show for the P. r1b5/ppqn2bk/3R2pp/2p2p2/2P1rN2/4BN2/PPQ2PPP/4R1K1/w Rd6xPg6 HJ.047 white_wins 6rk/4q3/pNQpn2b/P3p2p/1P2Pp2/2P2Prp/3R2PN/6RK/w Qc6d7 HJ.048 Qd7 white_ahead; The point is Qd7,Qg5; Qxe6,hxg+; Rdxg2,Rxg2; Qxg8+!,Qxg8; Rxg2 with a fine position. If Qc4,h4 is strong. 8/pp5p/3bNkp1/5p2/2B2P2/P6P/1P4P1/1b4K1/b Pb7b5 HJ.049 b5; Bb3(d5),Bd3 black_wins k2r3r/pq1nbp1p/4pp2/1p6/3PN3/5NP1/1PP1QP1P/1K1RR3/w Pd4d5 HJ.050 white_ahead 3rq2n/2p1r1pk/1p5p/p1p1R2P/P7/1PBP2Q1/2P3P1/5RK1/b Qe8d7 HJ.051 1...Rxe5; Qd7 is even better than the given solution 5r2/r3qpk1/3p2p1/1QpPb3/Pp2P3/1P2PRPB/5RK1/8/w Bh3e6 HJ.052 r1b2rk1/1p2b1p1/p1q1pnB1/4p3/4N3/4B3/PPP4P/R2Q1RK1/b e5 HJ.053 e5,dxe; Ne4,Nxe4; Rxf8+,Kxf8; Qh5,Bc5! equal ILLEGAL 3r2k1/2p1p2p/2p1p1pB/p1PrP3/8/P2bR2P/1P3RP1/6K1/w Pg2g4 HJ.054 Nxf7,Rxf7; Bxe6,Nf6; Bxh6 white_ahead r2q1rk1/3n1pp1/bp2p2p/2b1N3/p7/P4Q2/BPP2PPP/R1B1R1K1/w Ne5xPf7 HJ.055 b3,Qa3; Bc1 Qxa2; Rd2 Qb1; O-O white_ahead; Unsound would be b6; b4 Qb3!!; Rd3 Qxc3; Rxc3 c5!; bxa5 cxd black_ahead 1r3rk1/ppp2pbp/4p1p1/n3P3/q2P3P/2Q1BB2/PP3PP1/3RK2R/w Pb2b3 HJ.056 berliner has doubts this solution is good 1qr3r1/p3k3/1p1p1bp1/4pP1p/4P1b1/1N1QB3/PPPR3P/1K4R1/w Rg1xBg4 HJ.057 8/2p3r1/1p2kb2/p3pRp1/P1NrP2p/3P3P/1P2KP2/2R5/w Nc4xPb6 HJ.058 r1q2r1k/p4Ppp/1p6/2pBn2n/4P1b1/2P2N2/P3QPPP/R1B2RK1/w Kg1h1 HJ.059 r3k1nr/1pp3pp/p2b1p2/N1p5/4P1b1/5P2/PPP3PP/RNBR2K1/b Bg4c8 HJ.060 rn1q1r1k/ppp1pPbp/6p1/4n3/2B3b1/5N2/PPP1QPPP/RNB2RK1/w Nf3xNe5 HJ.061 r4rk1/5n1p/3p1qn1/1Bp3pQ/P3RP2/6P1/1PN4P/2KR4/b Pg5xPf4 HJ.062 1k1r1r2/1p2bNp1/2p1p3/8/3P3p/4P3/PPP5/2KR1R2/w * HJ.M01 1k1N1r2/1p2b1p1/2p1p3/8/3P3p/4P3/PPP5/2KR1R2/b * HJ.M02 r1bqk2r/pppp1ppp/5n2/n5B1/2PNP3/2P5/P4PPP/R2QKB1R/b * HJ.M03 r1b1k2r/pppp1pp1/5q1p/n7/2PNP3/2P5/P4PPP/R2QKB1R/w * HJ.M04 rqb2rk1/1p3pp1/p2p3p/n1p4Q/2P1PP2/N1PB1R2/P5PP/R5K1/b * HJ.M05 r3q1rk/1p1b1pp1/p2p3p/n1pN3Q/2P1PP2/2PB1RR1/P5PP/6K1/b * HJ.M06 r1bqk2r/ppp1nppp/2np4/4P3/2B5/N1P2N2/P4PPP/R2Q1RK1/b * HJ.M07 r2q1rk1/ppp1nppp/2npP3/8/2B3b1/N1P2N2/P3QPPP/R4RK1/b * HJ.M08 r1b1kb1Q/pp1n2p1/2n1pqp1/3p4/3p1N2/2P5/PP1N1PPP/R1B1K2R/w * HJ.M09 r1b1kb1Q/pp4p1/2n1p1p1/2npq3/8/2Pp2N1/PP1N1PPP/R1B2K1R/w * HJ.M10 gnuchess-4.0.pl70/test/CHESSTEST/jenoban.fin100644 21542 13 33144 5527662451 17472 0ustar cracraftuser#Jeno Ban: #The tactics of endgames, #Corvina press, 2nd edition 1963, #printed at Athenaeum printing house, Budapest 1972. # #This is a collection of endgame studies, hence all moves are unique #and best (if there wasnt an error) with the sole (?) exception of #position 220. In all except 2 positions, (195 and 196) white is to #move. Stalemate and underpromotion (N,B,R) themes are all included. #Diagrams 163-176 unfortunately were missing from my copy of the book #hence not included here; they all concern the theme "driving on". #Misprints: #Diagram 34 had the kings of the wrong color, apparently; now fixed. #Diagram 26 really does have two black queens. # 8/8/7P/8/5R2/8/3r4/K1k5/w Ph6h7 (JenoBan_TofE) #17 white_wins 8/7p/3p4/8/6pP/8/4PK2/7k/w Kf2g3 (JenoBan_TofE) #18 draw 2k5/3p2p1/2p5/2K5/5P2/8/2P5/8/w Kc5d6 (JenoBan_TofE) #19 draw 8/3Pk1p1/8/1K3Pp1/8/8/8/8/w Kb5c6 (JenoBan_TofE) #20 draw 2K5/7p/8/8/6pP/8/2k3P1/8/w Kc8d7 (JenoBan_TofE) #21 draw 3k4/3p3p/3p4/PK6/4P3/8/8/8/w Kb5b6 (JenoBan_TofE) #22 draw 1k6/8/p5p1/6p1/6P1/5P1P/6PK/8/w Pf3f4 (JenoBan_TofE) #23 draw 8/1p6/1P1p4/1K1p2B1/P2P4/6pp/1P6/5k2/w Bg5d2 (JenoBan_TofE) #24 draw 1r6/1B6/8/8/5k1b/8/1B4P1/6K1/w Pg2g3+ (JenoBan_TofE) #25 draw k3q3/q1p5/8/5Q2/8/8/3K4/5R2/w Rf1a1 (JenoBan_TofE) #26 draw 5B2/8/5P1K/q7/5k2/8/8/8/w Bf8d6+ (JenoBan_TofE) #27 draw 8/1q4PK/8/6P1/6k1/8/7P/8/w Kh7h8 (JenoBan_TofE) #28 draw 7b/8/kq6/8/8/1N2R3/K2P4/8/w Nb3d4 (JenoBan_TofE) #29 draw 4k3/8/4K3/b7/8/4p3/6pP/2R5/w Ke6f5 (JenoBan_TofE) #30 draw R7/8/3bN3/7p/7K/p1k5/6p1/8/w Ne6f4 (JenoBan_TofE) #31 draw 8/8/2p5/pkp3R1/7B/P7/2p3K1/8/w Pa3a4+ (JenoBan_TofE) #32 draw 8/8/8/6p1/6P1/6pp/7p/1R3K1k/w Rb1e1 (JenoBan_TofE) #33 draw 8/1R6/1p6/4K3/6k1/7r/2pP4/8/w Rb7g7+ (JenoBan_TofE) #34 draw 1k6/R7/K7/8/8/8/2p5/8/w Ra7b7+ (JenoBan_TofE) #35 draw 2R5/2P5/K1k5/1r6/8/8/2p5/8/w Rc8g8 (JenoBan_TofE) #36 draw 8/1p3k2/3K4/8/3Pp2R/8/6p1/6b1/w Rh4f4+ (JenoBan_TofE) #37 draw 4k3/6b1/6N1/8/2R5/8/K2p4/8/w Rc4e4+ (JenoBan_TofE) #38 draw 8/8/Pk2N3/4n3/1B6/1P1p4/K4p2/8/w Bb4c5+ (JenoBan_TofE) #39 draw 8/5k1K/8/4R3/4p3/pb6/8/8/w Re5xPe4 (JenoBan_TofE) #40 draw 8/2p5/2P1p3/4P1p1/7k/p6P/6PB/6K1/w Pg2g4 (JenoBan_TofE) #41 draw 3N4/8/3k1P2/8/8/2p2p1p/7P/7K/w Pf6f7 (JenoBan_TofE) #42 draw 1r6/4kP2/6PK/8/8/8/8/8/w Kh6h7 (JenoBan_TofE) #43 draw 8/8/4PkPK/8/3N1r2/8/8/8/w Nd4f5 (JenoBan_TofE) #44 draw 4r3/Kp6/5P2/1k2P3/8/8/8/8/w Pf6f7 (JenoBan_TofE) #45 draw 3k4/1K6/1P6/5p2/B1p5/8/3b4/8/w Kb7a6 (JenoBan_TofE) #46 draw 8/6B1/1r1P4/8/4K3/8/7b/2k5/w Bg7e5 (JenoBan_TofE) #47 draw 1N5k/8/8/4K2N/8/p7/8/8/w Nb8d7 (JenoBan_TofE) #50 draw 4k3/3pp3/6P1/1N6/6B1/8/p4K2/8/w Bg4xPd7+ (JenoBan_TofE) #51 draw 5B1k/7p/6P1/4NnP1/8/8/K4p2/8/w Pg6g7+ (JenoBan_TofE) #52 draw 4K3/2k1Bp1N/6p1/5PP1/8/7p/b7/8/w Be7f6 (JenoBan_TofE) #53 draw 8/3k4/2p5/8/p1p5/PpP5/1P2B3/r1NK4/w Be2g4+ (JenoBan_TofE) #54 draw 8/8/3b2P1/6P1/1k6/8/2B1r3/1K6/w Pg6g7 (JenoBan_TofE) #55 draw 2K3k1/1p6/R3p1p1/1rB1P1P1/8/8/1Pb5/8/w Ra6c6 (JenoBan_TofE) #56 draw 3k4/6b1/6P1/8/1p6/3b4/1P3B2/4K3/w Bf2b6+ (JenoBan_TofE) #58 draw 2k1b3/3n4/8/8/3N4/4K3/8/4n3/w Ke3e2 (JenoBan_TofE) #59 draw 6b1/1B6/3P4/5n2/K1n5/8/4k3/8/w Pd6d7 (JenoBan_TofE) #60 draw 2n1b3/8/2r5/3k3n/8/3B4/1R5K/8/w Bd3b5 (JenoBan_TofE) #61 draw 3n4/6k1/6P1/1KP5/8/8/8/3b4/w Pc5c6 (JenoBan_TofE) #62 draw 6k1/8/8/1K4p1/3p2P1/2pp4/8/1R6/w Kb5c6 (JenoBan_TofE) #63 draw 3N4/8/8/3b4/6K1/5p2/8/7k/w Kg4g3 (JenoBan_TofE) #64 draw 8/K7/4N3/3k4/5R2/6n1/4p3/8/w Rf4f6 (JenoBan_TofE) #65 draw 3n4/8/2P5/8/5p2/p2N3k/7p/5K2/w Nd3f2+ (JenoBan_TofE) #66 draw q7/p7/4b3/B6p/7k/7P/5P1K/5B2/w Pf2f4 (JenoBan_TofE) #67 draw 1b5q/5Pp1/8/1BN4k/8/7P/6K1/8/w Nc5d7 (JenoBan_TofE) #68 draw 5R2/4K3/5P2/4k1pp/1Pp5/2P1P2P/1P3q1P/8/w Rf8e8 (JenoBan_TofE) #69 draw 6k1/8/4K3/1R5p/8/2N5/n2q3B/8/w Nc3e4 (JenoBan_TofE) #70 draw 8/r3k2B/7P/n1K5/7P/8/8/8/w Bh7g8 (JenoBan_TofE) #71 draw 8/k7/2K5/8/8/8/6pp/1R6/w Rb1a1+ (JenoBan_TofE) #72 draw 1b2K3/1P6/6n1/1P2k3/8/8/8/8/w Ke8d8 (JenoBan_TofE) #73 draw 8/8/p5r1/1p6/1P1R4/8/5K1p/7k/w Rd4d1+ (JenoBan_TofE) #74 white_wins 6k1/2Q5/6q1/8/7K/5B2/8/8/w Bf3d5+ (JenoBan_TofE) #75 white_wins 1q1r4/4k3/8/2R3K1/8/8/8/2Q5/w Rc5c7+ (JenoBan_TofE) #76 white_wins 8/8/2k4b/P7/8/8/2N2PKp/8/w Nc2d4+ (JenoBan_TofE) #77 white_wins 5rk1/5p2/4P2P/8/4pR2/8/4K3/8/w Rf4f6 (JenoBan_TofE) #78 white_wins r2k1B2/7R/p7/8/8/8/8/4K3/w Bf8c5 (JenoBan_TofE) #79 white_wins 8/2b5/8/4N3/8/4K3/8/3Bk1B1/w Bd1g4 (JenoBan_TofE) #80 white_wins 6k1/8/5pPp/5P2/7K/8/8/8/w Kh4g4 (JenoBan_TofE) #81 white_wins 6k1/8/3K2p1/8/6P1/8/8/8/w Pg4g5 (JenoBan_TofE) #82 draw 2Q5/8/8/4p3/8/K7/4kp2/8/w Qc8c4+ (JenoBan_TofE) #83 draw 8/8/1p6/pP3K1p/P7/6kP/8/8/w Kf5e4 (JenoBan_TofE) #84 draw 4N3/8/6p1/8/8/7p/5K1k/8/w Ne8f6 (JenoBan_TofE) #85 white_wins 8/8/4pN2/6p1/5p2/7p/8/5K1k/w Nf6g4 (JenoBan_TofE) #86 white_wins 1knK4/n7/3N4/2N5/8/8/8/8/w Nc5d7+ (JenoBan_TofE) #87 white_wins 4k3/8/8/6pP/6B1/8/7K/8/w Bg4e6 (JenoBan_TofE) #88 white_wins 8/Bpk5/8/P2K4/8/8/8/8/w Kd5d4 (JenoBan_TofE) #89 white_wins 8/1p6/8/5N2/p1K4B/p7/2k5/8/w Nf5d4+ (JenoBan_TofE) #90 white_wins n7/7k/4p3/B7/6N1/8/8/6K1/w Ng4e5 (JenoBan_TofE) #91 white_wins 7K/k7/8/P7/6pP/8/8/8/w Pa5a6 (JenoBan_TofE) #92 draw 8/1p6/7R/1k6/8/8/pP4PP/2K5/w Rh6h5+ (JenoBan_TofE) #93 white_wins 6q1/3p4/4pp2/2P2k2/7K/3PP3/2R5/1B6/w Rc2f2+ (JenoBan_TofE) #94 white_wins 5rk1/3qPb2/8/7P/8/3B4/8/1K1R4/w Bd3h7+ (JenoBan_TofE) #95 white_wins 1k1K4/1p6/pP2B3/P4p2/6p1/8/8/8/w Kd8d7 (JenoBan_TofE) #96 white_wins 8/8/8/8/8/1Q3pp1/p5p1/k5K1/w Qb3b6 (JenoBan_TofE) #97 white_wins 8/8/1KP5/3r4/8/8/8/k7/w Pc6c7 (JenoBan_TofE) #98 white_wins 8/8/2P5/1Pr5/8/8/N7/k2K4/w Na2c1 (JenoBan_TofE) #99 white_wins 8/8/3PR3/8/1k3p2/5P2/3p2K1/8/w Re6e4+ (JenoBan_TofE) #100 white_wins 8/8/1P6/8/2N1k3/2K3p1/6r1/8/w Pb6b7 (JenoBan_TofE) #101 white_wins 8/7p/6pP/1B4P1/pp6/1k1K4/8/8/w Bb5e8 (JenoBan_TofE) #102 white_wins k7/1p6/nP1P2K1/8/r5R1/8/4B3/r7/w Pd6d7 (JenoBan_TofE) #103 white_wins 8/p3B2p/1P5P/3P4/5r2/3k4/8/6K1/w Pb6b7 (JenoBan_TofE) #104 white_wins 7k/5p1p/8/7N/P1P5/8/K1R5/6q1/w Rc2e2 (JenoBan_TofE) #105 white_wins 8/6Pk/8/7P/B6K/8/8/1b6/w Ph5h6 (JenoBan_TofE) #106 white_wins 8/8/2Q5/2K5/4N3/6p1/k5q1/8/w Ne4c3+ (JenoBan_TofE) #107 white_wins 8/5q2/1Q6/4k3/1N6/8/3K4/8/w Nb4c6+ (JenoBan_TofE) #108 white_wins 1b6/8/1N4Pk/8/8/B6K/8/8/w Nb6d7 (JenoBan_TofE) #109 white_wins 8/3k4/1K6/8/4BR2/4p3/4p3/8/w Be4f5+ (JenoBan_TofE) #110 white_wins 6R1/8/8/2B5/8/5K2/7p/7k/w Kf3g4 (JenoBan_TofE) #111 white_wins 8/8/5N2/B1pK4/1p6/k7/8/8/w Nf6e4 (JenoBan_TofE) #112 white_wins 8/8/3q4/8/1P2K3/8/Q7/7k/w Qa2d5 (JenoBan_TofE) #115 white_wins 8/6p1/4p3/2k2q2/1R3N2/B7/K7/8/w Nf4g6 (JenoBan_TofE) #116 white_wins k7/P7/8/2PK4/3p4/3P1B2/7p/6b1/w Pc5c6 (JenoBan_TofE) #117 white_wins 7k/7b/8/p1P1Kp2/5B2/p7/8/8/w Pc5c6 (JenoBan_TofE) #118 white_wins 7R/q7/4k3/1p5p/1p6/4P3/2P2PK1/6B1/w Rh8h6+ (JenoBan_TofE) #119 white_wins 8/5K2/3pp3/8/5k1p/3p3Q/q3P3/8/w Qh3f3+ (JenoBan_TofE) #120 white_wins 5R2/8/2p1qP2/3p4/k7/8/3Pp3/2K1B3/w Pf6f7 (JenoBan_TofE) #121 white_wins 8/B1p2p1P/8/4p3/8/k7/p2K4/8/w Ba7d4 (JenoBan_TofE) #122 white_wins 3B4/1p6/4p1p1/2P1k1P1/2P5/6N1/2KP1P2/4q3/w Pc5c6 (JenoBan_TofE) #123 white_wins q4k2/p2pp2K/8/2R1P3/4N3/3P4/P7/8/w Pe5e6 (JenoBan_TofE) #124 white_wins 1Q6/8/p2N1k2/q2p4/P3p1K1/8/8/6n1/w Qb8f8+ (JenoBan_TofE) #125 white_wins 6q1/3p4/p4p2/P1kP2p1/4P1R1/2Np4/1P6/1K6/w Pe4e5 (JenoBan_TofE) #126 white_wins R7/Pp2b1p1/8/8/4p3/8/k1K3p1/8/w Ra8h8 (JenoBan_TofE) #127 white_wins R7/3p3p/8/3P2P1/3k4/1p5p/1P1NKP1P/7q/w Pg5g6 (JenoBan_TofE) #128 white_wins 8/8/3P4/7B/8/1k2r3/1P6/3K4/w Bh5g6 (JenoBan_TofE) #129 white_wins 8/8/P7/4k3/7B/8/1K6/6r1/w Pa6a7 (JenoBan_TofE) #130 white_wins 8/3p4/8/2P5/8/2pK4/p6R/1k6/w Pc5c6 (JenoBan_TofE) #131 white_wins 8/6pk/1pp1p3/1R4P1/1K3N2/8/2Pp4/8/w Pg5g6+ (JenoBan_TofE) #132 white_wins 7K/6p1/8/7p/8/8/R7/6k1/w Kh8h7 (JenoBan_TofE) #133 white_wins 4k3/3p1N2/8/P1P4b/8/8/8/6K1/w Pc5c6 (JenoBan_TofE) #134 white_wins 6k1/8/4KP2/4N3/8/8/1b6/8/w Ke6e7 (JenoBan_TofE) #135 white_wins 8/3p3p/3B3k/P1Pp1p1P/8/8/5P2/1b5K/w Pc5c6 (JenoBan_TofE) #136 white_wins 1r6/4P1P1/8/7k/8/7N/8/4K3/w Nh3f4+ (JenoBan_TofE) #137 white_wins 8/8/P7/3p3r/3k3B/3P4/5K2/8/w Pa6a7 (JenoBan_TofE) #138 white_wins 1kr5/4P1Pp/8/8/8/B7/7K/8/w Pe7e8=Q (JenoBan_TofE) #139 white_wins 4k3/B1Kp3p/P1p5/7P/2p5/8/2P4r/8/w Ba7f2 (JenoBan_TofE) #140 white_wins 4B3/8/k7/P7/8/8/3r3p/7K/w Be8f7 (JenoBan_TofE) #141 draw 8/8/3P4/2r5/4B2k/4r1p1/8/5R1K/w Pd6d7 (JenoBan_TofE) #142 white_wins 5N1k/8/2nPP3/P7/5p1r/3b4/5P2/3K4/w Pd6d7 (JenoBan_TofE) #143 white_wins K7/2b5/3p1p2/4k3/4P3/4N3/8/2B5/w Ka8b7 (JenoBan_TofE) #144 white_wins 4B3/8/6N1/5p2/1r4p1/6pk/7b/4K2Q/w Be8c6 (JenoBan_TofE) #145 white_wins 4n2k/8/5nP1/7P/8/4K3/3R4/8/w Ph5h6 (JenoBan_TofE) #146 white_wins 6N1/n7/3kn3/K7/6N1/8/8/4B3/w Ka5b6 (JenoBan_TofE) #147 white_wins 4kr2/R4p2/6p1/8/1K6/3B4/8/8/w Bd3f5 (JenoBan_TofE) #148 white_wins 8/6k1/1B6/4n3/8/7p/8/3K4/w Bb6g1 (JenoBan_TofE) #149 draw 8/2pp2pp/8/2PP1P2/1p5k/8/PP4p1/6K1/w Pf5f6 (JenoBan_TofE) #150 white_wins 8/pp3pb1/P1p5/2K1k2B/5p1p/3P4/3P2P1/8/w Pd3d4+ (JenoBan_TofE) #151 white_wins 7B/8/5R2/8/8/7p/4K2p/7k/w Rf6f8 (JenoBan_TofE) #152 white_wins 3K4/8/8/p7/3N4/8/pn1B4/k7/w Nd4c2+ (JenoBan_TofE) #153 white_wins 1k6/1p1p4/PK2p3/5p1p/6pP/8/8/5B2/w Pa6a7+ (JenoBan_TofE) #154 white_wins 8/8/2r3pP/6P1/8/K7/7k/3B4/w Bd1h5 (JenoBan_TofE) #155 white_wins 3q2r1/6P1/p7/8/8/k3N1Qp/8/2K5/w Ne3c2+ (JenoBan_TofE) #156 white_wins 8/5q2/1Q5K/8/4k3/8/3B4/8/w Qb6e3+ (JenoBan_TofE) #157 white_wins 7k/8/2P3n1/8/8/3pN1K1/8/8/w Ne3f5 (JenoBan_TofE) #158 white_wins 6n1/8/k3N3/8/8/K7/2b5/4R3/w Ne6d4 (JenoBan_TofE) #159 white_wins 1n6/7k/8/b7/8/4R3/6P1/3K4/w Re3b3 (JenoBan_TofE) #160 white_wins K7/2rp4/8/2p3P1/8/8/5R2/7k/w Ka8b8 (JenoBan_TofE) #161 white_wins 8/3p4/6P1/8/b4R2/8/K2p2Pk/8/w Rf4h4+ (JenoBan_TofE) #162 white_wins (i think this move is right: pages 145-160 missing in my copy of book) 8/2p4k/P7/4K3/4P3/p7/6r1/2R5/w Pa6a7 (JenoBan_TofE) #177 white_wins 8/R1p5/5pP1/8/8/7K/1k6/2r5/w Ra7b7+ (JenoBan_TofE) #178 white_wins 2K5/1P6/2k5/7p/8/6b1/8/2B5/w Bc1e3 (JenoBan_TofE) #179 white_wins 3B4/6b1/6P1/2p5/P1k5/8/8/5K2/w Bd8a5 (JenoBan_TofE) #180 white_wins K2n4/8/P7/8/2k5/8/2N5/8/w Ka8a7 (JenoBan_TofE) #181 white_wins 8/8/5p2/5p2/5P2/3p3B/5k1P/3K4/w Bh3g2 (JenoBan_TofE) #182 white_wins 8/3p3B/1n2P2r/8/8/7k/R4P2/7K/w Pe6e7 (JenoBan_TofE) #183 white_wins 8/8/B3P3/3k4/5K2/2P4b/8/8/w Ba6c8 (JenoBan_TofE) #184 white_wins 8/8/P5b1/8/k7/p1P2p1B/3K4/8/w Kd2e3 (JenoBan_TofE) #185 white_wins 2k2K2/8/3n2P1/8/4b3/8/2P1B3/8/w Pg6g7 (JenoBan_TofE) #186 white_wins 8/p6k/3P4/4p3/3p4/6r1/2P5/R6K/w Ra1a3 (JenoBan_TofE) #187 white_wins 8/kp2q3/pR2r2r/1Pp5/7R/1P2Q2P/4K3/8/w Rb6xRe6 (JenoBan_TofE) #188 white_wins 7k/4p3/3pPp2/2pP4/1pP5/1P6/P7/K7/w Pa2a4 (JenoBan_TofE) #191 white_wins 8/7k/4K2p/6p1/6P1/7P/8/8/w Ke6f7 (JenoBan_TofE) #192 white_wins 8/pp4p1/4k1P1/3p4/3P4/2P5/4K2P/8/w Pc3c4 (JenoBan_TofE) #193 white_wins 8/6p1/8/5p1P/5P2/6P1/8/5K1k/w Kf1e1 (JenoBan_TofE) #194 white_wins 8/8/8/1p5r/p1p1k1pN/P2pBpP1/1P1K1P2/8/b Pb5b4 (JenoBan_TofE) #195 black_wins 8/pR4pk/1b6/2p5/N1p5/8/PP1r2PP/6K1/b Rd2xPb2 (JenoBan_TofE) #196 black_wins 8/1p6/7p/5p1P/5P2/1p6/6RK/k7/w Rg2g5 (JenoBan_TofE) #197 white_wins 8/r7/Pp4Pp/7k/p7/7K/6P1/R7/w Pg6g7 (JenoBan_TofE) #198 white_wins 8/4B3/2K1P3/8/8/8/k1p5/2b5/w Be7b4 (JenoBan_TofE) #199 draw 2K5/2P2R2/k7/8/8/8/2r2p2/8/w Kc8b8 (JenoBan_TofE) #200 white_wins 1B6/8/7P/4p3/3b3k/8/8/2K5/w Bb8a7 (JenoBan_TofE) #201 white_wins 6n1/3p4/8/1P2k1n1/4P3/B5K1/3P4/8/w Pd2d4+ (JenoBan_TofE) #202 white_wins 8/4pp2/p1P2p2/8/P1P2R2/K1kr1P2/P7/8/w Pc6c7 (JenoBan_TofE) #203 white_wins 8/KPb5/8/P5p1/5p2/3k4/7P/2B5/w Bc1a3 (JenoBan_TofE) #204 white_wins 1N6/8/K7/3k4/3p3B/p7/2PP4/8/w Nb8c6 (JenoBan_TofE) #205 white_wins 3N4/8/2P4k/8/8/3B4/n6K/2b5/w Kh2g3 (JenoBan_TofE) #206 white_wins 8/6q1/2k2r2/8/1K6/8/4R3/5Q2/w Re2e6+ (JenoBan_TofE) #207 white_wins K7/1P6/k1q5/8/8/1Q6/8/8/w Qb3b4 (JenoBan_TofE) #208 white_wins 6K1/8/pp5p/8/7k/3PP3/8/8/w Pd3d4 (JenoBan_TofE) #209 white_wins 4k3/8/3RK2P/8/p7/8/6r1/8/w Ke6f6 (JenoBan_TofE) #210 white_wins 2k5/5N2/8/8/8/1b2K3/6B1/3N4/w Nf7d6+ (JenoBan_TofE) #211 white_wins 8/8/7P/8/5N2/1k6/1p3b2/1K6/w Nf4e6 (JenoBan_TofE) #212 white_wins 8/1p6/1p6/6N1/6p1/4k3/K7/8/w Ng5h7 (JenoBan_TofE) #213 draw 4q3/5N2/B7/8/3k3B/8/1K6/8/w Bh4f2+ (JenoBan_TofE) #214 white_wins 6q1/6p1/2k4p/R6B/p7/8/2P3P1/2K5/w Ra5a8 (JenoBan_TofE) #215 white_wins 8/4B2p/8/3p3P/8/3Pk1K1/p7/6N1/w Be7f6 (JenoBan_TofE) #216 white_wins 8/6p1/k1P2p1p/7K/8/8/8/8/w Kh5g6 (JenoBan_TofE) #217 draw 5K2/k7/4P1p1/8/8/8/4b3/8/w Kf8e7 (JenoBan_TofE) #218 draw 2K2N2/2B5/p1p4p/2k5/2P5/7p/8/8/w Kc8b7 (JenoBan_TofE) #219 white_wins 8/4K3/8/3pk3/3R4/8/8/8/w Rd4d2,Rd4d3 (JenoBan_TofE) #220 white_wins 1k6/1P6/2P5/P7/5ppp/8/6K1/8/w Kg2g1 (JenoBan_TofE) #221 white_wins 8/8/8/8/1bk5/2r5/1KP2B2/R7/w Ra1a4 (JenoBan_TofE) #222 white_wins 3b3k/4n3/8/8/7B/8/8/5KR1/w Bh4f6+ (JenoBan_TofE) #223 white_wins 8/5k2/8/2BR4/b7/8/1P2p1Kp/1n6/w Rd5e5 (JenoBan_TofE) #224 white_wins 2R5/k2Bn3/1pP5/8/b7/2K5/8/8/w Rc8c7+ (JenoBan_TofE) #225 white_wins 1R1K4/8/3n4/1b6/1P6/8/8/7k/w Rb8b6 (JenoBan_TofE) #226 white_wins 6k1/1B5p/1p6/3n4/3r4/7P/5KP1/2R5/w Rc1c4 (JenoBan_TofE) #227 white_wins 1r3k2/8/3b2p1/3P4/1p6/6P1/K4B2/7R/w Bf2c5 (JenoBan_TofE) #228 white_wins 8/8/5P1k/8/2K5/pr2r3/4R3/2R5/w Pf6f7 (JenoBan_TofE) #229 white_wins 3r2r1/7k/8/7K/8/8/8/3RR3/w Re1e7+ (JenoBan_TofE) #230 white_wins 8/8/B7/3K4/8/6p1/7k/5R2/w Rf1f3 (JenoBan_TofE) #231 white_wins 6k1/4K3/6PP/8/7B/8/8/7r/w Ph6h7+ (JenoBan_TofE) #232 white_wins 5k2/4p2p/6P1/3K4/8/4B3/8/8/w Be3h6+ (JenoBan_TofE) #233 white_wins 1NBk4/p2p4/8/3K4/8/8/8/8/w Bc8b7 (JenoBan_TofE) #234 white_wins 8/4q3/2p5/2n2Q2/p5N1/7k/8/1K6/w Ng4e3+ (JenoBan_TofE) #235 white_wins 8/3b2Bq/8/7p/6k1/8/6K1/Q7/w Qa1d4+ (JenoBan_TofE) #236 white_wins R7/6N1/8/4p3/4k3/6n1/7b/3K4/w Ra8a2 (JenoBan_TofE) #237 white_wins 8/3b4/k2p3P/1p1K3P/1P4r1/8/3R4/8/w Ph6h7 (JenoBan_TofE) #238 white_wins 5q2/n2P1k2/2b5/8/8/3N4/4BK2/6Q1/w Qg1g5 (JenoBan_TofE) #239 white_wins gnuchess-4.0.pl70/test/CHESSTEST/kcmdm.fin100644 21542 13 31043 5527662451 17145 0ustar cracraftuser#Test Positions from the book "Master chess, a course in 21 lessons", #Pergamon Press 1985. #By D. Kopec, G. Chandler, C. Morrison, N. Davies, I.D. Mullen. # #Pages 13,14,29-34, 105-106, 111-112, 115-117, 119-123 #were scanned in by Kevin Lang Apr 12 1993. #The rest were typed in by Warren Smith. # # #LESSONS 1-4: TACTICS AND COMBINATIONS #begin examples from (Kopec-Lessons-1-4) 3r1rk1/pppb2p1/3ppbP1/8/q7/2P4B/PP3PP1/K1NR1Q1R/w Rd1d4 (Kopec-Lessons-1-4) (1 page 3) r1b2rk1/3p1ppp/1q3n2/1p6/pN2N3/4PP2/PPR4P/KQ4R1/w Rc2c6 (Kopec-Lessons-1-4) (3 page 3) 5rk1/q2p1ppp/8/1p3N2/1np5/P7/1PQ2PP1/KR6/w Nf5e7+ (Kopec-Lessons-1-4) (5 page 4) r1b1k2r/p1ppbN1p/2n5/6pQ/2p5/8/PP3PPP/6K1/w Nf7d6+ (Kopec-Lessons-1-4) (6 page 6) r1bq1rk1/pp1n1ppp/2n1p3/3pP3/3P4/2PB1N2/P4PPP/R1BQ1RK1/w Bd3xPh7+ (Kopec-Lessons-1-4) (7 page 6) r1bqkb1r/1ppp1ppp/p1n5/4N3/8/2n5/PPPP1PPP/R1BQR1K1/w Ne5xNc6+ (Kopec-Lessons-1-4) (9 page 7) 5rk1/1p3ppp/p1b5/3pN2q/5r2/QP6/PB3PPP/2R1R1K1/w Qa3xRf8+ (Kopec-Lessons-1-4) r2qk2r/ppp2ppp/2np1n2/4p3/1bP3b1/1QN1P1P1/PP1PNPBP/R1B1K2R/b Ra8b8 (Kopec-Lessons-1-4) (12 page 8) 3r1rk1/bpq2ppp/p1b1p3/2P5/1P2B3/P4Q2/1B3PPP/2R2RK1/w Be4xPh7+ (Kopec-Lessons-1-4) (13 page 9) r1r3k1/qb1N1ppp/p3p3/1pbn2B1/8/4P3/PP2QPPP/1B1R1RK1/w Rd1xNd5 (Kopec-Lessons-1-4) (14 page 9) r2qk3/p1ppb2p/b1p1r1pN/2n5/8/2N1B2Q/PPP2PPP/R2R2K1/w Nh6f7 (Kopec-Lessons-1-4) (14 page 10) r4rk1/p1pq1ppp/2pb4/2n1pN2/4P3/5Q1P/PPP2PP1/R1BR2K1/w Bc1h6 (Kopec-Lessons-1-4) (17 page 11) 7k/1p2q2p/3N4/2Q1b3/5r2/1P2p2P/P5P1/3R2K1/w Nd6f5 (Kopec-Lessons-1-4) (34 page 16) 5rk1/6pp/bpp1N3/p2p1p2/3P4/2P5/PP3PPP/5RK1/w Ne6xRf8 (Kopec-Lessons-1-4) (35 page 17) 2r5/p4pkp/q5p1/p7/8/2b1N2P/P4PP1/2RQ2K1/w Rc1xBc3 (Kopec-Lessons-1-4) (36 page 17) 8/pp3pk1/5np1/Bp4p1/6P1/1P3P2/P3K3/8/w Ba5c3 (Kopec-Lessons-1-4) #37 8/3r1k2/p3q1p1/4P1P1/8/P1KQ4/8/5B2/w Qd3xRd7+ (Kopec-Lessons-1-4) #38 8/8/8/7r/2R5/3k4/8/R2K4/w Rc4h4 (Kopec-Lessons-1-4) (39 page 18) 6k1/2r3pp/1p1p2P1/p3p3/8/2P1PR2/1P3PK1/8/w Rf3f8+ (Kopec-Lessons-1-4) (40 page 19) 2r3k1/2P2pp1/4r2p/8/7B/6P1/5PKP/3R4/w Rd1d8+ (Kopec-Lessons-1-4) (41 page 19) 3r2k1/6P1/4q3/8/8/6P1/2Q3KP/5R2/w Rf1f8+ (Kopec-Lessons-1-4) (42 page 19; RxRf8, 2. Qh7+ KxQ, 3 gxf8=N+ and wins) r1b2rk1/pppn1pp1/7p/4N3/8/3B3P/PPP2PP1/3R1RK1/w Ne5xNd7 (Kopec-Lessons-1-4) (43 page 20) 2r5/1pkr4/p1p2n1p/8/1PN3PP/P1KR4/8/3R4/w Rd3xRd7+ (Kopec-Lessons-1-4) (44 page 20) 3r4/p1k5/8/2p5/2P4P/p1P3P1/P4P2/5K1R/b Rd8d1+ (Kopec-Lessons-1-4) (45 page 20, 2. Kg2 Rxh1 3. Kxh1 Kb6 forcing stalemate) 6K1/8/8/8/8/3b4/3P2kp/R7/w Kg8h8 (Kopec-Lessons-1-4) (forces draw. 46 page 21.)) 8/p1k5/P4b2/2PP4/2K3B1/8/8/8/b Bf6e7 (Kopec-Lessons-1-4) (draws. 48 page 21) k2rb2r/pp2n2p/2N1p3/1N1q2p1/5Q2/2PP3P/1P3PP1/R4RK1/b Qd5xPg2+ (Kopec-Lessons-1-4) (at least draws and saves the day 49 page 22) r1b2r1k/pp2N1bp/3p2p1/4p3/2qBP3/8/PPPQ2P1/2KR3R/b Bc8g4 (Kopec-Lessons-1-4) (50 page 22) r5k1/pb2rpp1/1p6/7q/3R4/2PB2Q1/P1P3PP/5R1K/w Rd4h4 (Kopec-Lessons-1-4) (52 page 23) LESSONS 5-8: HOW TO ANALYSE A POSITION begin examples from (Kopec-Lessons-5-8) r3rnk1/pp1qbpp1/5n1p/1P1p1b2/P2P4/1QN1PN2/1B2B1PP/R4RK1/b Be7d6! (Kopec-Lessons-5-8) (1 page 37) r1br2k1/2qpbpp1/2p4p/1p2P3/2nNBB2/PQ6/2P2PPP/R2R2K1/b Nc4xPe5 (Kopec-Lessons-5-8) (11 page 45) LESSONS 9-12 HOW TO FORMULATE A PLAN begin examples from (Kopec-Lessons-9-12) rn1q1rk1/pp3pb1/3p4/2pPp1p1/2P1Pnb1/2N2NB1/PPQ2PP1/R3KB1R/b Nb8a6 (Kopec-Lessons-9-12) (14 page 60; 1...BxNf3? looks good but is wrong. It secures an N outpost, BUT it is in a useless place.) r1bq1rk1/1p1nbppp/p2p1n2/4p1B1/B1P1P3/2N2N2/PP1Q1PPP/R4RK1/b Nd7b6 (Kopec-Lessons-9-12) (15 page 60) r1b1k2r/pp2bppp/2n1p1n1/q2pP3/3p2Q1/3B1N2/PPPN1PPP/R1B1R1K1/w Ph2h4 (Kopec-Lessons-9-12) (18 page 62) 1r6/1q2n1bk/p2p1npp/4p3/1r2P3/2NQB1NP/PPRR2P1/1K6/b Pd6d5 (Kopec-Lessons-9-12) (20 page 63) 2rr2k1/1p3ppp/8/pB1p4/P2Pb1P1/8/1P3PP1/R3R1K1/w Pf2f3 (Kopec-Lessons-9-12) (21 page 64) 3rr1k1/pp3pb1/2p3p1/4p2p/P3P3/2P2P2/1PK3PP/R1B4R/w Bc1e3 (Kopec-Lessons-9-12) (22 page 65) rn2qrk1/p3bppp/bpp1pn2/3pN3/Q1PP4/2N3P1/PP2PPBP/R1B1R1K1/b Pb6b5 (Kopec-Lessons-9-12) (23 page 66) 1rbqk2r/pp2npbp/2npp1p1/2p5/4P3/2NPB1P1/PPP1NPBP/R2Q1RK1/w Pd3d4 (Kopec-Lessons-9-12) (25 page 67) 3r1rk1/2pqn1pp/1p1bbp2/p1p1p3/4P3/2PPBPN1/PP1R1QPP/2N2RK1/b Pf6f5 (Kopec-Lessons-9-12) LESSONS 17-20 ENDINGS begin examples from (Kopec-Lessons-17-20) 8/8/p7/1p6/1PkBbK2/2P2p2/8/8/b Pa6a5 (Kopec-Lessons-17-20) (32 page 93) 6k1/6p1/6Pp/ppp5/3pn2P/1P3K2/1PP2P2/3N4/b Ne4c3 (Kopec-Lessons-17-20) (36 page 94) 2n3k1/pp3ppp/3p4/3P4/3N4/8/PP3PPP/2K5/w Nd4b3 (Kopec-Lessons-17-20) (37 page 94) 8/7p/8/8/6k1/8/8/KR6/w Rb1g1+ (Kopec-Lessons-17-20) (39 page 95) 8/7p/8/8/6k1/8/8/KR6/b Ph7h5 (Kopec-Lessons-17-20) (39 page 95, other side moves) 8/8/5k2/3K4/3P4/8/7r/6R1/w Rg1e1 (Kopec-Lessons-17-20) (47 page 98) R7/6k1/P7/8/3K4/8/8/r7/w Pa6a7? (Kopec-Lessons-17-20) (is a mistake which draws. Kc5 won. 48 page 99) 2r3k1/pppR1pp1/4p3/4P1P1/5P2/1P4K1/P1P5/8/w Pg5g6 (Kopec-Lessons-17-20) (50 page 99) 7R/8/8/PK6/1P6/6k1/7p/r7/w Rh8xPh2 (Kopec-Lessons-17-20) (51 page 99) 3R4/2r3kp/6p1/P4p2/5P2/6P1/6KP/8/w Rd8d2 (Kopec-Lessons-17-20) (52 page 100) EXERCISES PAGES FOLLOW begin examples from (Kopec-Exercises-p.13) r6k/1R1N1R2/6n1/6r1/8/8/8/4K3/w Rf7h7+ (Kopec-Exercises-p.13) #20 q1b3k1/r5n1/4P3/5N2/5Q2/8/7R/6K1/w Nf5e7+ (Kopec-Exercises-p.13) #21 rnb3kr/ppp2ppp/1b6/3q4/3PN3/Q4N2/PPP2KPP/R1B1R3/w Ne4f6+ (Kopec-Exercises-p.13) #22 2r2rk1/2p2ppp/8/6R1/2q5/5P2/1PPQ4/1K1R4/w Rg5xPg7+ (Kopec-Exercises-p.13) #23 3q2k1/4pp1r/7Q/8/4N3/3B4/8/7K/w Ne4f6+ (Kopec-Exercises-p.13) #24 4n2k/1Q4p1/3q2P1/8/8/5R2/b5R1/6K1/w Rf3f8+ (Kopec-Exercises-p.13) #25 r5k1/3R2pp/3P1b2/4N1q1/8/8/5Q2/4K3/w Rd7d8+ (Kopec-Exercises-p.13) #26 7k/qbp2ppp/1Nr1pn2/4Q3/8/2B2P2/8/1R5K/w Qe5xNf6 (Kopec-Exercises-p.13) #27 5k2/pbp2r2/1p5p/4R1pP/1PP5/8/PKBQ1q2/8/w Qd2d8+ (Kopec-Exercises-p.13) #28 r7/5k1p/2pP2p1/1p6/1q3B2/1p2Q1P1/1P6/rNK1R2R/b Ra1xNb1+ (Kopec-Exercises-p.13) #29 begin examples from (Kopec-Exercises-p.29) 1q4r1/p3r1pk/1p2b1Rp/3pNp1P/3P4/2P3Q1/PP6/K5R1/w Rg6xBe6 (Kopec-Exercises-p.29) #1 7k/pp5p/2p5/3bb2q/8/2B5/PP2N1PP/5Q1K/w Qf1f8+ (Kopec-Exercises-p.29) #2 6k1/7p/4p3/1p1n1Pp1/8/7K/Pr5P/3Q4/b Rb2g2 (Kopec-Exercises-p.29) #3 1r3rk1/ppR2npp/8/6P1/4p1P1/1B2P3/1PP5/1K5R/w Rc7xNf7 (Kopec-Exercises-p.29) #4 r4r2/6kp/2pqppp1/pbR5/3P4/4QN2/PP3PPP/2R3K1/w Pa2a4 (Kopec-Exercises-p.29) #5 r2q2k1/pQ2bppp/4p3/8/3r1B2/6P1/P3PP1P/1R3RK1/w Bf4b8 (Kopec-Exercises-p.29) #6 4r2k/5p1p/3B1b1P/5P2/2pp4/P7/6PQ/6K1/w Bd6e7 (Kopec-Exercises-p.29) #7 7r/1pR5/6k1/3p4/p3n1np/8/PPP3PP/5R1K/b Ne4g3+ (Kopec-Exercises-p.29) #8 8/8/4p3/4P3/7R/k5p1/B6r/K7/w Rh4xRh2 (Kopec-Exercises-p.29) #9 2qr2k1/pp2bppp/8/4B3/1n6/P4B1P/3Q1PP1/3R2K1/w Qd2xRd8+ (Kopec-Exercises-p.29) #10 8/5p2/1p6/p3Pp2/P1k2P2/Rb6/3BK3/1r6/b Kc4d4 (Kopec-Exercises-p.29) #11 5rk1/pp3ppp/3p4/3Pp3/3r1n1q/5PN1/PPB4P/R1Q1R1K1/b Qh4h3 (Kopec-Exercises-p.29) #12 8/pQRq2pk/4p2p/3r1p2/3P4/4P3/PP3PPP/6K1/b Rd5c5 (Kopec-Exercises-p.29) #13 3r1k2/3rqp1p/p7/7P/5pQ1/2BB4/1PP3K1/8/w Qg4g7+ (Kopec-Exercises-p.29) #14 4r1k1/3qP2p/p5p1/1p2Q3/8/8/6PP/5RK1/w Rf1f8+ (Kopec-Exercises-p.29) #15 3r2k1/pRp2p2/6pQ/5b2/2B5/2qP2P1/P6P/6K1/w Bc4xPf7+ (Kopec-Exercises-p.29) #16 2r5/3k2p1/q2p1nP1/p3p3/1pR3bp/3P4/PP3R2/K1Q2B2/w Rc4xRc8 (Kopec-Exercises-p.29) #17 2r2r2/3qbpkp/p3n1p1/2ppP3/6Q1/1P1B3R/PBP3PP/5R1K/w Rh3xPh7+ (Kopec-Exercises-p.29) #18 k1rR3r/pp2P1pp/2q5/1p6/5BQ1/8/PPP2PPP/2K5/w Qg4xRc8+ (Kopec-Exercises-p.29) #19 r2q1rk1/ppp1ppbp/2np1np1/8/2PPP3/2NBBQ1P/PP3PP1/R3K2R/b Nf6d7 (Kopec-Exercises-p.29) #20 r3qrk1/p2pbppp/1pn1n3/2p2N2/Q7/6P1/PP2PPBP/R1BR2K1/w Rd1xPd7 (Kopec-Exercises-p.29) #21 6k1/4pr1p/p2p1PNQ/8/1qr1P3/5P2/P1b5/K2R3R/w Ng6xPe7+ (Kopec-Exercises-p.29) #22 5rk1/r1q2p1p/p1b1pQ2/2Pp1p2/1R6/3BP3/P4PPP/5RK1/w Rb4g4+ (Kopec-Exercises-p.29) #23 3r4/1ppb1ppk/p6p/4n1PQ/4Pq2/2P2p2/PP3P1P/R3RBK1/b Rd8h8 (Kopec-Exercises-p.29) #24 5r2/1pbq1rk1/p4ppp/2pPp3/2P1P1PQ/4N1R1/PP5P/5RK1/w Ne3f5+ (Kopec-Exercises-p.29) #25 r6k/ppp3p1/5NQ1/4nqN1/6b1/8/PPP2PPP/4R1K1/w Qg6e8+ (Kopec-Exercises-p.29) #26 5r1k/p6p/2b1p2Q/2P1Pp2/5P2/8/r5P1/7K/b Rf8f7 (Kopec-Exercises-p.29) #27 3Q4/1p3pk1/p3p1pp/4q3/6PK/5R1P/P4P2/7r/w Rf3xPf7+ (Kopec-Exercises-p.29) #28 r3r1k1/pq3p1p/4pQp1/1p6/2pP2N1/2P4R/PP3PbP/R5K1/w Ng4h6+ (Kopec-Exercises-p.29) #29 1k3r2/1ppn3p/p7/5bpr/3N4/3P2B1/PPP3P1/2KRR3/w Nd4xBf5 (Kopec-Exercises-p.29) #30 r4rk1/3b1p1p/p5p1/1p2Q3/3N2n1/1P4Pq/PB3P1P/1R2R1K1/w Qe5g7+ (Kopec-Exercises-p.29) #31 kr6/5Rp1/p2q1p2/N6n/4r3/1Q4P1/5PK1/1R6/w Rf7a7+ (Kopec-Exercises-p.29) #32 r3r3/p1p2p1k/3p2pp/2p5/5n2/2N2B2/PPR1PP1q/3RQK2/b Re8e3 (Kopec-Exercises-p.29) #33 8/5pkp/5qp1/2Rp1n2/8/3PPNP1/rr3PKP/2Q2R2/b Rb2b1 (Kopec-Exercises-p.29) #34 5r2/2p3pk/1r1p3b/p1q1p3/6R1/P2P1p2/BPPQ1P1P/2K3R1/w Qd2xBh6+ (Kopec-Exercises-p.29) #35 rn1qr3/pb5p/1p3b1R/5Pp1/2pp2k1/3B4/PP1B2PP/5RK1/w Bd3e4 (Kopec-Exercises-p.29) #36 begin examples from (Kopec-Exercises-p.105) 5r2/3q1kp1/1p2pr1p/2p1R2P/p1PpQP2/6P1/PPP5/2K1R3/w Pa2a3 (Kopec-Exercises-p.105) #1 3k2q1/1p1r4/5pBP/3P1n2/p2B4/P7/1P4P1/5RK1/w Bd4b6+ (Kopec-Exercises-p.105) #2 2r2rk1/1bqnbpp1/1p1ppn1p/pP6/N1P1P3/P2B1N1P/1B2QPP1/R2R2K1/b Bb7xPe4! (Kopec-Exercises-p.105) (from Bratko-Kopec test) #3 r1b2rk1/2q1b1pp/p2ppn2/1p6/3QP3/1BN1B3/PPP3PP/R4RK1/w Nc3d5,Pa2a4 (Kopec-Exercises-p.105) #4 1q2r1k1/1b1n2pp/p3pn2/8/1p2PP2/1N1B4/4Q1PP/2B2R1K/w Pe4e5 (Kopec-Exercises-p.105) #5 3q1r2/p2r1pbk/bpn3pp/3Pp3/7P/1P2BN2/P1BQ1PP1/2RR2K1/w Ph4h5 (Kopec-Exercises-p.105) #6 3q1r2/p3n1bk/bp4pp/3rp3/7N/1P2B3/P1BQ1PP1/2RR2K1/w Qd2xRd5 (Kopec-Exercises-p.105) #7 begin examples from (Kopec-Exercises-p.111) 2rq1rk1/p5bp/bp1ppnp1/2p5/4PP2/P1NPBN1P/1P1Q1KP1/3RR3/b Pd6d5 (Kopec-Exercises-p.111) #1 1rb1r1k1/2qn1pbp/3p2p1/1pnP4/2p1PP2/2N1B1NP/1PB2QP1/R4RK1/w Pe4e5 (Kopec-Exercises-p.111) #2 r2q1rk1/ppp2pbp/2np1np1/3Pp3/4P3/2N1BP1P/PPPQBP2/R3K2R/b Nc6d4 (Kopec-Exercises-p.111) #3 r1b2rk1/pp2qp1p/4p1p1/Q2nN3/8/3R2P1/PP2PPBP/2R3K1/w Pe2e4 (Kopec-Exercises-p.111) #4 4r1k1/2rb1pp1/p3p2p/1p1pP3/3K1P2/1P1B2P1/P1P2R1P/R7/w Pg3g4 (Kopec-Exercises-p.111) #5 4r1k1/p4pp1/1p3q1p/n1prp3/2P1Q3/2P1PB1P/P4PP1/3R2K1/w Rd1xRd5 (Kopec-Exercises-p.111) #6 begin examples from (Kopec-Exercises-p.115) rnbqkb1r/pp2pppp/2p2n2/3P4/2P5/8/PP1P1PPP/RNBQKBNR/w Pd5xPc6? (Kopec-Exercises-p.115) wins a pawn but is bad #2 r1bqkbnr/pp1npppp/2p5/8/3PN3/8/PPP1QPPP/R1B1KBNR/b Nd7f6 (Kopec-Exercises-p.115) #3 r1bqkb1r/pp1p1ppp/2p2n2/4P3/2Bp4/8/PPPP1PPP/RNBQ1RK1/b Pd7d5 (Kopec-Exercises-p.115) #4 rn1qkbnr/pp2ppp1/2p3bp/8/7P/5NN1/PPPP1PP1/R1BQKB1R/w Nf3e5 (Kopec-Exercises-p.115) #5 r1bqkb1r/pp2pppp/2p2n2/4N3/3P4/8/PPP2PPP/R1BQKB1R/b Nf6d7 (Kopec-Exercises-p.115) #6 r1b2rk1/ppp2pp1/2n1pq1p/b2p4/2PP4/PQNBPN2/1P3PPP/R3K2R/b Pe6e5 (Kopec-Exercises-p.115) #7 r1bqk2r/pp1pppbp/2n2np1/1Bp5/4P3/2N2N2/PPPP1PPP/R1BQR1K1/b Nc6d4? (Kopec-Exercises-p.115) is bad. ...o-o is better. #8 r1b1k2r/ppq2pp1/2n2n1p/2p1p3/2P1P3/2PB1N1P/P3QPP1/R1B1K2R/w Nf3h2 (Kopec-Exercises-p.115) #9 r1bq1rk1/p2p1ppp/1pn1pn2/2p5/2PPP3/P1PB4/4NPPP/R1BQK2R/b Nf6e8 (Kopec-Exercises-p.115) #10 r1b1k1nr/ppqp1pbp/6p1/1B2p3/2N1PB2/5Q2/PP3PPP/R4RK1/w Nc4xPe5 (Kopec-Exercises-p.115) #11 r3k2r/pp1bb1pp/1q2pn2/3pB3/1P6/2PB4/P4PPP/RN1Q1RK1/w Nb1d2 (Kopec-Exercises-p.115) #12 begin examples from (Kopec-Exercises-p.119) 4k3/8/2P5/3K4/8/8/8/8/w Kd5e6 (Kopec-Exercises-p.119) (also Kc5) #1 4k3/8/8/8/8/8/4PK2/8/w Kf2e3 (Kopec-Exercises-p.119) #2 8/8/5k1K/p6P/P7/8/8/8/w Kh6h7 (Kopec-Exercises-p.119) #3 8/8/8/2p5/8/8/1kP5/3K4/w Pc2c4 (Kopec-Exercises-p.119) #4 5k2/5p2/8/4P3/2K1P3/8/8/8/w Pe5e6 (Kopec-Exercises-p.119) #5 8/3k2p1/1p5p/1p1pP3/1P1P1PP1/8/7K/8/b Pg7g5 (Kopec-Exercises-p.119) #6 8/1p3pk1/p3p1pp/4P3/5P2/P7/1P2K1PP/8/b Pg6g5? (Kopec-Exercises-p.119) ...g5? is bad #7 8/8/p4p2/5p1p/Pk1K4/5PPP/8/8/w Ph3h4 (Kopec-Exercises-p.119) #8 8/5k2/7P/8/8/5K2/8/1B6/w Bb1h7 (Kopec-Exercises-p.119) #9 k1N5/2p5/8/1P6/8/8/7K/8/w Nc8b6+ (Kopec-Exercises-p.119) #10 4n3/pp5p/6k1/2P2pp1/5p2/2B2P2/PPK3PP/8/w Bc3e5 (Kopec-Exercises-p.119) #11 6k1/5pp1/8/B2n4/5P2/P4KPp/8/8/b Nd5e3 (Kopec-Exercises-p.119) #12 6b1/6p1/5k2/1p5p/P3B3/1P1K3p/8/8/w Pa4a5 (Kopec-Exercises-p.119) #13 8/8/8/2p2Bp1/5p1p/2p1bPkP/6P1/5K2/b Pg5g4 (Kopec-Exercises-p.119) #14 8/6pp/8/1N6/2n2P2/4k1P1/P1Kp3P/8/b Nc4a3+ (Kopec-Exercises-p.119) #15 8/8/kP6/2R1K3/8/8/1p6/8/w Rc5b5 (Kopec-Exercises-p.119) #16 8/8/6p1/7p/7P/8/pk1K4/2R5/w Rc1a1 (Kopec-Exercises-p.119) #17 5k2/1p4pP/p7/1p1p4/8/2r3K1/6PP/8/w Kg3f2 (Kopec-Exercises-p.119) (Kg4? Kf4? Kh4? all lose.) #18 r7/4R3/8/8/4p3/5k2/8/4K3/w Ke1d2 (Kopec-Exercises-p.119) #19 6K1/3k2P1/8/8/8/8/4R3/7r/w Re2e4 (Kopec-Exercises-p.119) #20 8/8/2k5/6R1/6K1/2r2P2/8/8/w Rg5e5 (Kopec-Exercises-p.119) #21 8/7R/4p3/k4P2/8/1K6/3rP3/8/w Pf5f6 (Kopec-Exercises-p.119) #22 6R1/2pk4/P2p3p/1P4p1/8/r5P1/7P/6K1/w Pb5b6 (Kopec-Exercises-p.119) #23 2r5/6k1/7p/pR4p1/P4p2/5P1P/6P1/6K1/b Rc8c1+ (Kopec-Exercises-p.119) #24 8/6Q1/8/8/4q3/4p3/1K6/4k3/w Qg7g1+ (Kopec-Exercises-p.119) #25 gnuchess-4.0.pl70/test/CHESSTEST/kotov.fin100644 21542 13 23462 5527662451 17222 0ustar cracraftuser#Alexander Kotov: Think like a grandmaster. #B.T. Batsford ltd, 1971. ISBN=0-7134-3160-1. # #I have tried to use "!" to indicate a move that kotov thinks is #clearly *the* unique best move in this position. Moves without "!" are #just good moves, not so clear they are the only good moves. Hence #perhaps don't be too worried if you choose another. This differs from #my normal convention, which is that the answer is the answer, #regardless of "!"s. # #I should really have gone thru carelfully and removed all positions #from the present set, in which there was not a unique best move, but I #was lazy (or prefered to keep the data intact) so I didn't. # #As usual, moves with "?" are definitely bad and you should be #penalized for choosing them. # 1brr2k1/1b3pp1/pp2pqnp/4N2Q/3P4/1B4R1/PP1B1PPP/4R1K1/w Ne5g4 (Kotov_TLaG) #1 r1r3k1/p4ppp/bpq1Nn2/4R3/1PBR4/2Q1PP2/6PP/6K1/w Pb4b5! (Kotov_TLaG) #3 3b1kn1/6p1/3q1p2/4pPP1/pP1pP1N1/3P1NQ1/1rr5/5RRK/w Qg3h3! (Kotov_TLaG) #4 5rk1/6pp/5P2/1q4P1/1pp2Q1P/7K/1P1p4/2B2R2/b Qb5d7+! (Kotov_TLaG) #11 3q1rk1/pp2ppbp/6p1/5b2/3p1Q2/1P1P1NP1/P1r1PPBP/R2K3R/b Qd8a5 (Kotov_TLaG) #12 2k1b3/p4nQ1/1p1q4/2pPpPpB/2P1P3/P1P2P2/5K2/8/b Qd6h6! (Kotov_TLaG) #13 r1bq1rk1/2pp1ppp/p4n2/1p2P3/5P2/1BP5/P1P3PP/R1BQK2R/b Pc7c5! (Kotov_TLaG) #15 2k5/2b5/pp6/4p3/1P4P1/1KP2p2/1P1R4/8/w Rd2d5! (Kotov_TLaG) #16 r4rk1/p4ppp/qp2p3/b5B1/n1R5/5N2/PP2QPPP/1R4K1/w Bg5f6! (Kotov_TLaG) #17 4r1k1/1p3ppp/pb6/2npq1B1/3N4/Q1P3N1/PP3KPP/3R4/w Pb2b4! (Kotov_TLaG) #20 4r1k1/1p3ppp/pb3q2/2np4/8/Q1P2NN1/PP3KPP/2BR4/b Qf6g6! (Kotov_TLaG) #20a 1r4nk/1p1qb2p/3p1r2/p1pPp3/2P1Pp2/5P1P/PP1QNBRK/5R2/b Qd7xPh3+! (Kotov_TLaG) #22 r2q1rk1/p1p2p2/bp2p1np/n2pP1p1/2PP3B/P1P2P1N/2Q3PP/RB2K2R/w Nh3f4! (Kotov_TLaG) #23 r4rk1/pp4b1/2bpp2p/4q1p1/2P3p1/1P1QP3/P3NPP1/1BR2RK1/b Kg8f7! (Kotov_TLaG) #24 5bk1/2n1qr2/p1Q2pp1/2p1p3/4P3/2N1BPP1/PP6/2KR4/w Qc6b6! (Kotov_TLaG) #25 rn5k/1p2qpp1/pB1pn2p/4p3/4P1Q1/1BP3P1/PP3P1P/3R2K1/w Qg4h4! (Kotov_TLaG) #26 r5k1/1n1bpp2/p5pp/3Pq3/1p2pN2/1P2P3/P1R2PPP/3Q1BK1/w Qd1d4! (Kotov_TLaG) #27 8/p2PB1pk/1p5p/3Qq3/2p3K1/2Pn1P2/6PP/8/w Qd5d6! (Kotov_TLaG) #28 2r2qk1/1R3n1p/p3p1p1/3pB3/P4Q2/7P/5PP1/6K1/w Be5b2 (Kotov_TLaG) (Qf6 also wins, probably more wins too) #32 3r2k1/1b3pb1/p3pq2/1p2N3/3P1nQ1/2R3P1/PP3P1P/1B4K1/b Rd8xPd4 (Kotov_TLaG) is simplest win #33 5rk1/1p3ppp/2q1b3/p2pQ3/2rP4/PnB3P1/1P3PBP/3RR1K1/w Pf2f4 (Kotov_TLaG) #35 6k1/3bbpp1/p3pn2/1p2q1N1/1P5Q/2N3P1/P3PP1P/2B3K1/w Qh4h8+! (Kotov_TLaG) #36 5rk1/4Qp1p/n4bp1/p5N1/P4q2/5B1P/1P3P2/2R2RK1/w Qe7xPf7+! (Kotov_TLaG) #37 3N4/1p6/8/p7/2P2k2/1KP1p3/8/8/w Nd8e6+ (Kotov_TLaG) #38 1.Kc2? loses to Kg3! 2r3k1/3n1pp1/2pq3p/1pNp4/1PnP2b1/3BPN2/R1Q2PPP/6K1/w Bd3h7+ (Kotov_TLaG) #39 r1bq1knr/pp3pbp/6p1/1B1p4/3p1P2/3P4/PPP3PP/RNBQ1RK1/w Nb1d2? (Kotov_TLaG) #42 1rb2r1k/1p1n2q1/p2Q2p1/P2Npn1p/2P1N2P/6P1/1R3PB1/1R5K/w Ne4g5? (Kotov_TLaG) #43 8/p4p2/3p1k2/2pPnPp1/2P3B1/r6P/1Q4RK/4q3/b Ra3xPh3+? (Kotov_TLaG) #45 8/p2Rbk1p/6p1/8/2rN4/1P6/P6K/8/b Rc4c7? (Kotov_TLaG) #46 2rq1rk1/pb3p1p/1p2pbp1/3p3R/2PP4/PP5R/1B3PPP/3Q1BK1/b Pd5xPc4! (Kotov_TLaG) #47 2r1r1k1/pb2bppp/1pn2n2/3p4/2P2q2/2N2N2/PB2QPPP/1BRR2K1/w Nc3xPd5 (Kotov_TLaG) or cxd5, the latter is a simpler and hence preferable win. #48 kr6/p4r2/2p1p3/2Pb2PP/2BR1P2/4R3/P7/2K5/w Re3xPe6! (Kotov_TLaG) #51 r3k2r/pppnqp2/5n1p/3p1Q2/1b1P3p/2NBPN2/PP4PP/R3K2R/b Qe7xPe3+! (Kotov_TLaG) #52 1r6/2p2rkp/p1npbpp1/1qpN4/4P3/PNQ1R2P/1PP2PP1/3R2K1/w Nd5xPc7! (Kotov_TLaG) #53 1q1r2k1/pp1b3p/1n1r1pp1/2pP1p2/2P2Q2/1B3N1P/PP3PP1/4RRK1/w Nf3d4! (Kotov_TLaG) #54 r1q2rk1/pb1pbp1p/np2p3/5p2/2P5/P1N2NP1/1PQ1PPBP/R2R2K1/w Pb2b4! (Kotov_TLaG) #55 4r1k1/ppp2p2/4b2p/2p5/2P1n1p1/4PNB1/PP3PPP/2RK4/w Nf3h4! (Kotov_TLaG) #56 5r2/q5k1/3pQpp1/2p1n2p/4P2P/6PB/5P2/3R2K1/w Bh3f1 (Kotov_TLaG) (Qxd6 or Rxd6 both lose) #57 2r1qr1k/1n1bb2p/p2p3N/1p1Ppn2/1P6/5N1P/P1BBQP2/2R1R1K1/w Nf3xPe5! (Kotov_TLaG) #58 8/5pk1/7p/5Qp1/3N4/P2nq1P1/6KP/8/w Qf5d5 (Kotov_TLaG) #59 r7/N4pbp/4b3/Pk1p4/1Pr5/4B3/5PPP/2RR1K2/b Kb5a4 (Kotov_TLaG) #60 6k1/3R1p2/8/4p2p/P2bN1p1/6P1/2r2P1P/5K2/w Rd7d8+! (Kotov_TLaG) #61 2r1k2r/pp1b1ppp/4p3/3qP3/Pn1P4/2p2P2/3BB1PP/R1Q1NRK1/b Nb4a2! (Kotov_TLaG) #62 2b1r2r/2p1qpk1/1p1p1npp/p2P4/2P1p1P1/2P1PP2/P1Q2KP1/1B2RNR1/b Nf6xPg4+ (Kotov_TLaG) #63 5r1k/5p2/2p1n1pp/p3P2N/P5QP/4RP2/7q/4BKRr/w Nh5f6 (Kotov_TLaG) #64 3rn1k1/1pq1r1p1/2p1p1Bp/p2p4/3P1P2/4P2P/PPQ3P1/2R2RK1/w Rf1f3! (Kotov_TLaG) #67 r4rk1/pb1qn1pp/1pnNp3/3pPp2/PP1P1P2/5N2/3Q2PP/R3KB1R/w Pa4a5! (Kotov_TLaG) #69 r4rk1/4npbp/5qp1/p2p4/Pp6/3QB3/1PP2PPP/R2N1RK1/b Pd5d4! (Kotov_TLaG) #72 r3r1k1/pb2qppp/1pp1p3/4P3/2BP4/P1Q1P3/1P4PP/3R1RK1/w Qc3e1 (Kotov_TLaG) #73 r4r2/1ppqn1bk/p2p1npp/3Pp3/4P3/2NQB1NP/PPP3P1/1K1R3R/b Pb7b5 (Kotov_TLaG) #74 r1bq1rk1/pp3ppp/2np1n2/2p1p3/2PP4/P1PBP3/4NPPP/R1BQ1RK1/w Pe3e4 (Kotov_TLaG) #76 r1b1k2r/2q1bppp/p1np1n2/1pp1p3/3PP3/2P2N2/PPBN1PPP/R1BQR1K1/w Pa2a4 (Kotov_TLaG) #78 2r2rk1/Q1pq1pbp/2pp1np1/8/4P3/2N5/PPP2PPP/R1B2RK1/w Qa7a6 (Kotov_TLaG) #79 rnb1k2r/pp3ppp/3p4/q1p1p3/2PP4/P1P1P3/2QN1PPP/R3KB1R/w Pd4xPe5 (Kotov_TLaG) #81 2br1n2/1p1r1kp1/p1p2p1p/2PPp3/1P2P3/1NN2P2/5RPP/R5K1/w Nb3a5 (Kotov_TLaG) #82 r4rk1/ppq1ppbp/2n2np1/2p5/2P5/2NPB1P1/PP3PBP/R2Q1RK1/b Rf8d8 (Kotov_TLaG) #85 r4rk1/1b2qppp/5b2/p2P4/B1p5/2P3Q1/P4PPP/R1BR2K1/w Bc1f4! (Kotov_TLaG) #86 r4rk1/pp2nppp/1qn5/1B1p1b2/P2N4/1N2P3/1PPQ2PP/R4RK1/w Nd4xNc6? (Kotov_TLaG) #88 rn3rk1/pp4bp/4pnp1/2p5/8/2N1PN2/PP3PPP/R1BK3R/w Kd1e2 (Kotov_TLaG) white almost surely wins #90 2bk4/2rn1p2/p3p1p1/P2p2P1/1N1P3P/1K2PB2/8/R7/w Bf3e2 (Kotov_TLaG) white wins #92 r1b1k2r/pp3ppp/2p5/2npP3/1b3P2/2N1P1Pq/PPB4P/R1BQK2R/w Ke1f2! (Kotov_TLaG) #93 3r2k1/1b2q1pp/p4p2/1pQnp3/1P6/P5P1/4PPBP/2R1N1K1/w Qc5a7 (Kotov_TLaG) #94 rnbq1rk1/pp4bp/3p4/2pPpp1n/2P5/2NBBP2/PPQ1N1PP/R3K2R/b Pe5e4! (Kotov_TLaG) #95 r4rk1/1p1b2bp/p2p4/2pPq3/2P1Pn2/3B1P1P/PPQN1B2/2KR3R/w Bd3f1 (Kotov_TLaG) white manages to draw although at a disadvantage #96 r2qr1k1/np1b1ppp/1Pp1pn2/p7/P1pP4/B1Q1PN2/5PPP/1R2KB1R/b Na7b5! (Kotov_TLaG) #97 2R5/1r2ppbk/4n1p1/1p5p/p2P4/1B2PPBP/P3K1P1/8/w Bb3xNe6! (Kotov_TLaG) #98 (PxB; Rb8 RxR; BxR b4; Kd3 Bh6; f4! shutting black's B out of game. r4rk1/pp1b1pp1/1q1b1n1p/nPp5/2Pp4/3P1NP1/PBQN1PBP/R4RK1/w Ra1e1 (Kotov_TLaG) #99 r2q1rk1/p2bbppp/1pn5/1B1p4/3P4/5N2/PP3PPP/R1BQR1K1/w Qd1a4 (Kotov_TLaG) #100 8/pp3k1p/2n2pp1/1p1r4/5P2/PPB1PP1P/4K3/7R/w Pe3e4 (Kotov_TLaG) was followed by the mistake ...Rh5? #101 r4rk1/2p1bpp1/p1n1n1p1/Pq1pP3/8/1NP1BN2/Q4PPP/1R3RK1/w Nf3d4! (Kotov_TLaG) (also Qc2?) #102 r1b1k2r/p4ppp/1pn1p3/qB6/3PpB2/bQP2N2/P4PPP/1R2K2R/b Bc8d7 (Kotov_TLaG) white then wins with Nd2! #103 r2q1rk1/pp3ppp/1b6/5n1Q/3nN3/P6P/BP3PP1/R1B2RK1/w Ne4g5! (Kotov_TLaG) (also Bg5) #104 r2qrnk1/pb2bppp/1pp2n2/3p4/3P1B2/2N2NP1/PPQ1PPBP/2RR2K1/w Nf3e5 (Kotov_TLaG) #107 r2q1rk1/pp2ppbp/1np3p1/n2p4/3PP3/2NBB2P/PPP1QPP1/3R1RK1/b Pe7e5! (Kotov_TLaG) #108 r1b2rk1/pp1n1pbp/1qpp2p1/4p1B1/2PPP1n1/2N2NPP/PP3PB1/R2Q1RK1/b Pe5xPd4! (Kotov_TLaG) #109 r1bqk2r/p2nbp1p/1pp1pp2/8/2BPN3/5N2/PPPQ1PPP/R3K2R/w Qd2h6! (Kotov_TLaG) #110 r1q1kb1r/pp3ppp/1npnp3/8/3PP3/2N2NP1/PP3PKP/R1BQ1R2/w Pd4d5! (Kotov_TLaG) #113 7q/1b1knn2/4p1p1/1pppPpP1/P4P1N/2P3K1/2N1B3/1Q6/b Nf7xPg5! (Kotov_TLaG) #115 3rqrk1/pb4pp/3Rpp2/Rp6/5P2/1P6/1PPQ2PP/2B4K/b Rd8xRd6! (Kotov_TLaG) #116 r6k/2pq1rbp/1p1p4/p2P2R1/P1P1Bp1P/1P3P2/6Q1/2K3R1/w Ph4h5! (Kotov_TLaG) #117 r4r2/4p1k1/1q1p1pp1/nppP4/P7/1P3BP1/1Q2PPK1/R6R/w Pa4xPb5 (Kotov_TLaG) #118 r2r1nk1/ppqb1pp1/2p1pn1p/4N3/2PP4/2N5/PPB1QPPP/3RR1K1/w Pc4c5! (Kotov_TLaG) #119 r1b2rk1/ppq1bppp/2pp4/P3P3/2B1P1n1/2NQB3/1PP2PPP/R4RK1/b Pd6d5! (Kotov_TLaG) #120 r1q2k1r/pp1n3p/8/2b4n/P7/2N1PP2/1P2Q1PP/R1BR2K1/w Pb2b4 (Kotov_TLaG) #121 3r1rk1/pbqnbppp/1p2pn2/2p5/2PP4/2NBPN2/PB2QPPP/3R1RK1/w Pd4d5! (Kotov_TLaG) #123 1r3rk1/2qnppb1/b2p2pp/p1pP4/P1P5/3B1NP1/2QBPP1P/1R3RK1/w Rb1b5! (Kotov_TLaG) #124 1r1r2k1/2b1qp1p/b1p3p1/p1p1p3/2P1P3/1PN1BP2/P1Q3PP/R2R2K1/b Rd8d4! (Kotov_TLaG) #125 2rq3r/pb1n1pk1/2n1p1p1/2PpP3/3P2P1/P2B1N2/1B2Q3/2R2RK1/w Qe2e3 (Kotov_TLaG) #127 3r1rk1/2pqb1pp/ppn1bp2/2p1p3/4P3/2PPBPN1/PPQN2PP/3R1RK1/w Nd2b3 (Kotov_TLaG) #128 r4rk1/pp1nqppp/2pb1n2/3pp3/P7/1P1PPB2/1BPN1PPP/R2Q1RK1/w Pg2g3 (Kotov_TLaG) #129 r2q1rk1/pbpn1pbp/1p3np1/3p4/3P4/1PN1PN2/PBQ1BPPP/R4RK1/b Pa7a6 (Kotov_TLaG) #130 2rr2k1/1b1nqpbp/p4np1/2pp4/8/1P2PN2/PB2NPPP/1QRR1BK1/b Bg7h6! (Kotov_TLaG) #131 rn1q1rk1/ppp2pp1/4p2p/2b2b2/4n3/3P1NP1/PPP2PBP/R1B1QRK1/w Pd3xNe4 (Kotov_TLaG) #132 r3k2r/3nbppp/1q1p4/p2Pp2b/P7/2B3PP/1P2NPBK/R2Q1R2/w Pg3g4 (Kotov_TLaG) is best #133 2r2rk1/pb1nqppp/1ppp1n2/4p3/Q1PPP3/2N2NP1/PP3PBP/3RR1K1/w Pb2b4,Nf3h4,Rd1d2 (Kotov_TLaG) 3 plans possible #134 r2q1rk1/pp1nbppp/2p2n2/3pp3/2PP2b1/1PNBPN2/PB3PPP/R2Q1RK1/w Bd3e2 (Kotov_TLaG) #136 1r1q1rk1/p1pnppbp/3p2p1/8/2Pn4/2N3PP/PP2PPB1/R1BQ1RK1/b Pc7c5? (Kotov_TLaG) #137 rnbqnrk1/1p3pbp/p2p2p1/2pPp3/2P1P1PP/2N1BP2/PP6/R2QKBNR/w Bf1d3 (Kotov_TLaG) #138 1rb2rk1/4q1bp/1n1p1np1/p2Pp3/2p1P1P1/4BPNN/PPB4Q/R3K2R/b Nb6xPd5! (Kotov_TLaG) #139 r4rk1/pp3ppp/1qp2n2/4nN2/8/1B2P3/PP3PPP/2RQ1RK1/w Qd1d6 (Kotov_TLaG) #140 r3r1k1/pb2qppp/1pp2n2/3p4/3Pn3/1PN1P1P1/PB3PBP/R2Q1RK1/w Rf1e1 (Kotov_TLaG) #141 r3r1k1/pp1q1pp1/2nbbn1p/3p4/1P1P1P2/PQNB3P/3BN1P1/R4RK1/b Be6f5! (Kotov_TLaG) #142 r4rk1/pp2qppp/3bbn2/3p4/8/1P2PB2/PB1NQPPP/R4RK1/w Pe3e4! (Kotov_TLaG) #144 2rr2k1/ppp1qpp1/1n2pn1p/3b4/3P4/P1Q2NP1/1P2PP1P/R2RBBK1/w Pb2b4 (Kotov_TLaG) #145 3qrbk1/pbr2p1p/1pp2np1/3p4/3P4/1P1Q2P1/PB1NPPBP/3RR1K1/w Pe2e4! (Kotov_TLaG) (also Nb1?) #146 5k2/r1p2pp1/4b2p/8/8/P4N1P/1P3PP1/2R3K1/w Nf3d4 (Kotov_TLaG) #147 r5nk/pp1br2p/2p1p3/3p4/3P4/2NB2R1/PPP3PP/2K2R2/w Nc3b1! (Kotov_TLaG) #148 3r2k1/5pp1/p1R5/2B5/2P1n2p/7P/P1P3P1/5K2/b Rd8d2! (Kotov_TLaG) #149 8/5pp1/6k1/R3B2n/7r/8/6K1/8/w Kg2f3 (Kotov_TLaG) #151 r3r1k1/2p3pp/p1np4/1p3b2/5P2/1PP2N2/P4BPP/R3R1K1/b Bf5d7 (Kotov_TLaG) #152 8/5kp1/p7/Np1b1P1p/1Bp1n1P1/2P4P/8/6K1/w Pg4xPh5 (Kotov_TLaG) (black had just played ...h7h5! forcing this) #153 2rr2k1/p2qb1pp/1p2bp2/2p1p3/1n1n4/1PNP2P1/PB1NPPBP/2RQR1K1/w Pf2f4 (Kotov_TLaG) #156 3b4/r4pk1/3p4/3BpKP1/1pP5/1P3R2/r4P2/6R1/b Pe5e4? (Kotov_TLaG) #157 8/p6k/3P2p1/2Q5/Pp1n1r2/1P4N1/5RPq/4K3/w Rf2xRf4? (Kotov_TLaG) #158 r1b3kr/p3bpp1/qp2p2p/4P2P/3RpPQ1/1NN5/1PP3P1/2K4R/w Nc3xPe4 (Kotov_TLaG) (...Kh7, 2. Ng5+! wins) #159 gnuchess-4.0.pl70/test/CHESSTEST/larsen1.fin100644 21542 13 16350 5527662451 17423 0ustar cracraftuser#Bent Larsen: Bent Larsen's good move guide, #Oxford University Press 1982. #100 "FIND THE COMBINATION" problems (CHAPTER 1). # #Correctness: Only one error was spotted by my automatic simpleminded #"chess common sense" checker. Now fixed. Apr 17 1993 several more #errors spotted and fixed. Bug fixed in Larsen1.34.100, june 1993. # r4k2/p3nppp/3q4/2Np1b2/1r1P3P/5QP1/P4PB1/2R1R1K1/w Re1xNe7 Larsen1.1.100 4r2k/p5pp/8/3Q1b1q/2B2P1P/P1P2n2/5PK1/R6R/b Qh5g4+ Larsen1.2.100 n1k1n2r/Qb1r2q1/1p1p1p2/1PpPpPp1/2P1P1P1/6R1/3B1KB1/R1N5/w Qa7xNa8+ Larsen1.3.100 5nk1/p2p2bp/1p1qp3/3N4/2P3QP/1P2B1P1/P7/5K2/w Nd5f6+ Larsen1.4.100 2rq1kr1/bp3p2/p2pb3/5N1p/1P1pB2P/P5P1/2P1QP2/3R1RK1/b Be6xNf5! Larsen1.5.100 3q3k/1pp3pp/5p2/1P6/4PQ2/3B2P1/1r3b1P/R6K/w Qf4xPc7 Larsen1.6.100 r4rk1/1bqn1pbp/pp4pB/4p1Nn/P3P2Q/2NB4/1PP3PP/R4RK1/w Bh6xBg7 Larsen1.7.100 kr4r1/pp1P4/4p1q1/P1Np3p/2pP1p2/2P5/2P2RnP/RQ5K/w Pd7d8=Q Larsen1.8.100 r1b1k2r/1pq2ppp/p1n1p3/2b5/P1B1P1n1/2N2N1P/1P2QPP1/R1B2RK1/b Nc6d4 Larsen1.9.100 6kr/1q2r1p1/1p2N1Q1/4np2/1P1p4/6R1/7P/2R3K1/w Rc1c8+ Larsen1.10.100 1r4k1/5p1p/5BpQ/8/4qN2/6P1/5P1P/3b2K1/b Qe4h1+ Larsen1.11.100 4r1k1/pp3pp1/2p4p/6q1/B2Pb3/4P3/PP3QPP/4R1K1/b Be4xPg2 Larsen1.12.100 2rk2nr/2pbbppp/p7/1p1NP3/1np2B2/4PN2/PP3PPP/2KR1B1R/w Nd5xNb4 Larsen1.13.100 r2q1rk1/1p3pbp/p2p2p1/nPpPp2n/4P3/3Q2P1/PPNB1PBP/R4RK1/w Pb5b6 Larsen1.14.100 6k1/5r1p/p2N4/nppP2q1/2P5/1P2N3/PQ5P/7K/w Qb2h8+ Larsen1.15.100 2kr4/ppp3Pp/4RP1B/2r5/5P2/8/PP1p3P/3K4/w Re6d6 Larsen1.16.100 r4rk1/1p1bpp1p/2pp2p1/p1nP4/2PQP1n1/P1N2NP1/1q3PBP/R3R1K1/w Re1b1 Larsen1.17.100 7k/1p4pp/pQ6/P1q5/4P3/2P1r2P/1P3Kp1/R7/b Re3e1+ Larsen1.18.100 Q7/p4rkp/3q4/2p1p1N1/P1P5/8/7B/7K/w Bh2xPe5+ Larsen1.19.100 1br1r1k1/p2q1ppp/1p6/4p3/1PPp1n1n/P2P1PNP/1B1Q3K/3R2NR/b Qd7xPh3+ Larsen1.20.100 r5r1/pq2kpQ1/1p2p3/4R3/8/2P5/PP3PPP/R5K1/w Re5xPe6+ Larsen1.21.100 r4nk1/pp1b2pp/4p3/3pn1N1/3q4/P2B1Q2/6PP/R4R1K/w Qf3xNf8+ Larsen1.22.100 r1b4k/p1q1r1p1/2p4p/2b1PpN1/5P1Q/7P/PP2B1P1/3R1R1K/w Rd1d8+ Larsen1.23.100 3r2k1/pRp2p2/6pQ/5b2/2B5/2qP2P1/P6P/6K1/w Bc4xPf7+ Larsen1.24.100 r2qkb1r/1b2nppp/pN1p4/1pp5/3NP3/1P6/1PP2PPP/R1BQR1K1/w Nd4f5 Larsen1.25.100 r1r3k1/2pq2pp/bp3p2/p7/P1NPp3/1P2P3/2R1QPPP/2R3K1/w Nc4xPb6 Larsen1.26.100 r2qr1k1/pbp1bp2/1pn3pB/8/3pN3/P1PB1Q2/1P3PP1/R3K2R/w Qf3xPf7+ Larsen1.27.100 r1r3k1/Bn2qp1p/2p3pb/1p2n3/1P2Pp2/1NP4P/4B1P1/R2R1QK1/b Pf4f3 Larsen1.28.100 r1q2rk1/1p2bppp/1Qp5/p2pPb2/1P3n2/PBP2N2/1B3PPP/R3R1K1/b Nf4xPg2 Larsen1.29.100 2r2rk1/pb2bppp/4pn2/qp2B3/8/1P3NP1/P3PPBP/1QR2RK1/w Nf3g5 Larsen1.30.100 r4rk1/4bp1p/1q2p1p1/1b2B1Nn/1p3P2/3B3Q/1PP3PP/3R1R1K/w Qh3xNh5 Larsen1.31.100 r4k1r/4Rppp/n1N2n2/1q1p1Q2/5B2/8/PPP2PPP/2KR4/w Qf5xNf6 Larsen1.32.100 3q1rk1/pp5p/2p3pn/5p2/1PPb1P2/6nP/P2BN1PK/R1Q1R3/b Nh6g4+ Larsen1.33.100 r2q1rk1/6p1/3p3p/p2Pp3/5bP1/1PNR1p1P/PQ3P2/5R1K/b Pe5e4 Larsen1.34.100 6k1/5rp1/4Nb1p/2p5/4Q3/1r5P/q5P1/3R1R1K/w Rf1xBf6 Larsen1.35.100 2r4k/1p1b3p/p3p2Q/3pqp2/1P6/6RK/8/7R/w Qh6xPh7+ Larsen1.36.100 8/pppk3p/6p1/6r1/2P2n2/1P3PN1/PB1Pb1rP/R5RK/b Rg2f2 Larsen1.37.100 r1b1k2r/pp1pppbp/2n2np1/q7/3NP3/2N1B2P/PPPQ1PP1/R3KB1R/b Nf6xPe4 Larsen1.38.100 5nk1/pp2q1pp/2p1Pp2/8/2B4P/6P1/PPP5/2KQ4/w Qd1d8 Larsen1.39.100 rn2kb1r/pp2pp1p/2p2p2/8/8/3Q1N2/qPPB1PPP/2KR3R/w Qd3d8+ Larsen1.40.100 r1bq3r/3pb1pp/p4n2/2p1k3/1p2P3/7Q/PPP2PPP/RNB2RK1/w Bc1f4+ Larsen1.41.100 5r2/4Q1bk/3p2pp/Rp5q/1P1p4/3P2P1/3BPP1P/6K1/b Rf8xPf2 Larsen1.42.100 8/2k2p2/5b2/1R3p1P/1p6/r1P1q1P1/4Q3/1K3B2/b Ra3a1+ Larsen1.43.100 r2qr1k1/1p2bppp/1np2p2/p4b2/2PP1B1P/3B1N2/PP1Q1PP1/2KR3R/b Nb6xPc4 Larsen1.44.100 1r4k1/p4p1p/6pb/8/8/1N1RP1P1/Pr1R3P/6K1/b Rb8xNb3 Larsen1.45.100 4r3/pkpn1Rrp/1p2p1p1/3pP1B1/q2P4/P1P2Q2/2P2P1P/3R2K1/b Nd7xPe5 Larsen1.46.100 r2q1rk1/pbp1bppp/1p3n2/3p4/3PnB2/P1NBPN2/1PQ2PPP/R3K2R/w Bf4xPc7 Larsen1.47.100 3r1r1k/pbq2ppp/6n1/2p5/8/P3P2P/BBQ2PP1/1RR3K1/w Bb2xPg7+ Larsen1.48.100 r3bk1r/1pp2p2/p1p1qNn1/4P1Q1/8/8/PPP2PP1/R1BR2K1/w Qg5h6+ Larsen1.49.100 2b3k1/4b1P1/p2pp1p1/2q1P2p/1r3r2/2NB3Q/1PP5/2KR2R1/w Qh3xPh5 Larsen1.50.100 6k1/pbpp2pp/1p2p3/7q/2P1B3/P4r2/1P2nPPP/RQ3R1K/b Rf3h3 Larsen1.51.100 2r1r1k1/2q4p/p5p1/1p1pn3/6nQ/PP1B4/2P3PP/2R1R1NK/b Ne5xBd3 Larsen1.52.100 5rk1/p4pp1/4qb2/1p2p1p1/1Pp1N1r1/8/PP4QP/R1B2R1K/w Rf1xBf6 Larsen1.53.100 6k1/6p1/5b2/8/5P2/1P5P/2rp2P1/3R2BK/b Bf6d4 Larsen1.54.100 4r1k1/p4pp1/1p6/3r4/P1Nb2q1/6Pp/1P1R1P1P/3R1QK1/b Bd4xPf2+ Larsen1.55.100 2kr4/pbp2p2/5q1p/4p3/8/3PBp2/PPPQ1RrP/R6K/b Rg2xPh2+ Larsen1.56.100 r1q1r1nk/pppbBQpp/8/4p1N1/8/2P5/P4PPP/R2R2K1/w Be7f8 Larsen1.57.100 r1bkn2n/pp3p2/3P3p/8/8/5B2/PP3PPP/2R1R1K1/w Rc1xBc8+ Larsen1.58.100 r4rk1/pbp2ppp/1p3Q2/8/2P5/2BR3P/PP2qPP1/6K1/b Qe2g4 Larsen1.59.100 4r2k/1p4r1/2p5/p1bq3p/3B1P2/P2Q2R1/5K2/6R1/w Qd3h7+ Larsen1.60.100 rb5k/1b1N2p1/p4n1p/np6/8/P1PQ2Pq/BP1B1P1P/4R1K1/w Re1e8+ Larsen1.61.100 5q1k/8/8/7r/1P2Q3/8/7P/6RK/b Rh5xPh2+ Larsen1.62.100 2r2r1k/4ppRp/p4n1P/6R1/2q1p3/8/PpN5/1K4Q1/w Rg5c5 Larsen1.63.100 r3k3/1b3qbp/p4Qp1/npp5/8/2P5/P4PPP/R2R2K1/w Rd1d8+ Larsen1.64.100 5r1k/4q2p/p5pP/2pQ4/P2p1R2/8/1PP3P1/7K/w Qd5e5+ Larsen1.65.100 r3br1k/pp5p/4B1p1/4NpP1/P2Pn3/q1PQ3R/7P/3R2K1/w Rh3xPh7+ Larsen1.66.100 7k/6rp/5qb1/1pQp2R1/p4p2/P1P2p2/1P5P/3n1BRK/b Rg7c7 Larsen1.67.100 6rk/pQ5p/B2R4/3n3r/3Np2q/5pP1/PPP2P1P/4R1K1/w Nd4xPf3 Larsen1.68.100 2k2r2/2p5/1pq5/p1p1n3/P1P2n2/1R4Pp/2QR4/6K1/b Nf4e2+ Larsen1.69.100 2br1k2/5pp1/7p/p2B4/2q3P1/7P/3Q1P2/4R1K1/w Re1e8+ Larsen1.70.100 r1r3k1/1q2bp1p/4p1p1/1b2B3/1p4Q1/1P1BR3/P4PPP/R5K1/w Bd3xPg6 Larsen1.71.100 2r4R/p2knrR1/1p1p4/2p1p1p1/2P1B3/2PP1P2/P5K1/8/w Be4c6+ Larsen1.72.100 r2qk2r/1p1nbp1p/p1b1p1pB/2NpP3/1P1P2Q1/P2B4/5PPP/1RR3K1/w Nc5xPe6 Larsen1.73.100 8/2k2p2/1p1p1q2/p1pPpPp1/P1P2nP1/1P2KPN1/3R3r/1Q6/b Pe5e4 Larsen1.74.100 6k1/ppr1r2p/1nq2pp1/3p4/6NR/1PPQ1PP1/P4PK1/7R/w Rh4xPh7 Larsen1.75.100 r7/1bb2p1k/p1n2rpp/1p1q4/1PpP4/P3BNP1/3QBPKP/R3R3/b Rf6xNf3 Larsen1.76.100 2r4k/p2n1p1p/qp2p1pQ/1b1pP3/3P2NP/6P1/1P3PB1/2R3K1/w Rc1c7 Larsen1.77.100 r5k1/pp3pbp/2pprnp1/q3n3/2P1P3/P1N1B1PP/1P3P2/R2QRBK1/b Nf6xPe4 Larsen1.78.100 3r4/2nnR2p/3p2k1/p1pPp1p1/N1P1P3/P2N2P1/6KP/8/w Na4xPc5 Larsen1.79.100 3r1k2/1pq2Pb1/2p4Q/p7/P1n5/2P4P/2P5/R3R2K/w Re1e8+ Larsen1.80.100 8/6R1/4p2Q/4kp2/6PK/1r6/6q1/8/w Qh6xPe6+ Larsen1.81.100 4N2k/1p4p1/pq2p2p/3rP3/4Q1RN/P6P/1P4PK/5r2/w Qe4h7+ Larsen1.82.100 8/7p/6pk/1P4r1/2P2QBK/R6P/6r1/6q1/b Qg1f2+ Larsen1.83.100 2r2rk1/1b3ppp/pq2p3/1pbn2N1/3B3P/1B4P1/PPP1QP2/2KRR3/w Qe2h5 Larsen1.84.100 4Rr1k/R7/5p2/6r1/6N1/6P1/6PK/8/b Rg5h5+ Larsen1.85.100 6k1/p1r2pp1/bp5p/3p4/1Q1N4/4PPPq/PP3K1P/7R/b Ba6f1 Larsen1.86.100 4rk2/bb3p1p/pq3np1/1p1nN3/3P1P2/1B1Q2NP/PP1B2PK/4R3/w Bb3xNd5 Larsen1.87.100 3r4/p1kb1Q1r/BppR1p1p/4pq2/8/2P3P1/PPP2P1P/2KR4/w Rd6xPc6+ Larsen1.88.100 1B4k1/4pp2/p5pp/1r5P/2n3q1/2P2Q2/P1P3P1/2KR3R/b Qg4g5+ Larsen1.89.100 r1b1k2r/ppp3pp/1qp5/2b1Pp2/3Qn3/5N2/PPPBNPPP/3RK2R/w Qd4d8+ Larsen1.90.100 3rr1k1/1p3ppp/p7/R3N1q1/1Q1PR3/8/1P3PPP/6K1/b Rd8xPd4 Larsen1.91.100 3r1rk1/1pq1nppp/p7/2pB3Q/P4P2/1P2P3/6PP/2RR2K1/w Rc1xPc5 Larsen1.92.100 2R4Q/pp1bkp2/4p1r1/qN1p4/Pb6/4B3/1P3PPP/6K1/w Be3b6 Larsen1.93.100 3rr1k1/1b5p/p7/1p3N2/6Pb/P1Q1p3/1PP4P/R5K1/b Rd8d1+ Larsen1.94.100 1r4r1/p2kb2p/bq2p3/3p1p2/5P2/2BB3Q/PP4PP/3RKR2/b Rg8g3 Larsen1.95.100 1r4k1/5ppp/8/3Rp3/p1B1n2P/2P3P1/4QP1K/1q6/w Bc4d3 Larsen1.96.100 6r1/4kp2/p1bRpp2/1pr1P3/5b1p/PBP1N3/1P4PP/1K1R4/w Ne3f5+ Larsen1.97.100 k1b4r/q4p2/p1R5/b2P4/r3p2p/PR2Q3/1PP3PP/1K3B2/w Qe3h6 Larsen1.98.100 2br1rk1/2qnQ2p/p4pp1/4p3/P1p1P1N1/2Pn1N1P/2B2PP1/1R1R1K2/w Rd1xNd3 Larsen1.99.100 r4rk1/pp2ppbp/6p1/8/Qnq1P3/2N1BPPb/PP4NP/R4RK1/b Bh3xNg2 Larsen1.100.100 gnuchess-4.0.pl70/test/CHESSTEST/larsen2.fin100644 21542 13 7167 5527662451 17412 0ustar cracraftuser#Bent Larsen: Bent Larsen's good move guide, Oxford University Press 1982. #48 "FIND THE PLAN" PROBLEMS (CHAPTER 2). # # 8/pp2kppp/4p3/8/1P6/P3PP2/5P1P/2K5/b Ke7f6 Larsen2.1.48 1k2r3/2pr2pp/ppp2p2/5R2/4P1P1/1P1P3P/P1P5/5RK1/w Pb3b4 Larsen2.2.48 5rk1/p3r2p/1pp3p1/5p2/R1PPp2P/4P1P1/P4P2/1R3K2/w Ra4a6 Larsen2.3.48 r1b1k2r/pp1p1p1p/2p2p2/2b1p3/2B1P3/2NP4/PPP2PPP/R4RK1/w Kg1h1 Larsen2.4.48 r1b2r1k/pp2q1pp/2p2p2/2p1n2N/4P3/1PNP2QP/1PP2RP1/5RK1/w Nc3d1 Larsen2.5.48 1rbq1rk1/4n1bp/2n1p3/p1p1Pp2/1pPp1P2/P2P1N2/1PQB1NBP/1R3RK1/w Nf2h1 Larsen2.6.48 2kr3r/1ppq1pbp/p2pbnp1/8/3BP3/2N2P2/PPPQB1PP/1K1R3R/w Qd2g5 Larsen2.7.48 5rn1/1p1bq1rk/p2p1p1p/P1pPn3/4P3/4N1B1/1P1QBRPP/5RK1/w Bg3xNe5 Larsen2.8.48 r2k4/ppp2ppp/2n5/8/3PR3/5N2/PP1K1PPP/8/w Re4g4 Larsen2.9.48 2r2rk1/1p1bq3/p3p2p/3pPpp1/1P1Q4/P7/2P2PPP/2R1RBK1/b Bd7b5 Larsen2.10.48 r2q1rk1/p3ppbp/1pQ3p1/2p1Pb2/8/2P2N2/PPP2PPP/R1B1R1K1/w Qc6a4 Larsen2.11.48 r3k2r/ppqbb2n/1n1p1p2/2pP2p1/P1P1P2p/1PNBB3/3QNRPP/R5K1/w Pe4e5 Larsen2.12.48 4r1k1/5ppp/p2p4/4r3/1pNn4/1P6/1PPK2PP/R3R3/b Nd4f3+ Larsen2.13.48 r4rk1/pppqn1b1/3p2pp/3Ppb2/2P1N3/3BBP2/PP4PP/R2QK2R/w Pg2g4 Larsen2.14.48 4r2r/2p2p2/p1kbp3/Pp1n1p1p/1P1P4/2P1B1P1/1R1K1PNP/3R4/b Ph5h4 Larsen2.15.48 r1b1r1k1/2nnqppp/pp1p4/2pP4/1P2P3/P1NB1N2/5PPP/1R1QR1K1/w Pe4e5 Larsen2.16.48 1r1r2k1/2b1qp1p/b1p3p1/p1p1p3/2P1P3/1PN1BP2/P1Q3PP/R2R2K1/b Rd8d4 Larsen2.17.48 2b5/ppr3pk/2p1pr2/2PpN2p/3P1P1P/P2PK1P1/1R6/1R6/w Rb2b4 Larsen2.18.48 r1bqnrk1/2p2pb1/1p1p2pp/p1nPp3/2P1P1PP/2N1B3/PP1NBP2/R2QK2R/w Ph4h5 Larsen2.19.48 bn6/1q4n1/1p1p1kp1/2pPp1pp/1PP1P1P1/3N1P1P/4B1K1/2Q2N2/w Ph3h4 Larsen2.20.48 r3rnk1/3b1ppp/1q1p1n2/p1pP4/1pP2P2/1P1B2NP/P1QB2PK/1R3R2/w Bd2c1 Larsen2.21.48 r4rk1/1ppnq1p1/p1n1b2p/2P1pp2/8/P2P1NP1/1B2PPBP/2RQ1RK1/w Nf3h4 Larsen2.22.48 r3k2r/1pp1n1bp/p1qn1pp1/3Np3/1PP1P3/1Q3N2/P4PPP/R1BR2K1/w Pb4b5 Larsen2.23.48 r1bq1rk1/pp1n1pb1/3p1npp/3Pp3/4P2P/2N1B3/PP2BPP1/R2QK1NR/w Ph4h5 Larsen2.24.48 1k1r3r/pp2qpp1/3b1n1p/3pNQ2/2pP1P2/2N1P3/PP4PP/1K1RR3/b Bd6b4 Larsen2.25.48 r2qnr2/2pb2k1/1p1p2p1/pNnPp1bp/2P1Pp2/5P2/PPBQN1PP/1K1R2BR/w Bg1xNc5 (planning Ba4; Larsen2.26.48 r3q1k1/2p2p2/1p2pQp1/1Pp1P2p/2P4P/3R2P1/4PPK1/8/w Pg3g4 Larsen2.27.48 r1q2rk1/ppnn2bp/3p2p1/2pPp3/2P1P1Q1/2N4P/PP1B1PB1/R3R1K1/b Rf8f7 Larsen2.28.48 1r1r2k1/p4pp1/2bpp2p/2p5/2P5/1P1BP3/PR3PPP/3R2K1/b Pa7a5 Larsen2.29.48 3qkbr1/1b1n1p1p/4pp2/rB6/P2p1B2/5N2/1P3PPP/R2Q1RK1/b Ra5xBb5 Larsen2.30.48 rnb1kb1r/ppp2ppp/2q1pn2/8/2Q5/5NP1/PP1PPPBP/RNB1K2R/w Pb2b3 Larsen2.31.48 3rb3/1pk3pp/1Np1pn2/rnP1Np2/3P1P2/pR2P1P1/P5BP/2R3K1/w Ph2h3 Larsen2.32.48 r4rk1/p3p2p/3pbppb/2p5/4P3/1P3P2/P1PN1BPP/3R1RK1/b Pa7a5 Larsen2.33.48 6k1/1p6/qP1p1ppb/3Pp2p/1R2P3/1Q3P1P/r2r1BP1/5RK1/b Qa6xRf1+ Larsen2.34.48 1rr5/p1n3p1/3k3p/5p2/3P3P/2N1PBP1/P1RK1P2/8/w Pg3g4 Larsen2.35.48 1r6/5pk1/3ppb2/p1p4p/P1P2P2/1P3NP1/2K1R2P/8/b Kg7g6 Larsen2.36.48 r2q1rk1/ppp3bp/3p1np1/3Ppb2/2P5/2N1BP2/PP1QB1PP/R3K2R/w Pg2g4 Larsen2.37.48 rn1q1rk1/pb2bpp1/1pp1p2p/4P3/3P4/2PB1N2/P1Q2PPP/R1B1K2R/w Ph2h4 Larsen2.38.48 1r4k1/5p1p/p5p1/P6P/2p5/1q3P2/1P4PK/3RQ3/w Qe1e5 Larsen2.39.48 1r2q1k1/1pn2rpp/p1pbppb1/Q7/P2PP3/3NB1P1/1P3PBP/2RR2K1/w Nd3f4 Larsen2.40.48 1r2r1k1/1pqb3p/p2p2p1/P2Pbp2/1PP5/4B1P1/3QBR1P/3R2K1/w Be3b6 (then ...Qc8 2. Larsen2.41.48 r4rnq/3b2k1/1p2p1p1/pP1pPpNp/5P1Q/2PB3R/1P4PP/6RK/w Pc3c4 Larsen2.42.48 r1brn1k1/ppq1nppp/8/2pPp3/2B1P2N/P1P5/5PPP/R1BQR1K1/w Pf2f4 Larsen2.43.48 r2r2k1/1p1n2pp/1np1bp2/p7/P2BP3/4NP2/1P2BKPP/R6R/w Pg2g4 Larsen2.44.48 r2q1rk1/pp2pp1p/3p2p1/n1pP4/2P5/1P3BP1/PQ2PP1P/R4RK1/w Ph2h4 Larsen2.45.48 2rr2k1/pb2bppp/1np1p3/q2p4/N1P5/1P2P1P1/PBQ2PBP/R1R3K1/w Bb2c3 Larsen2.46.48 2rq1rk1/pb2bpp1/1p1p1n1p/4pP2/4P3/1BNQ3R/PPP3PP/R1B4K/b Rc8xNc3 Larsen2.47.48 r2qrnk1/pp3ppb/3b1n1p/1Pp1p3/2P1P2N/P5P1/1B1NQPBP/R4RK1/w Bg2h3 Larsen2.48.48 gnuchess-4.0.pl70/test/CHESSTEST/larsen3.fin100644 21542 13 7040 5527662451 17401 0ustar cracraftuser#Bent Larsen: Bent Larsen's good move guide, Oxford University Press 1982. #63 "PRACTICAL ENDGAME" PROBLEMS (CHAPTER 4). # # 8/ppp3k1/8/PPP5/8/8/6K1/8/w Pb5b6 Larsen4.1.63 8/8/4pppp/8/4PPPP/k7/8/K7/w Ph4h5 Larsen4.2.63 8/5k2/1p2PP1p/p1p3p1/P1P3P1/1P1K3P/8/8/b Kf7xPf6 Larsen4.3.63 8/2k5/p2p3p/2pPp1p1/P5P1/3K4/2P4P/8/w Pa4a5 Larsen4.4.63 8/p7/4k1P1/1p1p3P/1P2pK2/2P5/P7/8/w Ph5h6 Larsen4.5.63 4k3/5p2/3K2p1/4P2p/7P/8/6P1/8/w Pg2g3 Larsen4.6.63 8/7p/p5p1/3k2P1/3p1P1P/3K4/P7/8/w Pa2a3 Larsen4.7.63 8/1p3pp1/8/3k3P/5PP1/8/3K4/8/w Pg4g5 Larsen4.8.63 8/1p3pp1/7p/5P1P/2k3P1/8/2K2P2/8/w Pf5f6 Larsen4.9.63 8/8/3K1k2/5p1p/4p1p1/4P1P1/5PP1/8/b Pf5f4 Larsen4.10.63 8/5p2/2k5/K7/8/1P6/8/8/b Kc6d5 Larsen4.11.63 8/8/4k1p1/6Q1/K7/3q4/8/8/b Qd3d7+ Larsen4.12.63 5q2/6pk/p7/1p3PPK/1P2Q3/8/8/8/w Pg5g6+ Larsen4.13.63 6Q1/8/3p4/2pPk1p1/1p5P/1P4PK/2q5/8/b Pg5g4+ Larsen4.14.63 8/6pk/4QP1p/7K/5qPP/8/8/8/w Pf6f7 Larsen4.15.63 4Q3/Pq4pk/5p1p/5P1K/6PP/8/8/8/w Pa7a8=B Larsen4.16.63 2K5/3r4/5k2/4R3/1P4p1/3P4/8/8/w Re5g5 Larsen4.17.63 8/8/3P4/2p5/3r4/1PK5/1P6/4k3/w Pb3b4 Larsen4.18.63 8/6KP/2r1k3/8/p7/P7/1P5P/8/b Rc6c7+ Larsen4.19.63 K1k5/2r3pp/P4p2/1P6/8/5P1P/8/8/b Rc7c6 Larsen4.20.63 3k4/3P3p/P2R2p1/6p1/8/6PP/1r6/5K2/w Pa6a7 Larsen4.21.63 8/8/5R1P/8/2K5/7r/4p3/4k3/b Ke1d2 Larsen4.22.63 8/2p5/5pK1/5R2/4k2P/p4P2/1r6/8/b Ke4d3 Larsen4.23.63 8/8/4r3/1PP2k2/2R5/5p1p/P6K/8/w Kh2g3! Larsen4.24.63 after 2 ply 4k3/1p3p2/p1pRr1pp/P1P1P3/5PK1/2P5/7P/8/w Ph2h4 Larsen4.25.63 8/8/R7/pp5p/2bK3k/2P5/6P1/8/w Ra6g6 Larsen4.26.63 3K2k1/2R3p1/1p2p2p/3bPp2/5P2/1p4P1/7P/8/w Kd8e7 Larsen4.27.63 R7/1P2p1k1/8/5p2/6p1/7p/7b/5K2/w Ra8a2 Larsen4.28.63 5k2/3R4/6pp/4bp2/8/5K2/8/8/w Rd7d5 Larsen4.29.63 7k/8/pP1N4/3P1p2/5PpP/3r4/7P/6K1/w Nd6f7+ Larsen4.30.63 8/4p3/8/3P3p/P2pK3/6P1/7b/3k4/w Pd5d6 Larsen4.31.63 8/8/3P1k2/2p1pB1p/2P3pP/4K1P1/6b1/8/w Bf5xPg4 Larsen4.32.63 8/8/B4p1p/3k4/p2p1pP1/P2P3P/bP2KP2/8/w Pb2b4 Larsen4.33.63 4B3/8/p7/P3k1p1/1Pb3P1/6K1/5P2/8/w Pf2f3 Larsen4.34.63 6k1/5p1p/6p1/ppp5/4b3/P1P1P3/5PPP/3B2K1/b Pa5a4 Larsen4.35.63 8/8/1bk3p1/p4pP1/P1P5/2BK4/6P1/8/w Pc4c5,Bc3d2 Larsen4.36.63 8/1p3B2/p2k2p1/P2p3p/1P1KbP1P/4P3/8/8/w Pf4f5 Larsen4.37.63 8/5Bp1/4P3/6pP/1b1k1P2/5K2/8/8/w Kf3g4 Larsen4.38.63 8/1Pb5/K7/P5p1/1k4B1/8/3p4/8/w Bg4d1 Larsen4.39.63 8/2b5/8/2Np4/P2K4/7k/8/8/b Bc7a5 Larsen4.40.63 8/1N1b4/1P6/8/7p/4K3/8/6k1/w Nb7d8 Larsen4.41.63 3n4/1p3pk1/p4p1p/P4P1K/1P2B3/5P2/7P/8/w Pb4b5 Larsen4.42.63 8/7k/7P/7P/p1n1p3/2P5/2K5/2B5/b Kh7g8 Larsen4.43.63 8/7k/4B3/8/3p1K2/p1n2P2/8/8/w Be6b3 Larsen4.44.63 8/8/6p1/5n1p/4Bp1P/5P1K/5kP1/8/b Kf2g1 Larsen4.45.63 8/k5p1/p2P1nBp/2p1p2P/2P5/P3K3/6P1/8/w Pd6d7 Larsen4.46.63 7k/6p1/6K1/p5P1/5N2/8/8/8/w Kg6f7 Larsen4.47.63 8/8/8/6N1/5pKp/8/5kn1/8/b Kf2e3 Larsen4.48.63 8/3b1p2/4p1k1/1pn1P1Pp/2pNPKp1/P1P3P1/2B5/8/b Bd7e8 Larsen4.49.63 6k1/6p1/7p/8/pb5N/2B1p2P/PP4P1/3K1b2/b Pe3e2+ Larsen4.50.63 8/8/3k2p1/1p2p2p/pNp1P2P/P1Pn4/1P2K1P1/2bN4/b Nd3c5 Larsen4.51.63 1R2b3/5kp1/1p2rp1p/1P1p4/3P1PP1/3B3P/5K2/8/w Bd3g6+ Larsen4.52.63 6k1/4pp1p/3p2p1/P1pPb3/R7/1r2P1PP/3B1P2/6K1/w Bd2b4 Larsen4.53.63 6k1/4pp1p/3p2p1/R2P4/2P5/1r3P2/1p1B2PP/5K2/w Ra5b5 Larsen4.54.63 5k2/4bp2/2B3p1/1P4p1/3R4/3P2PP/2r2PK1/8/b Rc2xPf2+ Larsen4.55.63 7R/8/6pp/4p1k1/3b2P1/5KNP/8/4r3/b Re1e3+ Larsen4.56.63 8/pp1k3p/2pr1p2/3n4/P1B2P1P/2P2KP1/8/4R3/w Bc4d3 Larsen4.57.63 8/7R/1pkpp1r1/p1n1p3/P1K1P3/2P1NP2/1P4P1/8/w Ne3d5 Larsen4.58.63 2r3k1/pR6/4r1p1/6Pp/3p3P/3P4/PP1Kp3/6R1/b Re6c6 Larsen4.59.63 4nk2/5pp1/2B1p2p/4q3/8/7P/5PP1/5QK1/w Bc6xNe8 Larsen4.60.63 7K/8/k1P5/7p/8/8/8/8/w Kh8g7 (Reti Study pag Larsen4.61.63 2b5/2P5/8/1k5p/5K1P/6B1/6P1/8/b Kb5a6 Larsen4.62.63 8/4k3/4P3/3K4/8/8/8/8/b Ke7e8 Larsen4.63.63 gnuchess-4.0.pl70/test/CHESSTEST/openings.fin100644 21542 13 25442 5527662451 17702 0ustar cracraftuser#The object of this file is to present positions in the opening in #which there is thought to be a unique best move. This test will only #be of much interest if the computer taking the test, is playing with #its opening book turned OFF. Otherwise a lot of the answers will be #directly in the book. Of course, it helps to have a book in non-book #positions because of transposition possibilities, but situations where #that is the case, are basically not represented in this file. # #First, A. Alekhine: My greatest games of chess #1908-1937, 2 volumes in 1, Dover 1985. AlekhineI is volume I, #1908-1923. AlekhineII is volumeII, 1924-1937. I'm going by Alekhine's #comments in which he says things like the move was "necessary" or #"best"; in nearly all these cases, something else (i.e. which Alekhine #considered to be a mistake) was played in the game. begin examples from (AlekhineI) rnbqkb1r/pppp1ppp/5n2/4p3/2B1P3/2N5/PPPP1PPP/R1BQK1NR/b Nf6xPe4! (AlekhineI) p1 r3kbnr/1ppb1ppp/p7/2p5/4P3/1P6/P1P1NPPP/RNB1K2R/b Pc5c4! (AlekhineI) p4 r1bq1rk1/pppnbppp/4pn2/3p2B1/2PP4/2N1PN2/PPQ2PPP/R3KB1R/b Pc7c5 (AlekhineI) p.9 r1bqkbnr/pp1p1ppp/2n1p3/2p5/2P1P3/2N2N2/PP1P1PPP/R1BQKB1R/b Nc6d4 (AlekhineI) p19 r1bqkb1r/pppp1ppp/2n2n2/4P3/3N4/8/PPP2PPP/RNBQKB1R/b Nc6xPe5 (AlekhineI) p25 r2q1rk1/ppn1ppbp/2p1bnp1/3P4/3P4/P1NBPN2/1PQ2PPP/R1B2RK1/b Nf6xPd5 (AlekhineI) p32 r1bqk1nr/2pp1ppp/p1n5/1pb1p3/4P3/1B3N2/PPPPQPPP/RNB1K2R/w Pa2a4! (AlekhineI) p43 r1bq1rk1/2ppbppp/p1n2n2/1p2p3/4P3/1BP2N2/PP1PQPPP/RNB1K2R/w Pd2d4 (AlekhineI) p54 r1bqkb1r/pppp1ppp/2n2n2/1B2p3/4P3/2N2N2/PPPP1PPP/R1BQK2R/b Nc6d4! (AlekhineI) p60 rnbqkb1r/ppp2ppp/8/3P4/4nP2/5N2/PPP3PP/RNBQKB1R/b Bf8c5 (AlekhineI) p66 rn1qk2r/ppp2ppp/8/2bP1b2/4nPP1/5N2/PPP1Q2P/RNB1KB1R/b Ke8g8C! (AlekhineI) p66 r2qk1nr/ppp2ppp/2npb3/2b1p3/2B1P3/2NP1N2/PPP2PPP/R1BQK2R/w Bc1e3! (AlekhineI) p82 r3k2r/1pp1qpp1/1pnpbn1p/4p3/2B1P2B/2NP4/PPP2PPP/R2QK2R/w Pf2f3! (AlekhineI) p113 rnbqk2r/pppp1ppp/4pn2/8/1bPP4/2N5/PPQ1PPPP/R1B1KBNR/b Pc7c5 (AlekhineI) p115 rnbqkbnr/pppp1ppp/8/8/2B1P3/8/PB3PPP/RN1QK1NR/b Pd7d5! (AlekhineI) p126 rn1qkb1r/pbpp1ppp/1p2pn2/8/2PP4/5NP1/PP2PPBP/RNBQK2R/b Bf8e7 (AlekhineI) p137 r1bqk2r/pppn1ppp/3bpn2/3p4/2PP4/2N1PN2/PP3PPP/R1BQKB1R/w Pc4c5 (AlekhineI) p140 r1bq1rk1/pp1n1ppp/2p1pn2/3p4/2PP4/2NBPN2/PP1Q1PPP/R3K2R/w Ra1d1! (AlekhineI) p143 r1bqkb1r/1pp2ppp/p1n1p1n1/2Pp4/3P1B2/2N2N2/PP2PPPP/R2QKB1R/w Bf4e3! (AlekhineI) p154 r1bqk2r/4nppp/ppnbp3/3p3P/3P4/2N1BN2/PP2PPP1/R2QKB1R/w Ph5h6! (AlekhineI) p154 rnbqkb1r/p2p1ppp/4pn2/1ppP4/2P5/5N2/PP2PPPP/RNBQKB1R/w Bc1g5 (AlekhineI) p158 r1bqk2r/2pp1ppp/p1n2n2/1pb1p3/4P3/1BN2N2/PPPP1PPP/R1BQK2R/w Nf3xPe5 (AlekhineI) p192 rn1qkb1r/pbpppppp/1p3n2/8/2PP4/2N5/PP2PPPP/R1BQKBNR/w Qd1c2 (AlekhineI) p199 r1b2rk1/pp1nq1pp/2p1p3/3p1p2/2PP4/2QBPN2/PP3PPP/R4RK1/w Ra1c1! (AlekhineI) p220 r1bqkb1r/pppp1ppp/5n2/1B6/3pP3/2N5/PPPP1PPP/R1BQK2R/w Pe4e5 (AlekhineI) p221 r1bq1rk1/pp1nbppp/2p1pn2/3p2B1/2PP4/2NBPN2/PP3PPP/2RQK2R/b Pd5xPc4 (AlekhineI) p234 r1bqr1k1/pp3ppp/2p1pn2/3n2N1/2BPN3/4P3/PP3PPP/2RQ1RK1/w Ne4g3 (AlekhineI) p234 r1bq1rk1/pppn1pbp/3p1np1/8/2PN4/2N3P1/PP2PPBP/R1BQ1RK1/w Pb2b3 (AlekhineI) p244 rnbqkb1r/pp1p1ppp/4pn2/8/3NP3/8/PPP2PPP/RNBQKB1R/w Nb1c3 (AlekhineI) p245 r1bq1rk1/ppp1nppp/1bnp4/8/3NP3/2P1B3/PP1NBPPP/R2Q1RK1/b Pf7f5! (AlekhineI) p248 r1bqk2r/2p1bppp/p1np1n2/1p2p3/P3P3/1BN2N2/1PPP1PPP/R1BQ1RK1/b Pb5b4! (AlekhineI) p255 begin examples from (alekhine2) rnbqkbnr/pppp1ppp/8/8/3Np3/6P1/PPPPPP1P/RNBQKB1R/b Pc7c5! (alekhine2) p11 rn1qkbnr/ppp1pppp/8/4N2b/2pP4/2N5/PP2PPPP/R1BQKB1R/b Nb8d7 (alekhine2) p23 r1bq1rk1/1ppnbppp/p3pn2/3p2B1/2PP4/2N1PN2/PP3PPP/2RQKB1R/w Pc4xPd5 (alekhine2) p45 rnbqkb1r/pp1ppppp/5n2/2p5/2P5/5N2/PP1PPPPP/RNBQKB1R/w Nb1c3 (alekhine2) p90 rnbqk1nr/ppp2ppp/4p3/8/3Pp3/P1N5/1PP2PPP/R1BQKB1R/b Nb8c6 (alekhine2) p94 2kr1b1r/pp1b1pp1/2n2q1p/8/8/2N1P3/PP1Q1PPP/R3KBNR/w Nc3d5 (alekhine2) p103 r3kb1r/pp2pppp/2n5/qB1n4/3P2b1/2N2N2/PP3PPP/R1BQK2R/w Qd1b3! (alekhine2) p110 r2q1rk1/2p1bppp/p1n5/1p1n4/3P2b1/1B2BN2/PP1N1PPP/R2Q1RK1/w Qd1b1! (alekhine2) p119 r1bqk2r/pppnnpbp/3pp1p1/8/2BPP3/2N2N2/PPP2PPP/R1BQ1RK1/w Pa2a4 (alekhine2) p124 r2q1rk1/1b1nbppp/pp3n2/2pp2B1/B2P4/2N1PN2/PP3PPP/2RQ1RK1/w Bg5xNf6 (alekhine2) p129 r1bqkb1r/5ppp/4pn2/1p2N3/3p4/3B4/PP3PPP/R1BQK2R/w Qd1f3! (alekhine2) p133 rnb1kbnr/pp2qppp/3p4/2pP4/4PB2/6P1/PPP4P/RN1QKBNR/w Ng1f3! (alekhine2) p139 r2q1rk1/1pp2ppp/p1n1pn2/8/Pb1P4/4P3/1P1NNPPP/R1BQ1RK1/b Pe6e5 (alekhine2) p173 (open up lines if better developed) r2qr1k1/1pp2ppp/p1nb1n2/8/P2Pp3/4P1N1/1P1B1PPP/R2QNRK1/b Bd6xNg3! (alekhine2) p173 r1bqk2r/pp2bppp/2nppn2/1B6/4P3/1NN5/PPPQ1PPP/R1B1K2R/b Ph7h6 (alekhine2) p182 r4rk1/2q1bppp/p2p1n2/npp1p3/3PP1b1/2P2N2/PPB2PPP/R1BQRNK1/w Nf1e3 (alekhine2) p205 rnbqkb1r/pp3ppp/4pn2/2pP4/3P4/2N2N2/PP2PPPP/R1BQKB1R/b Nf6xPd5 (alekhine2) p249 rnbqkbnr/ppp2ppp/8/3P4/3p4/2P5/PP3PPP/RNBQKBNR/b Ng8f6 (alekhine2) p250 r1b2rk1/ppp2ppp/2n2n2/3q4/1b1P4/2N2N2/PP2BPPP/R1BQ1RK1/b Qd5a5 (alekhine2) p250 #A few other examples follow rnbqkbnr/pppp1p1p/8/4N3/4PppP/8/PPPP2P1/RNBQKB1R/b Ng8f6 std King's gambit position; the best move, says Horowitz's book on chess openings rnbqkbnr/pppp1ppp/8/4p3/4PP2/2N5/PPPP2PP/R1BQKBNR/b Pd7d5 std Vienna, only decent move #Standard opening positions with a unique best move, but which is hard #to find for the uninitiated. Going by statements made in Modern Chess #Openings 13, ed. by W. Korn. begin examples from (MCO) rnbqkb1r/pppp1ppp/5n2/4p3/2B1P3/3P4/PPP2PPP/RNBQK1NR/b Pc7c6 (MCO) std bishops opening rnbqk2r/pp1p1ppp/4pn2/2p5/1bPP4/2N1P3/PP3PPP/R1BQKBNR/w Ng1e2 (MCO) std nimzo indian rnbqkb1r/pp1ppppp/5n2/2p5/2PP4/8/PP2PPPP/RNBQKBNR/w Pd4d5 (MCO) std benoni r1bqkbnr/pppp1ppp/2n5/4p3/3PP3/5N2/PPP2PPP/RNBQKB1R/b Pe5xPd4 std scotch #Opening positions from Nimzowitsch: Chess Praxis, Dover 1962. begin examples from (Nimzowitsch_Praxis) r1bqkbnr/pp3ppp/2n5/2pp4/3P4/2N2N2/PP2PPPP/R1BQKB1R/w Pg2g3 (Nimzowitsch_Praxis) ("a refutation of black's opening") game 65. r1bqk2r/pppp1ppp/2n2n2/4N3/1b1PP3/2N5/PPP2PPP/R1BQKB1R/b Qd8e7 (Nimzowitsch_Praxis) game 69 #Opening positions from Karpov's collected games, David Levy editor, Robert Hale and Co., London 1975 begin examples from (Karpov) rnbqr1k1/pp3pp1/3ppn1p/2pP4/1bP1P2B/2NB1P2/PP4PP/R2QK1NR/b Pe6xPd5 (Karpov) Lukin-Karpov p61 r1bqk2r/2p1bppp/p1np1n2/1p2p3/P3P3/1BP2N2/1P1PQPPP/RNB1K2R/b Bc8b7 (Karpov) karpov-moles p67 r2q1rk1/1bp1bpp1/p1np3p/1p2p1B1/P2PP3/1BP2N2/1P2QPPP/RN2R1K1/b Be7xBg5 (Karpov) karpov-moles p67 r1b2rk1/pp2qppp/8/b1P1n3/N1BpP3/P7/1PQ2PPP/R1B2RK1/w Bc4d5 (Karpov) karpov-timman p69 r3kb1r/2qp1ppp/p1n1p3/2P5/PpB3n1/3QBN2/1PP2PPP/R3K2R/w Bc4xPa6 (Karpov) vibornov-karpov p77 r5k1/pp1bpp1p/3p2pQ/2q1n1Pn/4P3/1B3PN1/P1P5/2KR3R/b Bd7g4! (Karpov) karpov-gik p78 2r2rk1/pb1nq1pp/8/2pp1p2/1P2n3/4PN2/PBQ1BPPP/2RR2K1/b Pc5c4 (Karpov) vaganian-karpov p83 r1bq1rk1/1p1nppbp/p2p1np1/2pP4/2P1P3/2N2NP1/PP3PBP/R1BQ1RK1/b Pb7b5 (Karpov) karpov-adorjan p96 r2qk2r/pp3ppp/3bpnb1/2p1N3/3P2PP/2P5/PP2QP2/R1B1KB1R/w Bf1g2 (Karpov) karpov-zaitsev p105 r2qk2r/pp3ppp/3bpn2/1Q2N2P/3pb1P1/2P2P2/PP6/R1B1KB1R/b Nf6d7 (Karpov) karpov-zaitsev p105 1r1q1rk1/3bnpbp/pp4p1/2pNp3/2P5/3P2P1/P2BPPBP/1R1Q1RK1/w Pa2a4 (Karpov) barcza-karpov p109 2rq1rk1/pb2bpp1/1p2pB1p/3nN3/2pP4/P1N5/1P2QPPP/1B1R1RK1/b Nd5xNc3! (Karpov) ivkov-karpov p115 r1bq1rk1/p2n1ppp/1p2pn2/8/1bBP4/2N2N2/PP2QPPP/R1BR2K1/b Bc8b7 (Karpov) yepez-karpov p117 r2q1rk1/pp2ppbp/1nn3p1/2Pp1b2/3P4/1PN2N1P/P3BPP1/R1BQ1RK1/b Nb6d7 (Karpov) dementeev-karpov p123 r2qkb1r/1b1p1ppp/p1n1p3/1p6/4PB2/2N3P1/PPPQ1PBP/R4RK1/b Pd7d6 (Karpov) orlov-karpov p142 r2qkb1r/1p3p1p/p1b2p2/4p3/8/4N3/PPP2PPP/R2QKB1R/w Bf1c4 (Karpov) karpov-taimanov p143 rnbqkb1r/p1p2ppp/4p3/1p1nN3/2pP4/6P1/PP2PPBP/RNBQK2R/w Pa2a4! (Karpov) lengyel-karpov p153 r1bqkb1r/1p1n1ppp/p1npp3/6P1/3NPP2/2N1B3/PPP4P/R2QKB1R/b Ph7h6 (Karpov) karpov-hort p156 r1bqkb1r/1ppp1ppp/p1n5/4p3/B3n3/5N2/PPPP1PPP/RNBQ1RK1/w Pd2d4 (Karpov) karpov-savon p160 rn2kb1r/1pq2ppp/p2pbn2/4p3/P3PP2/1NN5/1PP1B1PP/R1BQK2R/b Nb8c6? (Karpov) karpov-mecking p165 this is an error; it is essential to be able to reply to f5 with ...Bc4. r4rk1/3bbppp/p1npp3/qp6/2P1P3/1P4P1/PB2NPBP/R2Q1RK1/w Pc4c5 (Karpov) keene-karpov p165 2rr1bk1/2qb1ppp/ppnpp3/8/P1P1PP2/1PB3P1/1Q2N1BP/R4RK1/b Pb6b5! (Karpov) keene-karpov p165 rnbqkb1r/pppp1ppp/4pn2/6B1/3P4/5N2/PPP1PPPP/RN1QKB1R/b Pc7c5 (Karpov) korchnoy-karpov p167 r4rk1/1pqbbppp/p1nppn2/8/P3PP2/1NN1B3/1PP1B1PP/R2Q1R1K/b Pb7b6 (Karpov) karpov-cobo p178 r1bq1rk1/pp2ppbp/2np1np1/8/3NP1P1/2N1BP2/PPPQ3P/R3KB1R/b Bc8e6 (Karpov) karpov-dueball p181 rnbqkb1r/ppp3pp/5n2/3p1pB1/3P4/5N2/PPP2PPP/R2QKBNR/b Bf8e7 (Karpov) karpov-enevoldsen p184 r1bq1rk1/1p2ppbp/2np1np1/p7/2BNP3/2N1BP2/PPPQ2PP/R3K2R/w Pa2a4 (Karpov) karpov-d.byrne p196 r1bq1rk1/pppp2pp/2n2n2/2b1p3/2P2P2/2NP2P1/PP3PBP/R1BQK1NR/w Pf4xPe5 (Karpov) karpov-bellon p249 #E. Znosko-Borovsky: How to play the chess openings, Dover reprint. begin examples from (Znosko) r1bqk2r/pp1nbppp/2pp3n/4p1N1/P1BPP3/8/1PP2PPP/RNBQK2R/w Bc4xPf7+ (Znosko) game 1 r1bqk2r/pppp1ppp/2n5/8/2BP4/1Q3N2/P4PPP/b1B2RK1/w Bc4xPf7+ (Znosko) (Greco's trap in Moller Attack of GP. Previous move was ...B(c3)xR(a1), which this refutes... white's developmental advantange is too great, is one way to look at it, another is that there is a [very deep] forced win...) game 2 rn1qk2r/ppp2ppp/8/2bP1b2/4nP2/5N2/PPP1Q1PP/RNB1KB1R/w Nb1c3 (Znosko) (g4 is bad) game 3 r1bq1rk1/pppnbppp/4pn2/3p2B1/2PP4/2N1PN2/PP3PPP/2RQKB1R/b Pc7c6 (Znosko) is "forced" game 4 2rr1bk1/p4ppp/1p2p3/8/1P1B4/Pq2P1P1/4QP1P/R3R1K1/b Rc8c2 (Znosko) grabbing 7th rank game 5 r3k2r/pbqpbppp/2n1p3/2pn4/8/2PBPNN1/PP1BQPPP/R3K2R/b Pg7g5 (Znosko) (Also was keene #28) game 6 8/8/8/1p5r/p1p1k1pN/P2pBpP1/1P1K1P2/8/b Pb5b4 (Znosko) game 7 8/p4K2/P7/8/8/8/1k6/8/w Kf7e6 (Znosko) game 8 8/8/6kp/p7/1p4P1/1P3K2/P1P5/8/w Pc2c4 (Znosko) game 9 8/1p4p1/pB2k3/P6R/2r1PP1P/8/8/4b1K1/w Kg1g2 (Znosko) game 10 4k3/p1r1r1p1/2q2p1p/3b1P2/3PpNP1/2p1P1R1/P3QK1P/2R5/w Rc1xPc3 (Znosko) game 11 5rk1/p1p3p1/1p2p3/6Qq/5R1P/5bP1/P3PP2/6K1/w Rf4xRf8+ (Znosko) game 12 #Positions from "KLOP": #R.D. Keene and D.N.L. Levy: How to play the chess openings, #Batsford, 2nd ed 1980. begin examples from (KLOP) r2qk2r/ppp2ppp/2np1n2/2b1p2b/2B1P1P1/2NP1N1P/PPP2P2/R1BQ1RK1/b Nf6xPg4 (KLOP) p14 r1bq1rk1/ppp2pbp/3p1np1/2nPp3/2P1P3/2N2N2/PPQ1BPPP/R1B2RK1/b Pa7a5 (KLOP) p16 r1bqk2r/pppp1Npp/2n2n2/2b1p3/2B1P3/8/PPPP1PPP/RNBQK2R/b Bc5xPf2+! (KLOP) p73 wilkes-barre r1bqkbnr/pppp1ppp/2n5/1B2p3/4P3/5N2/PPPP1PPP/RNBQK2R/b Pa7a6! (KLOP) p77 r1b1k1nr/1p1p1ppp/p1nQ1q2/4p3/4P3/8/PPP2PPP/RNB1KB1R/w Qd6d1! (KLOP) p92 rnbqkb1r/pp2pppp/3p1n2/8/3NP3/5P2/PPP3PP/RNBQKB1R/b Pe7e5! (KLOP) p98 rn1qkbnr/pp2pppp/2p5/5b2/3P4/6N1/PPP2PPP/R1BQKBNR/b Bf5g6 (KLOP) p124 r1bqkbnr/ppp1pppp/2n5/3p4/2PP4/8/PP2PPPP/RNBQKBNR/w Nb1c3 (KLOP) p142 r1bq1rk1/pppnnpbp/3p2p1/3Pp3/2P1P3/2N5/PP2BPPP/R1BQNRK1/w Ne1d3 (KLOP) p168 r1b1qrk1/pp1nb1pp/2p1pn2/3pNp2/2PP4/1PN3P1/P3PPBP/R1BQ1RK1/w Ne5d3! (KLOP) p183 r1b2rk1/pp5p/2pbpn2/3p1ppq/2PP4/1PBNPPP1/P3Q1BP/R4RK1/w Bc3b4! (KLOP) p184 r1b1kbnr/pp3ppp/1qn1p3/2ppP3/3P4/2PB1N2/PP3PPP/RNBQK2R/b Pc5xPd4 (KLOP) p121 #all done. gnuchess-4.0.pl70/test/CHESSTEST/positional.fin100644 21542 13 37406 5527662451 20244 0ustar cracraftuser# #It seems to me that what the computer-chess world needs is something #like Reinfeld's 1001 position test set, only for "positional" and not #tactical play. That is, where the compensation you get for making the #right move is probably not going to be seen by an evaluation function #that only knows about material and checkmate. (Unless it looks very #deep... Or at any rate, if you know more, you are likely to find the #answer faster...) # #The Bratko-Kopec 24 position set was perhaps a step in this direction, #but is too small. Berliner, Kopec and Northam were attempting to #construct a large high quality test set with complete coverage of a #subject classification scheme they'd invented for chess themes... #(See: Advances in Computer Chess, 6) but they abandoned the project. # #I have tried to pick hard examples of a "positional" nature although #the distinction is blurred (material does matter, some are indeed #"totally" tactical, and looking ahead far enough would see material #gain in some of them... also some are easy, not hard... and also it is #harder to be certain of problem correctness than in a pure-tactics #test set...) # #They include: #26 Test positions from Raymond Keene & Andrew Whitely: #Ray Keene's good move guide, Oxford University Press 1982. # #10 Test positions from Max Euwe: #Strategy and Tactics in Chess, David McKay Co., NY. # #18 Test positions from Reuben Fine: The world's great chess games, #Bonanza Books NY 1956. # #25 Test Positions from Aron Nimzowitch: My system, edited by Lou Hays, #Hays Publishing Inc., Dallas Texas 1991. # #10 from F. Reinfeld: The complete chessplayer, Prentice-Hall 1953 # #10 from H. Berliner, D. Kopec, E. Northam: A taxonomy of concepts for #evaluating chess strength, Adv. Computer Chess 6, ed. D.F. Beal, Ellis #Horwood 1991, pages 179-191. # #4 from Andrew J. Palay: Searching with probabilities, Pitman 1985 # #Finally at the end I have appended the Bratko-Kopec set (24) from #D.Kopec and I. Bratko: A comparison of human and computer performance in chess, #page 57-72 in Advances in Computer Chess III, #edited by M.R.B. Clarke, Pergamon 1982. (These in turn were mostly or #entirely extracted from Hans Kmoch: Pawn power in chess, Dover publications.) # #and 16 test positions from David Levy: "How computers play chess," and #a few from Levy and R. Keene: How to beat your chess computer, and 8 #other problems. These were mostly snarfed off the net and are now #converted to have the same format as the other positions. # #Note, the LEVYKEENE set includes some positions *not* featuring a #single correct move, but instead featuring a definitely incorrect move #(with "?") which computers might foolishly want to make. # # #begin examples from (Keene) r1b3k1/1pqnb1pp/p1p1pr2/PPPp1p2/3P4/2B1PN2/2Q1BPPP/R4RK1/w Pb5xPa6 (Keene) #8. 1q1n4/2p2pbk/Qp1p1npp/1P1Pp3/1P2P3/1B2BP1P/3N2P1/6K1/w Bb3c4 (Keene) #11. 2krr3/pp3ppp/2b5/6q1/3P4/4N3/PP3PPP/R2Q1RK1/w Ra1c1 (Keene) #12. 1q2r1k1/r4pp1/p1p4p/2Ppn1b1/5B2/3B2P1/PPQ1RP1P/R5K1/w Bf4xNe5 (Keene) #13. r4rk1/pp2q1pp/2n1pn2/3p2B1/8/2P3P1/P3PPBP/R2Q1RK1/w Pc3c4 (Keene) #15. r2qk2r/2p1bppp/p1n1n1B1/1p1pP3/8/2P4P/PP1N1PPN/R1B1QRK1/b Pf7xBg6 (Keene) #16. 3r1rk1/p3qp1p/2bb2p1/2pp4/8/1P2P3/PBQN1PPP/2R2RK1/b Pd5d4 (Keene) #17. 6k1/p4p2/2r1p1p1/3p1n2/1q1P3p/1P5P/P3NPP1/1Q1R2K1/b Pa7a5 (Keene) #18. 1r2q1k1/p1rn3p/1pp1pp2/P2n4/1P1P4/Q4N2/5PPP/2RR1BK1/w Pb4b5 (Keene) #19. r2qrnk1/pp3bpp/1bp2p2/1P1p4/3P1P2/3BNNP1/P1Q2P1P/R4RK1/b Bf7h5 (Keene) #21. 6k1/4bpp1/1nq1p2p/pp1b4/3P4/PPQ2BPP/1B1N1PK1/8/b Bd5xBf3+ (Keene) #22. 2rq1rk1/pp2bpp1/2pn1n1p/3p4/3P1B1P/2NBP3/PPQ2PP1/R3K2R/w Pg2g4 (Keene) #25. 4r2k/p1p1rpp1/1pbpq2p/4n3/2P1PB2/2P2PP1/P3BR1P/2QR2K1/b Pf7f5 (Keene) #27. 8/8/4p3/1k1n1p2/pbpP1Pp1/2N3P1/PP6/4BK2/b Bb4xNc3 (Keene) #29. 3rn1k1/p4p2/2p1p1p1/4P1q1/P1B1N3/1P3R2/2nr1PP1/4RQK1/b Qg5xPe5 (Keene) #32. 5k2/p1p3p1/8/1p2p3/7P/5PP1/P3KP2/8/b Pa7a5 (Keene) #34. 4r1k1/p1p3pp/npRb4/5p2/3Pp3/P3B1P1/1P2PPBP/6K1/w Be3f4 (Keene) #35. 3r1k2/2q4p/4bpp1/1pp1p2n/2n1P3/2P1N1PP/1P2QP1N/R2B2K1/w Ne3d5 (Keene) #38. r2q1rk1/pppb1ppp/3b1nn1/3Pp1N1/1PB5/P1N1P2P/1B3PP1/R2QK2R/w Ng5e6 (Keene) #41. r1r3k1/1p1n1pbp/1q1Bp1p1/p3P1N1/PnBp4/1R5P/1P2QPP1/5RK1/b Rc8xBc4 (Keene) #42. 3r2k1/pp4bp/2n1pnp1/2p5/8/2N1PN2/PP2KPPP/R1B5/w Nf3g5 (Keene) #44. r2r2k1/ppp2pb1/2n1bnpp/4p3/4P3/2N1BN1P/PPP1BPP1/R2R2K1/b Nf6e8 (Keene) #48. r1bq2k1/p5bp/3p1nnr/P1pPp3/2P1Pp2/1NN2R1P/4B1P1/1R1QB1K1/b Ng6h8 (Keene) #49. r3k2r/ppqb2pp/4p3/3pn3/P1p5/B1P5/2P1BPPP/R2QR1K1/w Qd1d4 (Keene) #50 q4r2/1bn1ppkp/3p1np1/1ppP4/r3P3/2PBQNNP/1P3PP1/3RR1K1/w Pe4e5 (Keene) #63 rnbqk2r/p3ppbp/3p1np1/2pP4/2B1P3/2N2N2/PP3PPP/R1BQK2R/w Pe4e5 (Keene) #70. begin examples from (Euwe) 1k1r4/1p6/p1prnp2/P3p1p1/1PP1P2p/5P2/2R1NKPP/1R6/b Rd6d2 (Euwe) #page 24. 2rr2k1/5pp1/p2qp2p/1p1n4/3P4/1P3N1P/P2QRPP1/2R3K1/b Qd6f4 (Euwe) #page 34. 1r3rk1/pbpp1qpp/1p1b4/2nN2P1/2PQ1p1P/2B5/PP2PPB1/2KR3R/w Ph4h5 (Euwe) #page 41. r1bq1rk1/1p1nbppp/p1p2n2/3p2B1/3P4/2NBPN2/PPQ2PPP/R3K2R/w Pg2g4 (Euwe) #page 42. r4rk1/p3bppp/2p1bn2/1q1p4/N7/4BPP1/PP2P1BP/2RQ1RK1/w Be3c5 (Euwe) #page 46. r1b1rnk1/1p2qppp/p1p5/3p3n/3P4/P1NBPN2/1PQ2PPP/2R2RK1/w Pb2b4 (Euwe) #page 48. r1b1r1k1/1p3pp1/p3pq1p/7Q/3P1P2/4P3/P5PP/1BR2RK1/w Pg2g4 (Euwe) #page 55. 3rr1k1/p1p2ppp/1p3n2/2PP4/8/4BP2/P4P1P/1R1R2K1/w Pd5d6 (Euwe) #page 156. 6k1/5pp1/2Q4p/1p3q2/1P1P1N2/8/3n1PP1/6K1/w Pd4d5 (Euwe) #page 160. begin examples from (Fine) r1b1r1k1/1pp1n1pp/p1pb1p2/8/4PP2/1NN5/PPP3PP/R1B2RK1/w Pf4f5 (Fine) #page 54. 8/8/6P1/2k5/4KP2/1p6/1N1r4/8/w Ke4f3 (Fine) #page 58. 2r1rk2/1b3pp1/p1nq1b1p/1p2p2Q/3pP1NP/3P2P1/PP2B2N/R5RK/b Nc6e7 (Fine) #page 64. 8/pr2k1pp/8/R7/8/4PK2/P5PP/8/w Ra5a6 (Fine) #page 84. r2qr1k1/1p3pp1/2b2n1p/p1bpN3/5P2/P1N1P3/1PQ3PP/1B2RR1K/w Pe3e4 (Fine) #page 92. 6b1/p5k1/2p1q3/5QP1/3PpPp1/P3P1K1/1P6/8/w Kg3xPg4 (Fine) #page 119 4k3/1R5p/r4pp1/p1P5/3PP3/6P1/6KP/8/w Rb7b6 (Fine) #page 124. r1bqr1k1/pppn1ppp/3bpn2/3p4/2P5/1P3NP1/PB1PPPBP/RN1Q1RK1/w Pd2d4 (Fine) #page 126. r1b1kb1r/p2p1pp1/n3pq1p/1NpP4/1pP5/5N2/PP2PPPP/R2QKB1R/w Pe2e4 (Fine) #page 136. 8/1p1nk1n1/p2p1ppp/P2Pp3/1P2PP1P/4K1PB/8/2B5/w Pf4xPe5 (Fine) #page 173. 2rr2k1/1p1bbp1p/pn2pp1B/8/8/4PN2/PP3PPP/1BRR2K1/b Nb6a4 (Fine) #page 177. r1q2r1k/p2n2pp/1p1p1b2/2pP1p2/2P1pP2/1QB1N1P1/PP2P2P/R4R1K/w Ne3xPf5 (Fine) #page 194. r2q1rk1/pp4pp/2n1p1n1/3pPp2/8/P2B1NQ1/1PP2PPP/RNB1R1K1/b Nc6b8 (Fine) #page 196. 2r1rnk1/pp3p1p/5bp1/q2p4/2pP4/1PN1PN2/P1Q2PPP/R4RK1/w Pb3b4 (Fine) #page 203. 2r5/7p/p1n1kn2/Pp2pp2/1P4P1/2NK1P2/1R1N3P/8/b Pe5e4+ (Fine) #page 228. 3qk2r/3b1pp1/1r1Bp1p1/pp1pP3/n1pP4/2P3Q1/2P2PPP/RR3BK1/b Rb6xBd6 (Fine) #page 240. r1bq1rk1/pp2ppbp/n4np1/8/2QpP3/2N2N2/PP2BPPP/R1BR2K1/b Pe7e5 (Fine) #page 251. rn1q1rk1/p3bppp/b3p3/1p1pB3/3P4/2N3P1/PP2PPBP/2RQ1RK1/w Pe2e4 (Fine) #page 255. begin examples from (Nimzo) rnb1kb1r/1p3ppp/p5q1/4p3/3N4/4BB2/PPPQ1P1P/R3K2R/w Ke1c1C (Nimzo) page 169_2. r2q1rk1/2p1bppp/p2p1n2/2p1p3/4P3/3P1N2/PPP1QPPP/R1B2RK1/w Nf3d2 (Nimzo) planning Nc4 page 176_1. 3r1k2/3r1pb1/1ppp1qpp/p1n5/2P2N2/1P2PPR1/P2R1P1P/1B1Q3K/b Ph6h5 (Nimzo) #page 179 r4rk1/3q2pp/p2bp3/1b1p1p1n/1p1PP3/6PP/PP1B1PBK/1NRQ2R1/b Pf5xPe4 (Nimzo) #page 181_1 3r4/pp1rk1pp/n3pp2/8/2RN1P2/4P3/PP2K1PP/2R5/w Pa2a4 (Nimzo) #page 185 3rqnk1/pb4pp/1p1b1p2/2pP1N2/8/1P1Q4/PB3PPP/1BR3K1/w Bb2xPf6 (Nimzo) #page 192_2 r4rk1/ppp2ppp/2p2q2/4p2b/1b2P3/2NP1N1P/PPP2PP1/R2Q1RK1/w Pg2g4 (Nimzo) #page 197_2. 2r4r/np1kbppp/1q2p3/pN1pPn2/P2P4/1P3NP1/1B3P1P/R2Q1K1R/w Qd1d3 (Nimzo) NxNa7 is a big mistake. #page 203_1 8/8/5R2/1k2pp2/3r1P2/2BK4/p7/8/w Kd3c2 (Nimzo) #page 208_2 r2qk2r/pbpnbppp/1p1p1n2/3Pp3/1PP1P3/P1NB1N2/2Q2PPP/R1B2RK1/w Ph2h3 (Nimzo) #page 209 2rq1rk1/pb1nbpnp/1ppp2pQ/3Pp3/1PP1P1P1/P2B1NN1/1B3P1P/2R2RK1/b Pa7a6 (Nimzo) #page 210 5rnk/2q1b1np/BpPp2p1/1P2p1P1/4P3/P3QNN1/1B3P2/6K1/b Ph7h6 (Nimzo) #page 211_1. 4brk1/1pq1b1pp/2p1pn2/2PpNpB1/1P1P2PP/2Q1P3/4BP2/4K2R/w Bg5f4 (Nimzo) #page 214_1. 1rqn2k1/Rp3b1p/1Pp3p1/N1PpPpPP/5P2/2QBP3/3K4/8/w Pe5e6 (Nimzo) #page 214_3. r2qkb1r/1p1b3p/p3pppQ/2p5/2P5/4P3/PB1P1PPP/RN3RK1/w Qh6h3 (Nimzo) #page 215_2. 1r1q1rk1/ppp2ppp/2n1pn2/8/1bNP4/1QN1P3/PP3PPP/R1B2RK1/b Nf6d5 (Nimzo) #page 218_2. rn3rk1/pp2bpp1/2b1p1qp/2p5/2P1N3/2P3P1/PP2QPBP/R1B2RK1/w Pf2f4 (Nimzo) #page 223_1. rn1qk1nr/ppp3pp/3bbp2/4p3/4P3/2N2N2/PPPP2PP/R1BQKB1R/w Pd2d3 (Nimzo) #page 225. 1r2rb1k/3q2pp/2n1bp2/2p1pN2/1pP1P1P1/3PB3/1P1RQN1P/5RK1/b Pg7g6 (Nimzo) #page 226. r1b2r1k/1pq3pp/p1nb4/5p2/2Bp1P2/3P1QN1/PP1BR1PP/5RK1/w Ng3h1 (Nimzo) #page 228. r1b2rk1/p2qnppp/1p1p1n2/2p5/2PPpP2/1NP1P2P/P3B1P1/R1B1QRK1/b Ph7h5 (Nimzo) planning Qf5, Qh7 #page 232. 6k1/ppp3r1/5rp1/1b1p1p1p/2nP1P1P/2P2NR1/q1P1Q1PK/4R1B1/b Nc4d6 (Nimzo) #page 249_2 r3k2r/pp1nnppp/1q2p1b1/4P3/5PB1/8/PP4PP/R1BQNR1K/w Qd1e2 (Nimzo) #page 251_1 r1bqk2r/pp2nppp/2n1p3/2bpP3/8/3B1N2/PPP2PPP/RNBQK2R/w Bc1f4 (Nimzo) #page 258_1 8/8/8/1p5r/p1p1k1pN/P2pBpP1/1P1K1P2/8/b Pb5b4 (Nimzo) # lund-nimzowitsch begin examples from (Reinfeld) 8/2k3p1/1p2pb1p/p2p3P/P4P2/2PK1P2/8/1R6/w Pc3c4 (Reinfeld) (175, page 108. increases rook mobility) 6k1/7p/b1p5/5pP1/PBp2P2/7P/8/4K3/w Ph3h4 (Reinfeld) (184, page 125, threatens to make passer, keeping black busy) 2r2rk1/p1qn1ppp/1p2pn2/8/3P1P2/2PQ4/P3N1PP/R1B2RK1/b Qc7c4 (Reinfeld) (195 page 148. Fixing white's weakness.) r1b2rk1/4q1pp/4p3/pp1p4/3P4/3QP1B1/P4PPP/R4RK1/w Rf1c1 (Reinfeld) (196 page 148, seizing open file and later getting R on 7th) 3r4/1p2bp1k/1P1q2pp/1RpPp2n/4P3/4QN1P/2B2PP1/6K1/w Qe3c3 (Reinfeld) (197 page 152. Forces black to weaken his 2nd rank) 4nr1k/1p1br2p/p1p1pNpN/2PpP1P1/PP1P4/7R/7P/5RK1/w Rh3f3 (Reinfeld) (198 page 152. Forces a protected passer.) rnbq1rk1/pp3ppp/2p1pn2/8/PbpP4/2N2NP1/1P2PPBP/R1BQ1RK1/b Pc6c5 (Reinfeld) (283 page 247. Doesnt keep the pawn, but keeps pressure) r2q1rk1/1ppbbppp/p1np1n2/4p3/3PP3/2P2N2/PPB1QPPP/RNB2RK1/b Pe5xPd4 (Reinfeld) (279 page 243. xchging to free his cramped game.) rnbq1rk1/pp3pbp/3ppnp1/2pP4/2P1P3/2N2N2/PP2BPPP/R1BQ1RK1/b Pe6e5 (Reinfeld) (289 page 254. Keeps lines closed and barricades.) rn1q1rk1/pp3pnp/3p2p1/2pP2N1/2P5/2P5/P3QPPP/R1B1R1K1/w Ng5e4 (Reinfeld) (290 page 255, accomplishes several positional purposes) begin examples from (Berliner-Kopec-Northam) rnbqk2r/pp2ppbp/5np1/8/2BP4/2N2N2/PP3PPP/R1BQK2R/w Qd1a4+ (Berliner-Kopec-Northam) r1b2rk1/4bppp/pqp1pn2/2pp4/3PP3/1P3N2/PBPN1PPP/R2QR1K1/w Bb2a3 (Berliner-Kopec-Northam) r2qkb1r/pp1bpppp/2np1n2/8/2BNP3/2N1B3/PPP2PPP/R2QK2R/b Nf6g4 (Berliner-Kopec-Northam) rnbqkb1r/1p2pppp/p7/3P4/3Nn3/8/PP3PPP/RNBQKB1R/w Qd1a4+ (Berliner-Kopec-Northam) r1bqkb1r/p1p2ppp/2n2n2/1p1Pp1N1/2B5/8/PPPP1PPP/RNBQK2R/w Bc4f1 (Berliner-Kopec-Northam) rn2kb1r/1pqbpp1p/p5p1/2nP4/8/4QN2/PP3PPP/RNB1KB1R/w Qe3c3 (Berliner-Kopec-Northam) r1bqk2r/ppp1npbp/3p1np1/3Pp3/2P1P1PP/2N1B3/PP3P2/R2QKBNR/w Pf2f3 (Berliner-Kopec-Northam) 2r2rk1/pp1b1ppp/1n2pn2/BP6/4P3/P3NP2/3K2PP/R4B1R/w Pa3a4 (Berliner-Kopec-Northam) r1bqk2r/pppp1ppp/2n2n2/2b1p3/2P1P3/2N2N2/PP1P1PPP/R1BQKB1R/w Nf3xPe5 (Berliner-Kopec-Northam) r2qr1k1/pppb1ppp/2np1n2/2b1p3/2P5/P1NPP1P1/1P2NPBP/R1BQ1RK1/b Pa7a5 (Berliner-Kopec-Northam) begin examples from (palay) 8/7p/5k2/5p2/p1p2P2/Pr1pPK2/1P1R3P/8/b Rb3xPb2 (palay) (page 58) 8/p7/1ppk1n2/5ppp/P1PP4/2P1K1P1/5N1P/8/b Nf6g4+ (palay) (page 123) 8/3b3k/2p5/2Pp2p1/3P4/6P1/8/2K3N1/w Ng1f3 (palay) (page 127) 1r1r2k1/1bqnbppp/ppp1p3/8/PPNP4/2N1PBP1/2Q2P1P/1RR3K1/b Be7xPb4 (palay) (page 128) begin examples from (Bratko-Kopec) 1k1r4/pp1b1R2/3q2pp/4p3/2B5/4Q3/PPP2B2/2K5/b Qd6d1+ (Bratko-Kopec) bk001 3r1k2/4npp1/1ppr3p/p6P/P2PPPP1/1NR5/5K2/2R5/w Pd4d5 (Bratko-Kopec) bk002 2q1rr1k/3bbnnp/p2p1pp1/2pPp3/PpP1P1P1/1P2BNNP/2BQ1PRK/7R/b Pf6f5 (Bratko-Kopec) bk003 rnbqkb1r/p3pppp/1p6/2ppP3/3N4/2P5/PPP1QPPP/R1B1KB1R/w Pe5e6 (Bratko-Kopec) bk004 r1b2rk1/2q1b1pp/p2ppn2/1p6/3QP3/1BN1B3/PPP3PP/R4RK1/w Nc3d5 (Bratko-Kopec) bk005 2r3k1/pppR1pp1/4p3/4P1P1/5P2/1P4K1/P1P5/8/w Pg5g6 (Bratko-Kopec) bk006 1nk1r1r1/pp2n1pp/4p3/q2pPp1N/b1pP1P2/B1P2R2/2P1B1PP/R2Q2K1/w Nh5f6 (Bratko-Kopec) bk007 4b3/p3kp2/6p1/3pP2p/2pP1P2/4K1P1/P3N2P/8/w Pf4f5 (Bratko-Kopec) bk008 2kr1bnr/pbpq4/2n1pp2/3p3p/3P1P1B/2N2N1Q/PPP3PP/2KR1B1R/w Pf4f5 (Bratko-Kopec) bk009 3rr1k1/pp3pp1/1qn2np1/8/3p4/PP1R1P2/2P1NQPP/R1B3K1/b Nc6e5 (Bratko-Kopec) bk010 2r1nrk1/p2q1ppp/bp1p4/n1pPp3/P1P1P3/2PBB1N1/4QPPP/R4RK1/w Pf2f4 (Bratko-Kopec) bk011 r3r1k1/ppqb1ppp/8/4p1NQ/8/2P5/PP3PPP/R3R1K1/b Bd7f5 (Bratko-Kopec) bk012 r2q1rk1/4bppp/p2p4/2pP4/3pP3/3Q4/PP1B1PPP/R3R1K1/w Pb2b4 (Bratko-Kopec) bk013 rnb2r1k/pp2p2p/2pp2p1/q2P1p2/8/1Pb2NP1/PB2PPBP/R2Q1RK1/w Qd1d2 (Bratko-Kopec) bk014 2r3k1/1p2q1pp/2b1pr2/p1pp4/6Q1/1P1PP1R1/P1PN2PP/5RK1/w Qg4xPg7+ (Bratko-Kopec) bk015 r1bqkb1r/4npp1/p1p4p/1p1pP1B1/8/1B6/PPPN1PPP/R2Q1RK1/w Nd2e4 (Bratko-Kopec) bk016 r2q1rk1/1ppnbppp/p2p1nb1/3Pp3/2P1P1P1/2N2N1P/PPB1QP2/R1B2RK1/b Ph7h5 (Bratko-Kopec) bk017 r1bq1rk1/pp2ppbp/2np2p1/2n5/P3PP2/N1P2N2/1PB3PP/R1B1QRK1/b Nc5b3 (Bratko-Kopec) bk018 3rr3/2pq2pk/p2p1pnp/8/2QBPP2/1P6/P5PP/4RRK1/b Re8xPe4 (Bratko-Kopec) bk019 r4k2/pb2bp1r/1p1qp2p/3pNp2/3P1P2/2N3P1/PPP1Q2P/2KRR3/w Pg3g4 (Bratko-Kopec) bk020 3rn2k/ppb2rpp/2ppqp2/5N2/2P1P3/1P5Q/PB3PPP/3RR1K1/w Nf5h6 (Bratko-Kopec) bk021 2r2rk1/1bqnbpp1/1p1ppn1p/pP6/N1P1P3/P2B1N1P/1B2QPP1/R2R2K1/b Bb7xPe4 (Bratko-Kopec) bk022 r1bqk2r/pp2bppp/2p5/3pP3/P2Q1P2/2N1B3/1PP3PP/R4RK1/b Pf7f6 (Bratko-Kopec) bk023 r2qnrnk/p2b2b1/1p1p2pp/2pPpp2/1PP1P3/PRNBB3/3QNPPP/5RK1/w Pf2f4 (Bratko-Kopec) bk024 begin examples from (Levy) r5k1/pppq3p/3bpr2/3p1pN1/8/2P1P1P1/PP3PP1/R2Q1RK1/w Ra1c1 (Levy) (p34. Lawson used this to nearly beat DeepThought. The game continued ...Rg6, 2. Nf3 b5? [correct was 2. ...c6]) r1bqkbnr/pp1p1ppp/2n1p3/8/3NP3/8/PPP2PPP/RNBQKB1R/w Nd4xNc6? (Levy) (is wrong, almost any other move is sensible) 8/8/2pp3k/8/1P1P3K/8/8/8/w Pd4d5 (Levy) levy1 8/ppp5/8/PPP3kp/8/6KP/8/8/w Pb5b6 (Levy) Peasent 8 plys Cray Blitz 14 plys levy2 8/p7/1p1k1p2/1P2pp1p/1P1P3P/4KPP1/8/8/w Pg3g4 (Levy) at 13 plys +500 levy3 8/pp5p/8/PP2k3/2P2pp1/3K4/6PP/8/w Pc4c5 (Levy) cray 11 plys levy4 6k1/7p/5P1K/8/8/8/7P/8/w Kh6h5 (Levy) mate in 19 levy5 8/8/3pkp2/8/8/3PK3/5P2/8/w Ke3e4 (Levy) cray at 21 plys levy6 8/8/2ppk3/8/2PPK3/2P5/8/8/w Pd4d5+ (Levy) Cray Blitz at 19 plys levy7 8/2p5/3k4/1p1p1K2/8/1P1P4/2P5/8/w Pb3b4 (Levy) Cray Blitz at 18 plys levy8 8/k7/3p4/p2P1p2/P2P1P2/8/8/K7/w Ka1b1 (Levy) Cray Blitz at 18 plys sees the win levy9 8/8/p6p/1p3kp1/1P6/P4PKP/5P2/8/w Pf3f4 (Levy) Cray Blitz at 17 plys levy10 8/2k5/p1P5/P1K5/8/8/8/8/w Kc5d5 (Levy) easy levy11 8/5p2/8/4K1P1/5Pk1/8/8/8/w Ke5e4 (Levy) Cray Blitz at 23 plys levy12 8/7p/2k1Pp2/pp1p2p1/3P2P1/4P3/P3K2P/8/w Pe3e4 (Levy) Cray Blitz at 13 plys sees it wins a pawn levy13 8/6p1/3k1p2/2p2Pp1/2P1p1P1/1P4P1/4K3/8/w Ke2f2 (Levy) Cray Blitz at 18 plys sees it wins a pawn levy14 4k3/4Pp2/5P2/4K3/8/8/8/8/w Ke5f4 (Levy) Cray Blitz at 17 plys, PEASENT sees it at 11 plys levy15 8/1k3ppp/8/3K4/7P/5PP1/8/8/w Kd5d6 (Levy) Cray Blitz at 15 plys levy16 begin examples from (LevyKeene) r1b2rk1/ppp1qppp/2n2n2/1B1p4/3P4/PQP1P3/5PPP/R1B1K1NR/w Bb5xNc6? (LevyKeene) (Similarly BxNc6 here is positionally totally wrong; [From Stahlberg-Petrov, Lodz 1938] almost any other move is sensible, Ne2 is probably best) 2rqr1k1/pb2bp1p/1p2p1p1/n7/B2P4/P1PQ1NP1/3B1P1P/R3R1K1/b Qd8d5 (LevyKeene) (p.17. Browne beat DeepTHought with this xchg sac) 4n3/1b2q3/p2p4/1p1P2pk/3QP2p/2N1B2P/P5P1/6K1/w Qd4h8+ (LevyKeene) (Mephisto played a4?) rnbqk1nr/ppppppbp/6p1/8/8/2NP4/PPP2PPP/R1BQKBNR/b Bg7xNc3+? (LevyKeene) (is wrong; d5 or d6 or Nf6 or most anything else is sensible) begin examples from (stuart) 8/8/6p1/7p/7P/8/pk1K4/2R5/w Rc1a1 (stuart) # Solution : 1)Ra1! Ka1 2)Kc2! g5 3)hxg5 h4 4)g6 h3 5)g7 h2 6)g8=Q h1=Q 7)Qg7 mate. r5k1/1p3p1p/2ppr1p1/p1b1p1q1/2P1P3/3Q1P2/PPP1N1PP/1R3R1K/w Pc2c3 (stuart) (wrong choices: Ng3? QxN!; and f4? exf4) begin examples from (others) 6k1/6P1/1r6/pp5P/2p5/1B5R/7K/8/w Ph5h6 (others) (Benko's Bafflers, chess life August 1992.) 8/ppp1P1k1/1P6/1b6/1Pr5/1p1p4/P2P4/1K6/w Pb6xPa7 (others) (..bxa2+, 2.Ka1! Rc1+ 3. Kxa2 Rc6 3. e8=N+! Kf7 5. Nxc7 Rc2+ 6. Kb1 and wins. Benko's Bafflers, chess life August 1992.) q2k1bnr/pp1b1ppp/3p4/8/2Q1P3/6P1/PPP2PB1/R3K2R/w Pe4e5 (others) (Benjamin-Zapata St Martin 1992 rd 5 mv 15) 8/pk1r1p2/1pqPr1p1/3Rp3/2P5/8/P2Q1PPP/5RK1/w Pc4c5 (others) (Anand-Seirawan Haninge May 1992) gnuchess-4.0.pl70/test/CHESSTEST/reinfeld.fin100644 21542 13 222526 5527662451 17672 0ustar cracraftuser# Fred Reinfeld: 1001 winning chess sacrifices and combinations, # Melvin Powers Wilshire book company (third printing copyright 1955) # ISBN = 0-87980-111-5 #position 289 had an ambiguous answer. #position 112 has 2 moves that both work. #position 727 really has 2 black Qs #position 839 really has 4 queens # 3r2k1/1p5p/6p1/p2q1p2/P1Q5/1P5P/1P6/5RK1/w Rf1d1! Reinfeld.1.1001 r1bq4/1p4kp/3p1n2/5pB1/p1pQ4/8/1P4PP/4RRK1/w Re1e8! Reinfeld.2.1001 r2k4/1pp2rpp/pn1b1p2/3n4/8/P4NB1/1PP3PP/2KRR3/w Pc2c4! Reinfeld.3.1001 r4k1r/pp3ppp/1bppbq2/4n3/3pPB2/1B1P2Q1/PPPN2PP/R4RK1/w Bf4xNe5! Reinfeld.4.1001 5rk1/ppp1qn1p/3pB1pr/3Pp3/2P1Pn2/PPB5/1Q4RP/5RK1/w Rf1xNf4! Reinfeld.5.1001 5r1k/4R3/p1pp4/3p1bQ1/3q1P2/7P/P2B2P1/7K/w Qg5h4+! Reinfeld.6.1001 r1b1rk2/pp3ppQ/1np5/4q3/2B4N/4P3/PP3PP1/2R2K1R/w Qh7g8+! Reinfeld.7.1001 rn3b1r/pQpk2p1/2qnppB1/8/6PP/2N1B3/PPP2P2/2KR3R/w Bg6e4! Reinfeld.8.1001 2rr2k1/1pbb1ppp/4p3/pP1nN3/P7/1B2P3/1B2KPPP/2R4R/w Ne5xBd7 Reinfeld.9.1001 3nrrk1/2nb3p/1p5b/p1p1pp2/4N2N/P1PP2PP/1PB4K/4RRB1/w Ne4d6! Reinfeld.10.1001 1n2kbnr/3q1ppp/2N1p3/2p5/Q1pP4/4P3/5PPP/1NB1KB1R/w Qa4a8! Reinfeld.11.1001 3q2kr/1p3pnp/p5rQ/3N1p2/3P4/6R1/PP3P1P/4R1K1/w Nd5e7+! Reinfeld.12.1001 r5k1/p3qppn/2p1b2p/1p1r4/3N4/1PP4P/1P3BP1/R2QR1K1/w Nd4xPc6 Reinfeld.13.1001 r4rk1/p2nqppp/Qpp5/3p4/3Pn3/2N1PN2/PP3PPP/2R2RK1/w Qa6b7! Reinfeld.14.1001 3q1r1k/2r3np/p1p1P1b1/Pp1p1pN1/1P1Q1P2/3B3R/7P/6RK/w Ng5f7+! Reinfeld.15.1001 r4rk1/pp1b2p1/2p4n/2Qp1p1R/3P4/3BP3/PP2NPq1/1K5R/w Rh5xNh6! Reinfeld.16.1001 rn3R2/pp4p1/2p3k1/8/8/2P1B3/PPP3PP/6K1/w Be3f4 Reinfeld.17.1001 rn3rk1/ppp3pp/4bq2/2b1Np2/2B2P2/8/PPP1Q1PP/R1B1K2R/w Ne5d7! Reinfeld.18.1001 r1r3k1/3R1p1p/p3p1qp/1p6/3R4/P1P3P1/1P3Q1P/6K1/w Rd4g4! Reinfeld.19.1001 8/1p2r1kp/q1pRbpp1/2Pn4/r7/P3P1P1/1Q1N1PBP/1R4K1/w Bg2xNd5! Reinfeld.20.1001 r5k1/pp1R2pp/2p5/4P3/1bP2P1P/1P2pPq1/P1Q1P3/5K1R/w Rd7xPg7+! Reinfeld.21.1001 r3r3/5qpk/ppR2B1p/3p3P/n2P4/P2P2Q1/5PP1/2R3K1/w Bf6xPg7! Reinfeld.22.1001 2n1r2k/ppp3pp/2n3q1/3Q2N1/3P1p2/2P4P/PP3PP1/R4NK1/w Ng5f7+ Reinfeld.23.1001 7k/pbp1r2p/1p3q2/4nP2/1PP1p2p/P3P3/4B1R1/B3Q2K/w Qe1g1! Reinfeld.24.1001 8/1bp4p/p2p4/1p3rbk/4p3/1BP5/PP3PP1/3RR1K1/w Pg2g4+! Reinfeld.25.1001 r4r1k/p6p/1pq2bb1/n2pB3/2pP2Q1/2P3N1/PP4PP/R4RK1/w Rf1xBf6! Reinfeld.26.1001 2b5/1p3r2/p1p2rk1/P1Pp1pp1/3P2P1/4P2P/2B1K3/1R3R2/w Pg4xPf5+ Reinfeld.27.1001 r1q1b1k1/p3bppp/N1p1pn2/1r6/4P3/P3B1P1/4QPBP/R1R3K1/w Na6c7! Reinfeld.28.1001 r1b1kb1r/1p3ppp/p1q1pn2/8/P1B5/8/1PPNQPPP/R1B2RK1/w Bc4b5! Reinfeld.29.1001 2kr1r2/p6p/5Pp1/2p5/1qp2Q1P/7R/PP6/1KR5/w Rh3b3! Reinfeld.30.1001 r2qkbnr/ppp1pppp/8/3Pn3/6b1/2N2N2/PPP2PPP/R1BQKB1R/w Nf3xNe5! Reinfeld.31.1001 8/1bpk2b1/1p2p3/1qn3N1/1p1pPP2/3P3B/1PPKQ2R/r2N4/w Ng5xPe6! Reinfeld.32.1001 r2qk2r/pp1bbp1p/2n1p3/1Bp2p1N/Q7/2P2N2/PP3PPP/2KR3R/w Bb5xNc6! Reinfeld.33.1001 4kb1r/1b3p1p/p1qp1np1/B1n1p3/2N1P3/1PN3PB/2P2P1P/3QR1K1/w Nc4xPe5! Reinfeld.34.1001 r2r1k2/pb2qp2/1n2p2p/1p3pN1/3p3P/1B1P2Q1/PPP3P1/4RRK1/w Ng5xPe6+! Reinfeld.35.1001 Q1b3k1/pq3pp1/1pN1p2p/3n4/1P1PB2P/P7/5PP1/6K1/w Nc6e7+! Reinfeld.36.1001 4rrk1/ppp1qppp/5n2/2b1n1N1/2B3b1/1QN5/PB4PP/4RR1K/w Bc4xPf7+! Reinfeld.37.1001 6r1/p3r2k/2p1q1pp/1pPnNp1b/1P1P1P2/P5RQ/7P/1B4RK/w Ne5xPg6! Reinfeld.38.1001 r1b1k2r/pp2qppp/2pb1n2/3p4/4P3/3B1N2/PPP2PPP/R1BQ1RK1/w Pe4e5! Reinfeld.39.1001 r2q1r2/pb2bpkp/1p2pnp1/nP2Q3/6N1/P2B2N1/1BP2PPP/R4RK1/w Ng4xNf6 Reinfeld.40.1001 r1b2rk1/2q1bppp/p3pn2/1pn3B1/8/P1N1PN2/BPQ2PPP/3RK2R/w Ba2b1! Reinfeld.41.1001 4r2k/p6p/1p2q1p1/2pQnp2/2P2R2/2P5/6PP/4R1K1/w Kg1f1! Reinfeld.42.1001 r2q1k1r/p1pbbp1p/3p1npN/2pN4/4P3/5Q2/PPP2PPP/R1B1K2R/w Pe4e5! Reinfeld.43.1001 3b1k1r/pp4p1/1qn1bpQp/1B2p3/8/2N2N2/PPP2PPP/5RK1/w Nf3xPe5! Reinfeld.44.1001 1nb1rk2/p3q1pp/1n3p2/1p1p1N2/2pP1PQ1/1PP3P1/P5BP/R1B1rRK1/w Bc1a3! Reinfeld.45.1001 8/p6r/k6P/P1P4R/K7/8/8/8/w Pc5c6! Reinfeld.46.1001 r3k1nr/pb2qppp/2n1p3/4N3/Q1pP4/2B1P3/1P3PPP/R3K2R/w Pd4d5! Reinfeld.47.1001 r2q1rk1/1bp2p2/1p1p1npp/3P4/PpP2P1B/3Q4/2B3PP/4RRK1/w Re1e6! Reinfeld.48.1001 3rkb1r/p2nqppp/5n2/1B2p1B1/4P3/1Q6/PPP2PPP/2KR3R/w Rd1xNd7! Reinfeld.49.1001 r1bq1rk1/pp3pb1/2p1pnp1/4NnBp/2BPN3/2P2Q2/PP3PPP/R3K2R/w Pg2g4! Reinfeld.50.1001 r3r1k1/pp1Rbpnp/q1p1p1p1/4P3/1PP2QP1/P3B2P/4BP2/R5K1/w Be3c5! Reinfeld.51.1001 r3kb1r/pp2pppp/1q3n2/3p4/3n4/3BBQ1P/PPP2PP1/RN3RK1/w Qf3f4! Reinfeld.52.1001 3qk2r/1pp1nppp/1p6/r7/8/5Q2/PP3PPP/R1B1R1K1/w Bc1g5! Reinfeld.53.1001 r2q2k1/pp5p/4b1pQ/3Nn3/8/6PP/P5B1/3R2K1/w Qh6e3! Reinfeld.54.1001 1q2kb1r/1r1n1ppp/2Qpp3/8/N7/8/1PP2PPP/R1BR2K1/w Na4c5! Reinfeld.55.1001 r1b2rk1/ppp1qpp1/1bnp3p/5PNQ/2BPP3/4n3/PP4PP/RN3RK1/w Pf5f6! Reinfeld.56.1001 2rq1rk1/pp2bppp/2n2n2/4NRB1/3P4/PB5Q/1P4PP/3R2K1/w Bg5xNf6! Reinfeld.57.1001 4rrk1/p1p4p/1pnb3R/4p1P1/2PP1p2/5N2/PP1B4/2KR4/w Pc4c5! Reinfeld.58.1001 r2qkbnr/pp2pppp/3p4/3Pn3/4P1b1/5N2/PP3PPP/RNBQKB1R/w Nf3xNe5! Reinfeld.59.1001 4rkr1/1p1Rn1pp/p3p2B/4Qp2/8/8/PPq2PPP/3R2K1/w Qe5f6+ Reinfeld.60.1001 mate 6rk/1p4q1/p3p3/3b4/4p3/1P2B2P/P4PP1/2QR2K1/w Be3d4! Reinfeld.61.1001 r1bq1rk1/pp2bp1p/2p2np1/3p2B1/3P4/2NQ2N1/PPP2PPP/4RRK1/w Re1xBe7! Reinfeld.62.1001 2q2b2/5k2/4bP1r/2pB1Q1p/pp6/8/PPP3PP/2K2R2/w Rf1e1! Reinfeld.63.1001 6k1/6b1/1p1r3p/3q2pP/4Q3/8/4BPP1/1R4K1/w Be2c4 Reinfeld.64.1001 3rk2r/1pp1qppp/2n3n1/p3P3/2PN3P/P5P1/1P2PPB1/R2QK2R/w Bg2xNc6+ Reinfeld.65.1001 3r2rk/p4p1p/3p1Pp1/3R4/2p1B2Q/8/1q4PP/4R1K1/w Qh4xPh7+! Reinfeld.66.1001 1r3rn1/p5bk/b2pP2p/q2P1p2/1p2nP1N/3QB2P/PP4B1/3NRRK1/w Qd3xNe4! Reinfeld.67.1001 6r1/R2b2qk/2p1p2p/1pPpPrp1/1P1Qp3/4P3/4N1PP/5RK1/w Rf1xRf5 Reinfeld.68.1001 5rk1/1ppb4/p1pb4/6q1/3P1p1r/2P1R2P/PP1BQ1P1/5RKN/w Re3g3! Reinfeld.69.1001 1r1r4/1b3pk1/5qp1/pP1p3p/2pN3P/3nP1P1/PQR2PB1/3R2K1/w Rd1xNd3! Reinfeld.70.1001 6rk/1b4rp/2q2n2/p1n5/4p2Q/1PN2N2/PBP1R3/K3R3/w Nc3xPe4! Reinfeld.71.1001 1r2bqk1/2p1rpbn/3p3p/1p4n1/3PP2N/1BP1B2P/1P1N1R1K/3Q1R2/w Nh4g6! Reinfeld.72.1001 4r3/1p4pk/2b2pq1/7p/3B1P2/7P/4RQP1/7K/b Qg6xPg2+! Reinfeld.73.1001 r3r1k1/5pp1/p1p4p/2Pp4/8/q1NQP1BP/5PP1/4K2R/b Pd5d4! Reinfeld.74.1001 8/1p3k2/8/p2qp1QP/P1Bpb3/1P3r2/2P5/1K6/b Rf3xPb3+! Reinfeld.75.1001 1rr3k1/p3ppbp/3pbnp1/7P/qP1BP1P1/5P2/1PPQ4/1NKR1B1R/b Bg7h6! Reinfeld.76.1001 5rk1/1bpq1ppp/p7/4P3/3bnP2/4B3/PPP1Q1PP/R4R1K/b Ne4g3+ Reinfeld.77.1001 2rq2k1/1p1npp1p/p2p2p1/3P4/bP2PP2/r2BB2P/P2R1QPK/5R2/b Rc8c3! Reinfeld.78.1001 r1bq1rk1/1p2bppp/p1nppn2/5P2/3NP3/1BN5/PPP3PP/R1BQ1RK1/b Qd8b6! Reinfeld.79.1001 rnbqk2r/pppp1ppp/5n2/2bPp1B1/2P5/8/PP2PPPP/RN1QKBNR/b Nf6e4! Reinfeld.80.1001 r4rk1/pb3ppp/1p3q2/1Nb5/2p1BP2/P5P1/1PQ4P/R1B2R1K/b Qf6f5! Reinfeld.81.1001 4r1k1/3br1bp/p2p3q/P1pP1p2/2P1nP2/3Q3P/4N1B1/2B1RRK1/b Ne4c3 Reinfeld.82.1001 r1b1r1k1/ppp2ppp/2n2n2/8/1bq5/1PN2NP1/P1QBPPBP/R3K2R/b Re8xPe2+! Reinfeld.83.1001 2r3k1/2rb1pp1/5n1p/q1BPp3/p3Pn2/2R4P/2Q2PPK/1NR2B2/b Nf4xPd5! Reinfeld.84.1001 4r1k1/ppp2pPp/3b1q2/4Nn2/Q1pPrpb1/2P5/PP4PP/R1B2RNK/b Re8xNe5! Reinfeld.85.1001 r1b2rk1/pp2q1bp/5np1/4p3/4P1P1/2N1BB2/PPP4P/R2QK2R/b Nf6xPg4! Reinfeld.86.1001 4rrk1/ppp2qpp/3b4/3p4/6b1/2P1B3/PP1Q1PPP/R3KN1R/b Pd5d4! Reinfeld.87.1001 5rk1/p1p1p1bp/2Q1p1p1/8/4r2P/3qN3/PP1PNPP1/R1B2K2/b Re4xNe3! Reinfeld.88.1001 r4rk1/4q1pp/3p4/p1p1n3/4Q3/1P4P1/PNP4P/3RR1K1/b Ne5f3+! Reinfeld.89.1001 6k1/6p1/p7/3Pn3/5p2/4rBqP/P4RP1/5QK1/b Re3e1! Reinfeld.90.1001 2q3k1/pbR1bppp/4r3/1Q2p3/8/4P1P1/P4PPK/1BBR4/b Re6h6+! Reinfeld.91.1001 7k/pp2q3/2p2n2/4pr1p/1P1B2pQ/P2R2P1/5r1P/4R1K1/b Pe5xBd4! Reinfeld.92.1001 4r3/1p4pk/2b2pqp/8/8/P6P/3BRQP1/6K1/b Bc6xPg2! Reinfeld.93.1001 6k1/b4pp1/q1pp1nr1/1p5p/1P1BP2P/3P1P2/4N1PQ/5RK1/b Ba7xBd4+ Reinfeld.94.1001 3r3k/pp3rp1/1bp4p/4Q3/4PqP1/2PP1N2/P4PP1/R3R1K1/b Bb6xPf2+! Reinfeld.95.1001 2k5/ppp2pp1/1b5p/1P6/R2PP3/7P/1P3RP1/2rr1NK1/b Rd1xPd4! Reinfeld.96.1001 6k1/p4p2/1p2p1p1/4P3/PP2bP2/2B1b2p/6PP/6RK/b Kg8h7! Reinfeld.97.1001 6k1/6p1/p4Q1p/1p1P1b2/8/1P4RP/PBr3PK/4q3/b Qe1xRg3+! Reinfeld.98.1001 1r4k1/p3bppp/1qp1b3/8/4P3/P1NP4/1P1Q1PPP/2KR3R/b Be7g5! Reinfeld.99.1001 2rr2k1/5pp1/p1q2n1p/4pP2/2p1P1P1/2P5/2PNQ2P/R5RK/b Rd8xNd2! Reinfeld.100.1001 3r2k1/p3q2p/4n1p1/3BR3/3p2P1/8/P2Q3P/7K/b Rd8xBd5! Reinfeld.101.1001 k4rr1/pp5p/2b5/2P2p1Q/2pp1B2/2P2R1B/2P1q2P/5R1K/b Rg8g4 Reinfeld.102.1001 r2qk2r/pp3ppp/4p3/5b2/1Pp1n3/1P1pPQ2/5PPP/RN1K1B1R/b Bf5g4! Reinfeld.103.1001 8/pp4pk/6qp/1P1p4/r2N2r1/1RP1R3/P1Q4K/8/b Ra4xPa2! Reinfeld.104.1001 r5k1/pp1b1rp1/2p2n2/3p2qp/3P4/1P1QPPN1/P3R1BP/R5K1/b Ph5h4! Reinfeld.105.1001 2r3k1/1p3pp1/4p2p/3nP3/8/2PQ4/qP4PP/rNKRR3/b Nd5xPc3! Reinfeld.106.1001 r5k1/pp4p1/6r1/3p4/2nPNpPq/2P4P/P3Q2K/1R4R1/b Rg6e6 Reinfeld.107.1001 7r/2pR1bkp/1r6/p1N2qp1/P1QP4/2P5/5PPP/4R1K1/b Qf5xRd7! Reinfeld.108.1001 r4rk1/1q2bppp/p1n5/1p1NP3/8/2Q5/PP3PPP/R1BR2K1/w Qc3xNc6! Reinfeld.109.1001 r2qk2r/1b1nbppp/p3p3/1p1nP1B1/3pN3/3B1N2/PP3PPP/R2Q1RK1/w Ne4d6+ Reinfeld.110.1001 2r1kb2/pNn2n1p/2p4B/3p1p1B/P7/1P2P3/4KP1P/6R1/w Bh6xBf8 Reinfeld.111.1001 2kr1b1r/pp1b1ppp/n1n1p3/1N6/4N3/P5P1/1P1BPP1P/R3KB1R/w Nb5d6+,Ne4d6+ Reinfeld.112.1001 Ne4d6+ also works (can use either N) 3r1r1k/pp2N1qp/3p2p1/2n1b3/8/4BR1Q/PPP4P/5R1K/w Rf3xRf8+ Reinfeld.113.1001 2rrk3/6p1/p4pp1/P1bN4/3R4/4P2P/5KP1/3R4/w Nd5c7+! Reinfeld.114.1001 1k3r1r/pp2Rppp/2pp1q2/5Pp1/2QP4/2N5/PP4PP/6K1/w Nc3d5! Reinfeld.115.1001 4b3/5Nk1/7p/3p3P/3r4/4R3/5PPK/8/w Nf7d6 Reinfeld.116.1001 6k1/2p2pp1/1p3n2/6rp/3P3q/P3PQ1P/6PN/5R1K/w Qf3a8+! Reinfeld.117.1001 3rrb1k/pq5p/Q5p1/2pbN3/4NP2/8/PP4PP/3R1R1K/w Qa6xQb7 Reinfeld.118.1001 r3rk2/5ppQ/np1bbq1p/p1ppN3/3P4/P1N1P3/1P3PPP/1BR2RK1/w Nc3xPd5! Reinfeld.119.1001 r1b2rk1/pp4p1/2p4n/2Qp1pq1/3P1N1n/3BP1N1/PP3PP1/1K1R3R/w Rh1xNh4! Reinfeld.120.1001 5rr1/pp1b1P1p/5Q2/3p3k/5K2/8/2P3P1/8/w Pf7xRg8=N! Reinfeld.121.1001 1rb2rk1/p2n4/1p2pqp1/2p3Np/3P1P2/P2B2P1/1P3P2/2RQK2R/w Ng5h7! Reinfeld.122.1001 7r/1bk2q2/2p2p2/p1Q1pP1p/4P2P/2N3r1/PPPR4/2K5/w Nc3b5+ Reinfeld.123.1001 2k4r/1bpq2b1/p1np2p1/1p1N4/4QP1p/1B5P/PPP2BP1/2KR4/w Nd5b6+ Reinfeld.124.1001 5r2/2q2b2/2p5/1pPp1pk1/1P1P1NnR/3BPK2/3Q2P1/8/w Rh4h5+! Reinfeld.125.1001 8/p1r3n1/R1p2k2/4p3/8/1P2NPP1/P6P/6K1/w Ne3d5+ Reinfeld.126.1001 4nk2/1p3rb1/2qp2Rp/3Np3/p1r1Pp1P/3N1P2/PP2Q3/1K4R1/w Nd3xPe5! Reinfeld.127.1001 4r3/1qrnpk2/p1Np1pp1/1p6/1P2Q3/2P4P/P5PK/3RR3/w Nc6d8+! Reinfeld.128.1001 r1bn1k1r/4bppp/pq6/1ppBNQ2/5B2/8/PP3PPP/R2R2K1/w Qf5xBc8! Reinfeld.129.1001 1r3rk1/p1pb1pp1/2pp3p/q1n2N2/3NP3/1P2Q3/P1P2PPP/3RR1K1/w Nd4xPc6! Reinfeld.130.1001 2kr3r/ppp2pp1/2np2qp/2bNp3/2B1P1b1/2PP1N2/PP2QPPP/R3K2R/w Pb2b4! Reinfeld.131.1001 7k/6pp/2p5/4Nr2/pp2pPQb/4q2P/1P1R2K1/8/w Ne5f7+! Reinfeld.132.1001 r4b1r/pp1k1ppp/5p2/3N4/3pq3/8/PPP2QPP/2KR3R/w Nd5xPf6+! Reinfeld.133.1001 2k5/r2n3p/1Rp1qpp1/2pN4/4P3/1P1P3P/2P2QP1/6K1/w Rb6xPc6+! Reinfeld.134.1001 5rk1/pb1qrpb1/1pn3pn/2p1p1Np/2B1NP1P/PP2P1P1/1BQP1K2/1R2R3/w Ne4f6+! Reinfeld.135.1001 4rbk1/pppqrppp/1n1p4/3P4/2PBN3/3Q3P/PP3PP1/R4RK1/w Ne4f6+! Reinfeld.136.1001 1r6/RN1nbkpp/5p2/3p4/3N4/4P3/1P2KPPP/8/w Nb7d6+! Reinfeld.137.1001 R4n2/pp2qpp1/2p3pk/6N1/7P/2P2P2/P5P1/3R2K1/w Ra8xNf8! Reinfeld.138.1001 5r2/6p1/PNk5/2N1p2p/1PP5/6P1/6K1/8/w Pb4b5+! Reinfeld.139.1001 2brk1r1/p3bp1q/2p4p/1p2PP2/2p1N3/5Q1B/PP6/2KR3R/w Ne4f6+ Reinfeld.140.1001 1k3rr1/1pp2p2/p6p/b3q2P/3pN2R/PB1P1Q2/1PP1RP1n/1K6/w Qf3f6! Reinfeld.141.1001 3qnk2/pp3pb1/6p1/8/3pN3/1P5Q/1Pr3PP/4RRK1/w Rf1xPf7+! Reinfeld.142.1001 r2qn2k/pp3p1p/3p1nr1/2pP2N1/2P5/P1P4P/2Q5/R1B2RK1/w Qc2xRg6! Reinfeld.143.1001 r1bnkbnr/pp1q1p1p/2pp4/3N4/2BPP3/6Q1/PPP3PP/R1B2RK1/w Qg3xNg8! Reinfeld.144.1001 rrq1k3/2p2p2/3pb1p1/3N2Pp/p1PpPR2/P2P3P/1P6/K2Q1R2/w Rf4xPf7! Reinfeld.145.1001 2r2k2/1pr3q1/p2pQ3/3PpPN1/8/1P2P3/1P6/6RK/w Qe6xRc8+! Reinfeld.146.1001 r1bq1n1r/pp4k1/2p3pp/5p2/2BP1N2/6Q1/PP3PPP/R3R1K1/w Re1e8! Reinfeld.147.1001 2r2rk1/pb1nq1pp/1p2p3/2ppN2P/2PPpPP1/4P3/PPQ5/2KR1B1R/w Ne5g6! Reinfeld.148.1001 1r2r1k1/2q2p1p/b2p1npB/2pP4/3bNP2/1P4PB/3Q3P/1R2R1K1/w Qd2xBd4! Reinfeld.149.1001 4rn2/pp4k1/5qp1/4pp1P/P1Pb3N/6Q1/1B3PP1/3R2K1/w Rd1xBd4! Reinfeld.150.1001 8/1b2k2p/p3npp1/1pp1p3/4P2P/2P2KP1/PPBNnP2/5N2/b Ne2d4+! Reinfeld.151.1001 5rk1/4q1pp/3p4/R2Ppr2/1p2Qn2/5BP1/1P1R1P1P/6K1/b Nf4h3+ Reinfeld.152.1001 N1b2r1k/pp4bp/6p1/3Q3n/3P4/2N1P1qP/PP2KnP1/R1B2R2/b Nh5f4+! Reinfeld.153.1001 r2rb1k1/pp3pp1/4p1p1/1P2B3/2PnR2q/2Q3NP/P4PP1/R5K1/b Qh4xRe4! Reinfeld.154.1001 r3r1k1/1p1q1pp1/p2p1b1p/2pP2n1/3nPP2/6QP/PP4P1/RBB1RNK1/b Ng5f3+! Reinfeld.155.1001 2k1r3/p1q3pp/2R2p2/3pP3/1b1N1n2/6Q1/PP3PPP/6K1/b Qc7xRc6! Reinfeld.156.1001 8/p2r2pk/2q2p1p/2P1p1n1/4P3/6P1/PBQ4P/1R4K1/b Rd7d2! Reinfeld.157.1001 r1b1r1k1/ppp2ppp/3B4/8/2P1N1P1/P1np3P/1P3P2/R3KB1R/b Pd3d2+ Reinfeld.158.1001 2r2rk1/1pq1pp1p/6p1/1n1N4/p2RP3/2P5/P4PPP/2Q2RK1/b Nb5xRd4! Reinfeld.159.1001 6k1/1p3p1p/2n1p1p1/p4n2/2B1pP2/7P/P1N1K1P1/8/b Pb7b5! Reinfeld.160.1001 8/3n2kp/p3p1p1/4P1P1/4Nr2/PK6/2B5/8/b Rf4xNe4! Reinfeld.161.1001 2r3k1/1p3pBp/8/qN1p4/3Qn3/P3PB2/2rnRPPb/R2K4/b Rc2c1+! Reinfeld.162.1001 r4rk1/4ppbp/1pPq2p1/p3n3/3BP3/2N3P1/PP3P1P/R2Q1RK1/b Qd6xBd4! Reinfeld.163.1001 r4rk1/pb3ppp/4p3/qBn5/1p2P3/5P2/PP2Q1PP/R1B2RK1/b Nc5b3! Reinfeld.164.1001 8/8/8/1p3B1p/p6k/P3p2P/1P1n4/4K3/b Nd2f3+ Reinfeld.165.1001 r7/pp1n1k2/2pbpp2/3n4/P1BP4/5NNr/1P3PK1/R2R4/b Rh3xNg3+! Reinfeld.166.1001 2r2r2/p6k/1p4pb/2p1pp2/3n2p1/P1BPN1P1/1P2PPKP/3RR3/b Bh6xNe3 Reinfeld.167.1001 r1r3k1/1R3ppp/p3pb2/8/2P1nB2/5N2/P4PPP/2R3K1/b Ne4c5 Reinfeld.168.1001 2r2rk1/pp1b2pp/4pb2/q1np4/7P/P1NB1N2/1PPQ1PP1/2K1R2R/b Pd5d4! Reinfeld.169.1001 1r4k1/p1p2ppp/2p5/Pn1p4/1BbP4/2P1PP2/1r2NKPP/1R2R3/b Rb2xRb1 Reinfeld.170.1001 5r2/2p4p/1p1p1k1r/p2Pn1p1/P1P1PpP1/1P3P2/3R2KP/2RN4/b Rh6xPh2+! Reinfeld.171.1001 2rr2k1/1b3p1p/pq2pp1Q/1p2n3/1P2P2N/P2nN1P1/3p1PBP/R4RK1/b Nd3xPf2! Reinfeld.172.1001 rn2k2r/pp6/4pQp1/qb1pP2p/3P4/P1n1BP2/2P2KPP/R5NR/b Nc3e4+! Reinfeld.173.1001 4r1k1/p2b1p2/1p1q1n1p/3p2p1/P1pP2P1/2P1rPNP/3Q1K2/R3RB2/b Qd6xNg3+! Reinfeld.174.1001 r1b2rk1/pp3ppp/2p2q2/2Ppn3/B2Qn3/4B3/PPP2PPP/RN2R1K1/b Bc8h3! Reinfeld.175.1001 r3kb1r/ppp3pp/2n5/4PQ2/3P4/2p5/P1P1N1qP/R1B1KR2/b Qg2xNe2+! Reinfeld.176.1001 8/6pk/7p/2r2p2/5Pqn/1P6/P2Q2PP/2B2RK1/b Rc5xBc1! Reinfeld.177.1001 r1r3k1/1b3ppp/1p2p3/8/2NQPn2/1q3B2/1P3PPP/2R2RK1/b Qb3xBf3! Reinfeld.178.1001 r5k1/pp1B2b1/8/3p3p/3Pq3/BP1n1R2/P6P/3Q1N1K/b Nd3f2+ Reinfeld.179.1001 8/1Q2ppk1/6p1/2qN4/p1r3n1/6P1/P5KP/5R2/b Qc5xNd5+! Reinfeld.180.1001 2r2rk1/n2b1p2/p2Pp2p/3n2p1/1P6/8/P4PPP/B2QR1K1/w Qd1d4 Reinfeld.181.1001 3r2k1/5ppp/bn6/ppp2N2/3Pq3/P1P5/1B1Q2PP/2R3K1/w Qd2g5! Reinfeld.182.1001 r3r1k1/1q1b1ppp/pnn1p3/1p6/1b1NP3/1P1QBN2/P3BPPP/2R2RK1/w Nd4xNc6 Reinfeld.183.1001 rn2k2r/2q2ppp/bn1p4/2p5/4P3/1Q3N2/1P1N1PPP/R3KB1R/w Bf1xBa6 Reinfeld.184.1001 3r1k2/2rP1ppp/5b2/pp6/n7/P1NR1P2/1PK2P1P/4RB2/w Re1e8+! Reinfeld.185.1001 2r2rnk/2q1bppp/p2pp3/1b4P1/4PP1P/2B1n1N1/1P2N1B1/2RQ1R1K/w Qd1d4! Reinfeld.186.1001 r7/pp4k1/2p1b1p1/8/7r/1P1Q4/P5PP/5R1K/w Qd3c3+ Reinfeld.187.1001 r1bq1rk1/ppp2ppp/4p3/8/3b4/3B1N2/PPP1QPPP/R3K2R/w Qe2e4 Reinfeld.188.1001 2b4R/4rkp1/1p1Q3p/p1p2q2/2P1p1p1/1P2P1P1/PB3P1P/6K1/w Qd6d8! Reinfeld.189.1001 r1bnr2k/4q1pp/p2Rp3/1p2Qp2/1P5P/P3P3/1B3PP1/1BR3K1/w Rc1c7! Reinfeld.190.1001 r1b2rk1/ppppbppp/8/2q5/8/2PB1Q2/PPP2PPP/R1B1R1K1/w Qf3e4 Reinfeld.191.1001 2r3k1/4bppp/1q6/1p1Pp3/nP1p4/3B1Q1P/5PP1/R4NK1/w Qf3f5 Reinfeld.192.1001 3r2k1/R4pp1/1p5p/4p3/6b1/1P1n2P1/P4PBP/4N1K1/w Ne1xNd3 Reinfeld.193.1001 r3r1k1/pppn1ppp/2b2n2/q7/4PP2/2NBB2P/PP2Q1P1/1K1R3R/w Pe4e5 Reinfeld.194.1001 r3rbk1/3n1pp1/2N4p/2pP4/qpN2B2/5Q2/1P3PPP/2RR2K1/w Bf4xPh6! Reinfeld.195.1001 4k2r/2pq1p1p/3p1np1/8/2Q1P3/7P/PrP2PP1/RN3RK1/w Qc4c3! Reinfeld.196.1001 r4rk1/ppp2ppp/7q/4P3/1bB3b1/2NQ4/PPP3PP/4RR1K/w Rf1xPf7! Reinfeld.197.1001 r1bbr1k1/p2n1ppp/1p1Bp3/3q3Q/3PNP2/3B4/PP4PP/2R2R1K/w Ne4g5! Reinfeld.198.1001 r2q4/1bp1p1k1/1pn1pbB1/4N1B1/p2p3P/7R/PP2QPP1/1K6/w Bg5h6+! Reinfeld.199.1001 r1q2r1k/p1pp1pbp/6p1/2P5/4P3/4B3/PnBQ1PPP/4RRK1/w Be3d4! Reinfeld.200.1001 r5k1/1p1P1p1p/p1q2bp1/1N3n2/8/1P4PB/P2Q1P2/4R1K1/w Nb5a7! Reinfeld.201.1001 6k1/3nrppp/2B5/p1b2P2/5Q2/1P5P/Pr6/5R1K/w Pf5f6! Reinfeld.202.1001 1n6/2pq1kp1/p2pNpp1/b2r4/2R1Q3/7P/1B3PP1/6K1/w Ne6d8+! Reinfeld.203.1001 r2b1r1k/p4bR1/1p3P2/n2p3p/2pP1Bp1/2Pq2N1/PP2Q1PP/R5K1/w Rg7xBf7! Reinfeld.204.1001 r1bqk2r/2pp1ppp/p4n2/1p2b3/4P3/1B6/PPP2PPP/RNBQ1RK1/w Pf2f4 Reinfeld.205.1001 6k1/p1pr2p1/1p3p1q/4b3/4Q3/3N1P2/PPP3PP/4R2K/w Pf3f4 Reinfeld.206.1001 r7/3p4/2n1k3/4q3/4p3/4N1P1/2R2P2/2Q3K1/w Rc2xNc6+ Reinfeld.207.1001 8/r4pbk/4p2p/8/p5R1/Pq3N1P/1P1Q1PP1/6K1/w Rg4xBg7+ Reinfeld.208.1001 r3rqk1/3n1pbp/b2p2p1/p1pP4/1p2PP1N/6nP/PPQB3N/R3RBK1/w Bf1xBa6 Reinfeld.209.1001 rn2kb1r/p3pppp/b4n2/3qN3/2pP4/4P3/5PPP/RNBQKB1R/w Ra1xBa6 Reinfeld.210.1001 r6k/6p1/7p/4p3/3rb3/1P5P/6PK/2Q1R3/w Re1xBe4 Reinfeld.211.1001 5rk1/p1p2ppp/2r1b3/4P1Nq/3Q2n1/1P3N2/P5PP/R4RK1/w Ph2h3! Reinfeld.212.1001 r1r2nk1/7p/p2p1Q2/3p1R2/1PpP4/P1P4P/4b1P1/6K1/w Rf5g5+! Reinfeld.213.1001 r4rk1/2p1q1pp/p2p1n2/n3p1B1/Pp2P3/5N2/1PP2PPP/R2Q1RK1/w Bg5xNf6 Reinfeld.214.1001 3r2k1/pq1n1p1p/1r5p/8/4bQ2/5NP1/P4PBP/R4RK1/w Nf3g5! Reinfeld.215.1001 8/3qNrpk/1bpnRpNp/pp1p1P2/3P2P1/P1P4P/1P2Q1K1/8/w Ne7xPd5! Reinfeld.216.1001 r1bqkbnr/2pp2pp/p1n5/4p3/N3p3/1B3N2/PPPP1PPP/R1BQK2R/w Nf3xPe5! Reinfeld.217.1001 r5k1/1p3pbp/p1q3p1/3n4/2N5/1PB2P2/P5PP/3RQ2K/w Bc3xBg7 Reinfeld.218.1001 1r4k1/p4p1p/1p1r1n2/4p1B1/8/1P3P1P/P1Q3PK/8/w Qc2c7! Reinfeld.219.1001 r4rk1/2qn2pp/p3b3/1pp1pn2/7N/2P1B3/PPB2PPP/3QR1KR/w Nh4xNf5 Reinfeld.220.1001 r1b4r/p1ppkppp/2n3q1/bp1B4/4P3/1QP2N2/P4PPP/RN3RK1/w Bd5xNc6 Reinfeld.221.1001 r1bqkb1r/ppp2ppp/2np4/4p3/3Pn3/2P2N2/PP2BPPP/RNBQK2R/w Pd4d5 Reinfeld.222.1001 r4nk1/1b3qpp/p4p2/np1p4/2pP1PNQ/2P5/PPBNr1PP/R4RK1/w Ng4h6+! Reinfeld.223.1001 r1q3rk/1ppbb1pp/4Np2/p4P2/P3P3/2N2R2/1PP1Q1PP/3R2K1/w Rf3h3! Reinfeld.224.1001 4rk2/ppp3pp/8/4b1n1/6N1/2N4P/PPP2PP1/3R2K1/w Ng4xBe5 Reinfeld.225.1001 r1bq1rk1/pppn1ppp/5n2/4p3/1bBP4/2N1P3/PP2NPPP/R1BQ1RK1/w Bc4xPf7+! Reinfeld.226.1001 r1bqk2r/pppp1ppp/8/3Pp3/1b1n4/6P1/PP1PPPBP/R1BQK1NR/w Pe2e3 Reinfeld.227.1001 5k2/1r3p2/1P4p1/2P2q2/8/5N1P/3Q2PK/8/w Pc5c6 Reinfeld.228.1001 r4r2/p1p3Qp/4kp2/2pp1N1q/5P2/7P/PPP3P1/5RK1/w Qg7e7+ Reinfeld.229.1001 8/1p2r1k1/1p1rPp2/P1pPnP1p/1PP2Kp1/1B2R3/8/3R4/w Re3xNe5 Reinfeld.230.1001 3rbr2/pp2ppkp/2q1P1p1/5P2/6PP/2N2R2/PPP2Q2/2K2R2/w Pf5f6+ Reinfeld.231.1001 r5k1/3rbpnp/p3q1pB/1pp1P3/3p1PP1/3P2NP/PP2Q3/R1R3K1/w Bh6xNg7 Reinfeld.232.1001 r3r3/pp3k1p/2p1p3/3n1bp1/P1BPq3/4P1Q1/1P1B1PP1/R1R3K1/w Pf2f3 Reinfeld.233.1001 1rq2n2/1pp2kbr/p1n1p1pp/2N1P3/5P2/1Q2B2B/PP3P1P/2RR2K1/w Bh3xPe6+! Reinfeld.234.1001 4r2k/6np/3P2q1/1b4p1/6p1/8/1B1Q1PBP/5RK1/w Pd6d7 Reinfeld.235.1001 2b1rn1k/p4Rbp/1p6/3p2B1/8/P5N1/1q2B1PP/5Q1K/w Rf7xBg7! Reinfeld.236.1001 1rb2nk1/p1q2ppp/1p1Np3/8/4B3/4Q3/PP3PPP/3R2K1/w Nd6e8! Reinfeld.237.1001 r1b2k1r/pp4pp/1b1p1q1n/4n3/8/BBPN4/P4PPP/RN1Q1RK1/w Nd3xNe5 Reinfeld.238.1001 8/pb1q3k/1p1r3p/8/8/1P2Q1N1/P5PP/3R2K1/w Qe3xPh6+! Reinfeld.239.1001 5qk1/pr6/1p1n1rpp/2p1p3/2P3P1/2NRP2Q/PP3P1P/3R2K1/w Pg4g5! Reinfeld.240.1001 1r2r1k1/p4p1p/6pB/q7/8/3Q2P1/PbP2PKP/1R3R2/w Rb1xBb2! Reinfeld.241.1001 1rr3k1/4qppp/pn6/1pp1n2b/4P3/P1PP2QP/2B3PN/R1B2RK1/w Rf1f5 Reinfeld.242.1001 3r4/2q3k1/rp3bpp/2pBp3/2P1Q3/P4RP1/P2R1P1P/6K1/w Bd5f7! Reinfeld.243.1001 4Q3/8/2r3pk/3b4/1PpP2P1/8/7P/6K1/w Qe8h8+ Reinfeld.244.1001 r3k2r/pp2qppp/2p3b1/3pP3/Pb6/2N1P3/1P1BQPPP/R4RK1/w Nc3xPd5! Reinfeld.245.1001 r4b1k/ppp3pp/2n1b2r/2P2p2/3PpP1q/2Q3NP/PP2N1P1/R1B2R1K/w Pd4d5! Reinfeld.246.1001 2r1r1k1/1p1qbp1p/3p1p2/p2P4/3Q4/5N2/PP2RPPP/4R1K1/w Re2xBe7! Reinfeld.247.1001 rn3rk1/pbppq1pp/1p3b2/3Ppp2/2P5/1Q3NP1/PP2PPBP/R1BR2K1/w Nf3h4! Reinfeld.248.1001 3rrnk1/pp3ppp/q1pbp3/8/2P1Q1NP/2B5/PP3PP1/3RR1K1/w Rd1xBd6! Reinfeld.249.1001 r3rnk1/1p3ppp/p7/1q1P4/4b3/P4RN1/1B1Q2PP/R6K/w Qd2d4 Reinfeld.250.1001 r1b2r1k/1q1nbppp/pp2p3/4Q1B1/3N4/2N3R1/PPP2PPP/3R2K1/w Bg5h6 Reinfeld.251.1001 r2r2k1/pq3ppp/1p1bpn2/8/2PN3Q/1P6/PB3PPP/3RR1K1/w Nd4xPe6! Reinfeld.252.1001 r2r2k1/ppb1qpp1/2n2n1p/2P1p3/1P1p4/P3PN2/1BQ1NPPP/3RK2R/b Pd4d3! Reinfeld.253.1001 r6r/pN1bkppp/n3p3/4n3/8/P5P1/1P1BPP1P/1R2KB1R/b Bd7c6 Reinfeld.254.1001 r1r3k1/p3bp1p/1n4p1/N2bp3/3P4/4P3/1BqQBPPP/R2R2K1/b Qc2xQd2 Reinfeld.255.1001 r2q1rk1/pb1nbn1p/1pp1p1p1/3p1p2/2PP1B2/2N2NPB/PPQ1PP1P/2RR2K1/b Pg6g5 Reinfeld.256.1001 1r3r2/1b4kp/1q1p2p1/p1n1P1p1/1p2P3/7P/PPPQNNBK/R4R2/b Rf8xNf2! Reinfeld.257.1001 6k1/p2q2pp/2bb3r/1pp2p2/3p1P2/3P2PP/PPPNN2K/5RQ1/b Qd7e6! Reinfeld.258.1001 r3qrk1/p4pbp/B4np1/2p1p3/2Pp4/PP1P2Pb/1N1BPP1P/R1Q1K2R/b Qe8c6 Reinfeld.259.1001 r3k3/1p1b1p2/8/p1b1P1N1/5p2/P6r/1PP2P2/1RBR2K1/b Rh3g3+ Reinfeld.260.1001 1r1r2k1/3q1pbp/1n4p1/2R5/p3Q3/4NP1P/P2N2P1/3R3K/b Rd8e8! Reinfeld.261.1001 r1bq1rk1/1pp2pbp/3p1npB/p1nPp3/2P1P1P1/2N2P2/PP1Q3P/R3KBNR/b Nf6xPe4! Reinfeld.262.1001 3r1k2/1p6/p4P2/2pP2Qb/8/1P1KB3/P6r/8/b Rd8xPd5+! Reinfeld.263.1001 4R3/5ppk/2p2bq1/pp1p4/3P2bp/1PP4B/P4R1K/2B4N/b Bg4xBh3 Reinfeld.264.1001 r1r3k1/1p1bqppp/5n2/pP1Pp2N/4n3/P2QP3/1B2BPPP/R3K2R/b Ne4xPf2! Reinfeld.265.1001 1k1r1q2/pnp2p1p/1p2pp2/r7/2PP1P2/3R2P1/PKP1Q1NP/7R/b Rd8xPd4! Reinfeld.266.1001 4q1k1/pb3pp1/7p/Q7/3nN3/P2r1P1B/6PP/1R5K/b Bb7xNe4 Reinfeld.267.1001 3r2k1/pp4p1/7p/2b2p1P/8/P1Nr1Q2/1Pq1RPP1/1R4K1/b Qc2xRb1+! Reinfeld.268.1001 r1bqkb1r/ppppnppp/5n2/1B2N3/4P3/3P4/PPP2PPP/RNBQK2R/b Pc7c6 Reinfeld.269.1001 5n1k/5pp1/1qb4p/1p1p3Q/2pP4/R1P2P1P/1RB3PK/4r3/b Qb6c7+! Reinfeld.270.1001 rn1q1rk1/ppp3pp/3b4/3P1p2/3Pn1b1/3B1N2/PP3PPP/RNBQR1K1/b Bd6xPh2+! Reinfeld.271.1001 3R4/pkp4p/8/4p3/1q1n4/3R2P1/1N5P/2K5/b Qb4e1+ Reinfeld.272.1001 r4rk1/ppp2ppp/2b1p3/3n2q1/1b1P4/1QNBP1B1/PP3PPP/R4RK1/b Bb4xNc3 Reinfeld.273.1001 Q7/ppp2kpp/8/2b5/4RP1q/7b/PPP3PP/3R2BK/b Bh3xPg2+! Reinfeld.274.1001 7k/p1p1r1p1/1b5p/4B2q/5P2/6P1/P1Q4P/R3K3/b Re7xBe5+! Reinfeld.275.1001 r1br2k1/ppb1qppp/1np2n2/8/P2NP3/2N4P/1PQ2PP1/R1BR1BK1/b Rd8xNd4 Reinfeld.276.1001 5rk1/R4ppp/5b2/8/8/1N3P2/Pr4PP/5RK1/b Rb2xNb3! Reinfeld.277.1001 r4k1r/1pp1qpp1/p2p1n1p/3Pp3/B3P3/P1PP1Q2/1P4PP/R3K2R/b Nf6xPd5! Reinfeld.278.1001 3r2k1/1p2q1pp/4bp2/pB6/Q7/P3P3/1r3PPP/R4RK1/b Rd8d5! Reinfeld.279.1001 3r1rk1/p1p2ppp/1bp2n2/8/1P2p3/N1Pq1P2/P2P2PP/R1BQ1R1K/b Pe4e3! Reinfeld.280.1001 8/6pk/7p/3p1p1Q/3PbPP1/2p3KP/2P2B2/1rb5/b Pg7g6! Reinfeld.281.1001 rn1qk2r/pbpp1pp1/1p2pn1p/8/1bPP3B/4PN2/PP1N1PPP/R2QKB1R/b Pg7g5! Reinfeld.282.1001 5rk1/1p4pp/2p5/3p4/4p3/3q4/r1N1Q1PP/2R1K2R/b Pd5d4! Reinfeld.283.1001 1r3rk1/p5p1/5p1p/4p3/2qnN3/5P2/PR4PP/1Q2R1K1/b Nd4xPf3+! Reinfeld.284.1001 2k1n3/1pb2p2/p1p4p/8/2P2P1P/2N2RB1/PPP3r1/2K5/b Rg2xBg3 Reinfeld.285.1001 4r1k1/1pp3p1/p3q2p/4p1b1/1P5N/6QP/1PP3P1/5R1K/b Qe6c4! Reinfeld.286.1001 1r3rk1/p1p4p/3q2pb/3Ppb2/2Q2n2/P1N1BN2/1P4PP/2KR1R2/b Qd6b6! Reinfeld.287.1001 r2qr1k1/pp3p1p/2p1bnp1/2P1p3/3nPP2/1PNQ4/P2NB1PP/R4RK1/b Nd4xBe2+ Reinfeld.288.1001 6k1/1bp3pp/1p1p4/p3p2r/P1P2r2/1P1Q1PqP/2P3P1/3R1RBK/b Rf4xPf3! Reinfeld.289.1001 r3r1k1/1b1q1p2/3p2pB/p3p3/4n3/2P5/PP2N1PP/R2Q1R1K/b Qd7h3! Reinfeld.290.1001 3r2k1/5ppp/pb2p3/1p2P3/1P2bPP1/P1B5/6P1/R4R1K/b Rd8d3 Reinfeld.291.1001 3b4/5pk1/4p1p1/1p6/5P1p/1r4PK/1PR4P/3B4/b Ph4xPg3! Reinfeld.292.1001 5k2/pb1q1p1p/1p6/6R1/3p4/8/PP4PP/R2N3K/b Qd7e7! Reinfeld.293.1001 r2q1rk1/pp1bbppp/1np2n2/8/3N4/1N1Q2PP/PP2PPB1/R1B2RK1/b Pc6c5 Reinfeld.294.1001 r2r1k2/p1p1qp2/1p2pN1p/4Q3/2P5/P6P/1B4P1/5R1K/w Nf6d5! Reinfeld.295.1001 r1b1k2r/pp1nppbp/1qnp2p1/4P3/3N1P2/2N1B3/PPP1B1PP/R2QK2R/w Nd4e6! Reinfeld.296.1001 r3k2r/1p1b1ppp/p3p3/4R3/3q1P2/3B4/PPP3PP/R2Q3K/w Re5xPe6+! Reinfeld.297.1001 rnb2rk1/ppp2ppp/1b6/q2P2B1/4R3/2N2N1P/PP3PP1/R2Q2K1/w Bg5e7! Reinfeld.298.1001 2q2r2/R1P4k/6pp/1pQ5/1P3P2/7P/6P1/6K1/w Qc5xRf8 Reinfeld.299.1001 4n1k1/rrp1q1pp/5p2/R3pb2/1P6/2Q1PP2/1B2B1PP/2R3K1/w Be2a6! Reinfeld.300.1001 r1b3k1/ppp1n2p/2n2qpB/6N1/3NP3/2QP2P1/P1P3BP/6K1/w Nd4xNc6! Reinfeld.301.1001 3rrbk1/p2b3p/5qp1/2ppN3/5P2/8/PP1NQ1PP/4RR1K/w Ne5xBd7! Reinfeld.302.1001 rn1q1rk1/pbp3pp/1p1pp3/8/2P5/5NP1/PPQ1PPBP/3R1RK1/w Nf3g5! Reinfeld.303.1001 r3r1k1/ppqn1ppp/2p2n2/4pN2/2P5/Q4PPB/PP1R1P1P/3R2K1/w Rd2xNd7! Reinfeld.304.1001 rn3rk1/1bB1bppp/p7/1p1P4/P1p5/3N2P1/1P3PBP/R4RK1/w Pd5d6! Reinfeld.305.1001 r4rk1/p2q1ppp/bp1p4/n1pPpN2/2P1PP2/P1PB4/6PP/R2Q1RK1/w Qd1g4 Reinfeld.306.1001 r4rk1/6pp/p1Qp1q2/1p2ppn1/6b1/8/PPPNBPPP/3RR1K1/w Pf2f3 Reinfeld.307.1001 r3k2r/pp1bppbp/1qnp2p1/1N6/3NnPP1/4B3/PPP1B2P/R2QK2R/w Nd4e6! Reinfeld.308.1001 1r3r1k/4QBpp/2p5/1q2b3/8/1pP5/1P4PP/3R1R1K/w Bf7c4! Reinfeld.309.1001 rnb2rk1/ppp2qpp/1n2p3/1N2Pp2/2BP4/5N2/PP3PPP/R1Q1K2R/w Nb5xPc7! Reinfeld.310.1001 r3r1k1/p1p1qppp/1b6/2pp1P2/Q2Pn1P1/4BN2/PP3P1P/2R1R1K1/w Pd4xPc5 Reinfeld.311.1001 2r4R/1pkbbp2/1q6/3pP1p1/QP1N4/2P1BP2/5KP1/8/w Nd4e6+! Reinfeld.312.1001 6rk/2p1bp1p/2n2pr1/pp1qpN2/3pN2P/2PP1Q2/PP3PP1/R2R2K1/w Ne4g5! Reinfeld.313.1001 5r1k/pb3B1p/3r4/6Q1/1p2q3/8/PP3RPP/5R1K/w Bf7d5! Reinfeld.314.1001 rn1q1rk1/pbppbppp/1p2p3/8/2P5/2n2NP1/PPQPPPBP/R1B1R1K1/w Nf3g5! Reinfeld.315.1001 1n6/1P4p1/6k1/p7/4N3/P6Q/K6b/4q3/w Qh3e6+! Reinfeld.316.1001 1r2k2r/pbppnpp1/1bn4p/4P3/Q1B3q1/2P2NN1/P4PPP/R1B1R1K1/w Bc4xPf7+! Reinfeld.317.1001 rnb2rk1/pp2np1p/2p2q1b/8/2BPPN2/2P2Q2/PP4PP/R1B2RK1/w Nf4d5! Reinfeld.318.1001 r2nk2r/pq2bppp/1p2pn2/6N1/3BN3/5QP1/PPP2PKP/R2R4/w Bd4xNf6! Reinfeld.319.1001 3rkr2/pp2b1pp/2p1Bn2/4q3/8/4B3/P1P1QPPP/1R2R1K1/w Rb1xPb7! Reinfeld.320.1001 1r1q3k/1bp1n1pp/3p4/4n3/4Nr2/1P1Q3R/P1P2PPP/5RK1/w Ne4f6! Reinfeld.321.1001 r4rk1/1p3pbp/pn1pq3/6P1/3P4/1PN1BQ1R/1P5P/R6K/w Pd4d5! Reinfeld.322.1001 rn1qkbnr/ppp2pp1/3p3p/4p3/2B1P1b1/2N2N2/PPPP1PPP/R1BQK2R/w Nf3xPe5! Reinfeld.323.1001 rn2kb1r/ppp2ppp/4pn2/q4b2/2BP4/2N5/PPPB1PPP/R2QK1NR/w Nc3d5! Reinfeld.324.1001 r1q2rk1/pbpnbppp/1p6/4p3/2P5/1PQ2NP1/PB2PPBP/R2R2K1/w Rd1xNd7! Reinfeld.325.1001 5b1k/8/2p2P2/1pp1Q1P1/2P4q/3PKP2/1P6/8/w Pf6f7+ Reinfeld.326.1001 disch rqb2rk1/1p2pp1p/p5p1/3Nb3/P1B2n2/1Q3N2/1P3PPP/2RR2K1/w Nd5b6! Reinfeld.327.1001 1r3rk1/5ppp/1q1p4/pnp5/4P3/1PP2P2/PB2QP1P/1K1R2R1/w Qe2xNb5! Reinfeld.328.1001 r1bqr2k/1p4bp/2p1n3/p3p1p1/P1P1N1p1/BQ1PP3/5PBP/1R3RK1/w Ne4d6 Reinfeld.329.1001 r1b1qrk1/1p3ppp/p1p5/3Nb3/5N2/P7/1P4PQ/K1R1R3/w Re1xBe5! Reinfeld.330.1001 Q4b1r/pb1q1ppp/2n3k1/1pN5/8/8/PPP2PPP/RNB2RK1/b Bf8xNc5! Reinfeld.331.1001 r2r2k1/pQ3ppp/8/2p1n3/8/P1P1P2P/5PPq/R1B1RK2/b Ne5d3! Reinfeld.332.1001 4r1k1/1p3pp1/6q1/p1P3bp/NP5n/P1Q4P/2Pr1BP1/R3R1K1/b Bg5e3! Reinfeld.333.1001 5rk1/1p4pp/5qb1/2pPr3/P1P3R1/P4P2/3QP3/2KR3B/b Re5xPe2! Reinfeld.334.1001 r1b2rk1/pp2qppp/4nn2/1Bp1N3/4P3/2P5/P1P2PPP/R1BQR1K1/b Ne6c7 Reinfeld.335.1001 1r3rk1/5pb1/p2p2p1/Q1n1q2p/1NP1P3/3p1P1B/PP1R3P/1K2R3/b Nc5xPe4! Reinfeld.336.1001 r1q1k2r/pp1bppbp/2np1np1/8/3NP3/2N3PP/PPP2PBK/R1BQ1R2/b Nc6xNd4 Reinfeld.337.1001 r1bqkb1r/1p1n1ppp/p1p2n2/2Pp1B2/3Pp3/2N1P3/PP1N1PPP/R1BQK2R/b Nd7xPc5 Reinfeld.338.1001 2r3k1/2r1ppbp/p5p1/q2pP3/3BbP2/1P5P/PQNR1RPK/8/b Qa5xRd2 Reinfeld.339.1001 4r3/2p2b1p/pb3kp1/3n1p2/1N6/1PP2P2/PK4PP/2NR1B2/b Nd5e3 Reinfeld.340.1001 2kr3r/ppp2ppp/3b4/5b1q/8/2PP1N2/PPQ2PPP/R1B2RK1/b Bf5xPd3 Reinfeld.341.1001 r1bqk2r/ppp2ppp/2nb4/8/2P1n3/P4NP1/1P2PP1P/RNBQKB1R/b Ne4xPf2 Reinfeld.342.1001 5rk1/5p1p/3Q2p1/p3n3/4B3/7P/1qP1R1P1/7K/b Qb2c1+ Reinfeld.343.1001 r1b2rk1/ppp2ppp/1b1p1q2/3P4/BPPp4/8/PB1PQPPP/R4RK1/b Pd4d3 Reinfeld.344.1001 r1b4Q/ppp2kpp/3b4/8/4RP1q/8/PPP3PP/3R2K1/b Bc8h3 Reinfeld.345.1001 3rr1k1/p4ppp/1p3q2/1P2n3/3Rn3/B3P3/B1Q2PPP/5RK1/b Ne5f3+ Reinfeld.346.1001 1k6/ppp4p/1n2pq2/1N2Rb2/2P2Q2/8/P4KPP/3r1B2/b Rd1xBf1+ Reinfeld.347.1001 3r2k1/ppp2ppp/6q1/b4n2/3nQB2/2p5/P4PPP/RN3RK1/b Nf5g3 Reinfeld.348.1001 3rk1r1/pp3p1p/1nb1p3/8/qn2P2Q/3B1N2/PP3PPP/3R1RK1/w Qh4xRd8+ Reinfeld.349.1001 r1bq1rk1/pp1n1pp1/2p1p3/6b1/2PPBB2/4P3/PPQ2PP1/R3K2R/w Be4h7+ Reinfeld.350.1001 r1b1k2r/pp1n3p/2pb3q/3pN1p1/3PpP2/2N1P3/PP4PP/R2QBRK1/w Ne5f7 Reinfeld.351.1001 r2Q4/pbR2pkp/1p1Nq1p1/3p4/1n6/3BP3/PP3PPP/6K1/w Nd6xPf7 Reinfeld.352.1001 2k4r/1p1r1ppp/pq2pn2/2p5/Q1PP4/5R2/PP2NPPP/2KR4/w Rf3xNf6 Reinfeld.353.1001 r2RNknQ/1p1b1rpR/p1p1p3/2P1qp2/8/P3P3/1P3PP1/4K3/w Qh8xNg8+ Reinfeld.354.1001 2r4r/1k4bp/p5p1/2B1p3/8/8/3R1PPP/2R3K1/w Rd2d7+ Reinfeld.355.1001 8/6pp/4q3/2pp2P1/4pQbk/2P1P3/7K/6R1/w Rg1h1 Reinfeld.356.1001 6k1/p4R1p/1p5q/5Q2/2Pb4/8/P6P/7K/w Qf5d5 Reinfeld.357.1001 r3rk2/pbp2Bpp/8/4N1n1/5P2/4Q2R/Pq4PP/5RK1/w Qe3c5+ Reinfeld.358.1001 r5rk/pp3n1p/4q3/5pp1/3P4/PP1Q1N1P/1B5K/5R2/w Pd4d5+ Reinfeld.359.1001 disch r1b1kb1r/p2n2pp/4p3/qp1pNp2/2pP1P1B/2P1P3/PPQnB1PP/R3K2R/w Be2h5+ Reinfeld.360.1001 r3kb1r/2p1nppp/p1Np4/1pnP2B1/B5b1/8/PPP2PPP/RN2R1K1/w Bg5xNe7 Reinfeld.361.1001 3b1r2/3p2pk/bp1P3n/r4PpR/1pB1N1P1/8/PB5P/5RK1/w Ne4xPg5+ Reinfeld.362.1001 r4r1k/p1q3pp/1pbb4/5p2/1PP5/1BBR3P/PQ4P1/R5K1/w Rd3xBd6 Reinfeld.363.1001 rn2kbr1/pp3p1p/2p5/q2Pp3/6b1/1BN2Q2/PPP1NPPP/R3K2R/w Qf3xPf7+ Reinfeld.364.1001 2r2nk1/p4q2/bp4p1/3pPp2/6p1/1P2P2R/PB3R1P/3Q2K1/w Rh3h8+ Reinfeld.365.1001 r1b4r/ppp1kppp/q7/8/3pN3/8/PPP2PPP/R2QR1K1/w Ne4c5+ Reinfeld.366.1001 disch 3r4/r7/pp1p1bnk/2pP1RN1/P1P3QP/6P1/1qB2P1K/8/w Qg4h5+ Reinfeld.367.1001 r1b1r1k1/ppq2p1p/3b1ppQ/2n5/8/3B2N1/PPP2PPP/R1B2RK1/w Ng3h5 Reinfeld.368.1001 r1b2rk1/1pq2p1p/p4Q2/1pP5/5p2/3BR3/P4PPP/5K1R/w Re3g3+ Reinfeld.369.1001 r7/p1b3pk/2N4p/2pb4/8/1P1P4/PBP3PP/4R1K1/w Re1e7 Reinfeld.370.1001 r7/2b1qr1k/2p2pRn/p1Pppp2/Pp1P1N1P/5P2/PBBQ4/2K3R1/w Rg6xNh6+ Reinfeld.371.1001 2k2brr/1ppbqp2/2np4/1B2p1P1/Q3P3/2PPB1p1/P2N1PP1/RR4K1/w Qa4a8+ Reinfeld.372.1001 8/p5pk/1p3q2/2n2P1p/2PQ2p1/2P1Rb2/PK5P/1B6/w Re3e7 Reinfeld.373.1001 r1q2r1k/p4b2/1p2pP2/3p3p/1P1B1P2/2PB4/P3Q2P/6RK/w Qe2xPh5+ Reinfeld.374.1001 r4k2/1b2qp1r/pp2p3/3pNPbp/3P4/2N2Q2/PPP4P/1K1RR3/w Ne5g6+ Reinfeld.375.1001 r4r1k/ppb1q2p/2p1Bp2/2P2P2/n1PP4/5K1Q/P2B1P2/R6R/w Qh3xPh7+ Reinfeld.376.1001 1r4kr/p2p1R1p/p2Np1nB/4p3/6PP/7N/P1PK2b1/8/w Rf7g7+ Reinfeld.377.1001 3r3r/pk3ppp/1ppB1q2/4p3/2B1P1n1/Q2R4/1PP1NPPP/6K1/w Qa3xPa7+ Reinfeld.378.1001 2r1n3/p1q2krR/2bpp1pQ/1p4P1/4PP2/1PP5/2PBB3/2K4R/w Qh6xPg6+ Reinfeld.379.1001 r5r1/p1q2p1k/1p1R2pB/3p4/6bQ/2p5/P1P1NPPP/6K1/w Bh6f8+ Reinfeld.380.1001 disch 2r1q1r1/pb1n1ppk/3pNn1p/2pP1P2/2p4B/P1P4R/3Q2PP/1B3RK1/w Ne6xPg7 Reinfeld.381.1001 8/2R2Bk1/p2r3p/np2p2K/4P2P/1P2P3/8/8/w Pb3b4 Reinfeld.382.1001 r1b2r2/5P1p/ppn3pk/2p1p1Nq/1bP1PQ2/3P4/PB4BP/1R3RK1/w Ng5e6+ Reinfeld.383.1001 disch r2r2k1/p2nqpp1/2b1p2p/4B1P1/2p4Q/3B4/PPP2P1P/2KR2R1/w Qh4xPh6 Reinfeld.384.1001 6k1/pp3p1p/8/3pbR1r/3N4/P3p3/1PB3PP/6K1/b Be5xNd4 Reinfeld.385.1001 2k1r3/1pp2p2/p2p1B1p/3b1Nq1/1P4p1/2QB1pP1/P4R1P/7K/b Qg5xBf6 Reinfeld.386.1001 7k/6pp/p7/3N4/P7/3n1NPP/2r1n2K/3R4/b Ne2d4+ Reinfeld.387.1001 disch rn2kb1r/ppp1pppp/8/8/4q3/3P1N1b/PPP1BPnP/RNBQ1K1R/b Ng2h4+ Reinfeld.388.1001 disch 4rrk1/p1p3pp/3b4/1P1P4/4Npnq/3B4/PP2R1PP/5RQK/b Ng4xPh2 Reinfeld.389.1001 r1bqk3/pppp1pQ1/8/2b1P2r/4nP1p/8/PPP1B1PP/RNB2R1K/b Ne4g3+ Reinfeld.390.1001 5r1k/1b4pp/6r1/p1R5/Pp2p2q/1Q2B2P/1P3PPK/4R3/b Rg6xPg2+ Reinfeld.391.1001 6rk/6np/p6Q/3q4/BP6/3p4/P4PR1/6K1/b Qd5xRg2+ Reinfeld.392.1001 2Q5/k1p5/pb5p/6p1/3r4/p2q2BP/5PP1/2R3K1/b Qd3xBg3 Reinfeld.393.1001 2rq1rk1/1b2bppp/p3p3/4P1P1/1n1NpP1P/2N1B3/1PP2Q2/R4R1K/b Qd8xNd4 Reinfeld.394.1001 r1b2rk1/ppb1n2p/4pp2/8/3qNPPN/1P2pQ2/P1P3BP/R4RK1/b Pe3e2+ Reinfeld.395.1001 (discovered check) 6k1/1b2qpbp/3P2p1/Q7/N3r3/6B1/PP2r1PP/3RR2K/b Re2xPg2 Reinfeld.396.1001 r2rn1k1/1bqn1ppp/p7/2bpP1P1/1p1N1Q2/1P3B2/PBP1NR1P/3R2K1/w Qf4xPf7+ Reinfeld.397.1001 2qrr1n1/3b1kp1/2pBpn1p/1p2PP2/p2P4/1BP5/P3Q1PP/4RRK1/w Qe2h5+ Reinfeld.398.1001 rn2kb1r/pp2pp1p/2p2p2/8/8/3Q1N2/qPPB1PPP/2KR3R/w Qd3d8+ Reinfeld.399.1001 r1b1knr1/pp2bp1p/1q2p3/5p2/3NN3/8/PPPQBPPP/2KRR3/w Nd4xPf5 Reinfeld.400.1001 r3kb1r/1pp3p1/p3bp1p/5q2/3QN3/1P6/PBP3P1/3RR1K1/w Qd4d7+ Reinfeld.401.1001 r2q1rk1/pbp3pp/1p1b4/3N1p2/2B5/P3PPn1/1P3P1P/2RQK2R/w Nd5e7+ Reinfeld.402.1001 dblch r1b1k2r/pppn1ppp/2n5/1B1Qpq2/8/B1p2N2/P4PPP/R3R1K1/w Nf3xPe5 Reinfeld.403.1001 q3kb1r/3n1ppp/4p3/1p6/3N4/1B6/1P1BQPbP/5RK1/w Bb3xPe6 Reinfeld.404.1001 rnb1k1r1/ppp2p1p/4p3/8/1b2q2Q/8/PPPB1nPP/2KR1BNR/w Qh4d8+ Reinfeld.405.1001 rnb1kb1r/pp3ppp/2p5/4q3/4n3/3Q4/PPPB1PPP/2KR1BNR/w Qd3d8+ Reinfeld.406.1001 1rq5/2k5/2Bp1r1p/2nP1PpQ/1R2p3/P1P1P1RP/P5P1/6K1/w Rg3xPg5 Reinfeld.407.1001 r4rk1/1bp3pp/p3Pp2/1pb2P1Q/5B1N/1Pq1p1PK/P6P/R2R4/w Rd1d7 Reinfeld.408.1001 r1b1k2r/ppp2ppp/2p5/8/3Qn1q1/8/PPPB2PP/2KR1B1R/w Qd4d8+ Reinfeld.409.1001 r4r1k/ppp2pRp/1P1p4/8/1P2P3/3n4/PB3P1P/R6K/w Rg7g8+ Reinfeld.410.1001 dblch r3kb1r/ppp2ppp/5q2/3p4/2Bnn1b1/5NP1/PPPN1P1P/R1BQR1K1/w Nd2xNe4 Reinfeld.411.1001 2rr4/p3k1n1/1p3bB1/3qBPp1/1P2Q3/P6R/5P1P/R5K1/w Be5d6+ Reinfeld.412.1001 dblch k3r2r/p2q2b1/2p5/4N2p/4Q1p1/1R4B1/PP3PPP/6K1/w Rb3b8+ Reinfeld.413.1001 r3kb1r/ppp3p1/4bp1p/5q2/3QN2B/1PP5/P4PPP/3RR1K1/w Qd4d7+ Reinfeld.414.1001 rn3rk1/p5pp/2p5/3Ppb2/8/1Q6/PPPB2PP/R4KNR/b Bf5d3+ Reinfeld.415.1001 dblch r5k1/pQp2qpp/8/4pbN1/3P4/6P1/PPr4P/1K1R3R/b Rc2c1+ Reinfeld.416.1001 dblch r1b1k2r/ppp1qppp/5B2/3Pn3/8/8/PPP2PPP/RN1QKB1R/b Ne5f3+ mate Reinfeld.417.1001 7k/1bpp2p1/3bp3/p4B2/2P5/P3BrPq/1PQ2P1P/4RRK1/b Qh3g2+ Reinfeld.418.1001 r2qr1k1/ppp1bppp/5n2/6B1/2PR4/P3P3/1PQ2PPP/4KB1R/b Qd8xRd4 Reinfeld.419.1001 6k1/pb3pp1/8/7p/2Q5/P2r1P1B/4q2P/1R3N1K/b Rd3xPf3 Reinfeld.420.1001 3r1rk1/1p4pp/p5N1/4p3/2p5/2Pnp1Pq/PP4QP/R2K1R2/w Qg2d5+ Reinfeld.421.1001 rnb1r1k1/ppp2ppp/5q2/8/5B2/4NQP1/P3RPP1/6KR/w Ne3d5 Reinfeld.422.1001 2r1Rn1k/1p1q2pp/p7/5p2/3P4/1B4P1/P1P1QP1P/6K1/w Qe2c4 Reinfeld.423.1001 r5nr/pp2q1kp/3R4/1p2n3/4PQ2/2N1P1P1/PPP4P/5RK1/w Rd6d7 Reinfeld.424.1001 r5k1/ppbrq1p1/4np2/2P4Q/3P3P/1B2B3/PP1K1P2/6RR/w Rg1xPg7+ Reinfeld.425.1001 6kr/1q2r1p1/1p2N1Q1/5p2/1P1p4/6R1/7P/2R3K1/w Rc1c8+ Reinfeld.426.1001 8/2RR4/1r6/1k6/1p1p1nBp/1K2b3/7P/8/w Rd7d5+ Reinfeld.427.1001 4r1k1/1p3p2/p2PqBnr/P1p3R1/8/4P1QP/6RK/8/w Rg5e5 Reinfeld.428.1001 r4k1r/ppp1n2p/2n2N2/4p1N1/1q1b2Q1/8/P4PPP/R1B1R1K1/w Bc1a3 Reinfeld.429.1001 r4rk1/p1n2pbp/5Bp1/2pN4/2p3q1/8/PP1Q2B1/R4RK1/w Qd2h6 Reinfeld.430.1001 2r1r2k/1q3ppp/p2Rp3/2p1P3/6QB/p3P3/bP3PPP/3R2K1/w Bh4f6 Reinfeld.431.1001 2r1b1k1/5r1p/3p1QpB/q2Pp3/1pp1P3/5R1P/P4PP1/4R1K1/w Qf6e7 Reinfeld.432.1001 r3kbnr/2p2ppp/p1q5/1p2p3/4P3/1P1Q4/1PP2PPP/RNBR2K1/w Ra1xPa6 Reinfeld.433.1001 6rr/pp2kpRb/4p2p/4P3/3N1P2/4K3/P1P4P/6R1/w Rg7xBh7 Reinfeld.434.1001 r2q1r1k/pb3p1p/2n1p2Q/5p2/8/3B2N1/PP3PPP/R3R1K1/w Bd3xPf5 Reinfeld.435.1001 1Rb1q1rk/6p1/4p2p/1p1pB3/p2P4/4P2P/P1Q2PP1/6K1/w Rb8xBc8 Reinfeld.436.1001 2kr4/pp1r1pp1/4n1p1/4R3/2Pp1qP1/3P2QP/P4PB1/1R4K1/w Re5c5+ Reinfeld.437.1001 rn1q2rk/pp3p1p/2p4Q/3p4/7P/2NP2R1/PPP3P1/4RK2/w Re1e8 Reinfeld.438.1001 r1bqn2k/1p2n1p1/p2bppQ1/2pp2PP/8/PP2P3/1BPP4/2K3RR/w Pg5xPf6 Reinfeld.439.1001 r6k/3b2rq/4p3/p2pQp2/1p6/3R4/PPP1N2P/2K3R1/w Rd3h3 Reinfeld.440.1001 4r2k/pppb2pp/2np2q1/3B4/2P2P2/1PB1R1P1/PQ5P/6K1/w Pf4f5 Reinfeld.441.1001 4r2k/p2qr1pp/1pp2p2/2p1nP1N/4R3/1P1P2RP/1PP2QP1/7K/w Rg3xPg7 Reinfeld.442.1001 3Q4/qr4R1/k2p1p2/2pPpP2/p1P5/8/PP6/7K/w Qd8e8 Reinfeld.443.1001 r2q1bk1/1pp2ppp/p2p1n2/5NB1/4r3/2Q5/PPP2PPP/R3R1K1/w Nf5h6+ Reinfeld.444.1001 r1b2qk1/pnp4p/3p1BpQ/2pr4/5P2/8/PPP3PP/R3R1K1/w Re1e8 Reinfeld.445.1001 rn2r2k/pbq2ppB/2p1p2p/1p1nN3/P1pP4/B1P1P1P1/2Q2P1P/R4RK1/w Ba3d6 Reinfeld.446.1001 r5k1/1pQ2bpp/p1n1Rp2/3B4/1q6/6BP/PP3PP1/6K1/w Re6e8+ Reinfeld.447.1001 r1b3kr/pppp1p1p/5n1B/3PR3/4n3/2P2N2/P4PPP/R5K1/w Nf3d2 Reinfeld.448.1001 r1b2r1k/pp3Rpp/2p5/2q2p2/8/1B6/P3QPPP/1R4K1/w Qe2e5 Reinfeld.449.1001 r2r2k1/1b2bp1p/p4npQ/1p1Pp1N1/Pnq1P3/R5N1/5PPP/1BBR2K1/w Ng3h5 Reinfeld.450.1001 2r3r1/1kn1q2n/1p2p1Q1/p2pP3/3P4/P2N1N2/1PR4P/2R4K/w Rc2xNc7+ Reinfeld.451.1001 r4bkr/ppp3pp/8/3qn1N1/2pp2P1/8/PPP2P1P/R1BQR1K1/w Re1xNe5 Reinfeld.452.1001 3rr1k1/ppqbRppp/2p5/8/3Q1n2/2P3N1/PPB2PPP/3R2K1/w Qd4xBd7 Reinfeld.453.1001 2rn3k/p2q2bp/1p1p2p1/3B1p2/2P2P2/Q6P/P4BP1/4R1K1/w Qa3xPa7 Reinfeld.454.1001 r1bqkb2/ppp1p3/2P4r/6p1/7p/2pBP3/PPP3PP/R2QK1NR/w Qd1h5+ Reinfeld.455.1001 r1b1r1k1/pp3pBn/1q1p2p1/2pPp1n1/2P1P1P1/2N2P2/PPR1B2Q/4K2R/w Bg7f6 Reinfeld.456.1001 r2r2k1/2p2ppp/p7/1p2P1n1/P6q/5P2/2B1QP1P/R5RK/b Rd8d2 Reinfeld.457.1001 5rk1/1pq3pp/3bNp2/1Q6/4P3/2B5/2PP2PP/r4R1K/b Qc7d7 Reinfeld.458.1001 r2r2k1/pp1bpp1p/6p1/2ppn3/6P1/1PbPPB2/q1PN1P2/1R1QKN1R/b Ne5xBf3+ Reinfeld.459.1001 5r1k/pppq2pp/2n2r2/4p3/4Q3/2P1B2P/PPB3K1/R6R/b Rf6g6+ Reinfeld.460.1001 7k/1R3p1p/P2Pp3/4n3/8/8/r5BP/2r2N1K/b Ne5f3 Reinfeld.461.1001 r3r1k1/1p3ppp/2p2b2/p7/8/Q1BP2Pq/PPP4P/4RR1K/b Re8e2 Reinfeld.462.1001 b3r1k1/p4ppp/1pq5/8/8/1P1P2P1/P1P2QNP/3B2K1/b Re8e1+ Reinfeld.463.1001 8/8/8/1p5r/p1p1k1pN/P2pBpP1/1P1K1P2/8/b Pb5b4 Reinfeld.464.1001 3r4/p1r2bk1/5p2/2p1q1pp/8/1PR1P2P/P4QP1/2RB2K1/b Rd8xBd1+ Reinfeld.465.1001 3r2k1/1p4bp/2p1bnp1/1P2Nq2/5B2/5Q1P/5PN1/4R1K1/b Be6d5 Reinfeld.466.1001 6r1/1ppb1k2/p2p1p2/3P4/2P2P1N/4R1nP/PP1K2B1/8/b Ng3f5 Reinfeld.467.1001 2kr2r1/1bb2pq1/p1p4p/1pP1p3/4Pp2/1PNN1Q1P/1P3PP1/R4RK1/b Rd8xNd3 Reinfeld.468.1001 2r3k1/5p1p/p3q1p1/2n3P1/1p1QP2P/1P4N1/PK6/2R5/b Qe6e5 Reinfeld.469.1001 r1b1r1k1/1p3p2/2pp2pp/pP2b2n/2PNP2q/2N2PP1/P2Q3P/R3RBK1/b Nh5xPg3 Reinfeld.470.1001 2r3k1/5pb1/1N2p2p/8/3nBq1p/2r4P/R1p2PP1/2R1Q2K/b Nd4e2 Reinfeld.471.1001 3r4/1p3k1p/p1b1p1p1/4Q1Pn/2B3KP/4pP2/PP2R1N1/6q1/b Rd8d4+ Reinfeld.472.1001 r2r2k1/pp1bpp1p/6p1/q1ppn3/6P1/1PbPPBN1/P1PN1P2/1R1QK2R/b Ne5xBf3+ Reinfeld.473.1001 1r4k1/6pp/4N3/3r4/b7/3R4/K2R2PP/8/b Rd5a5 Reinfeld.474.1001 r4rk1/2p2pp1/pppb1q1p/4pN2/3PPn2/5Q1P/PPP2PP1/R1B2RK1/b Pe5xPd4 Reinfeld.475.1001 4r3/pp1q2kp/1bpn1p2/4p2p/6P1/1BP2Q2/PP3PK1/2B1R3/w Bc1h6+ Reinfeld.476.1001 5nk1/1p4pp/5r2/p2qNb2/2Npn3/P5P1/1P3PBP/2R1Q1K1/w Pg3g4 Reinfeld.477.1001 r2q1b2/5pk1/pp1p1np1/2pP2B1/6BQ/7P/PPP3P1/4R2K/w Re1e8 Reinfeld.478.1001 2r1k3/6pr/p1nBP3/1p3p1p/2q5/2P5/P1R4P/K2Q2R1/w Rg1xPg7 Reinfeld.479.1001 r2q4/5pk1/p1npr3/1pp1p1p1/4P1P1/1PPP1Q2/1P1B1PK1/R6R/w Rh1h7+ Reinfeld.480.1001 r4bkr/1pp3p1/p2qb2p/3n4/2B5/P2P1Q1P/1PP2PP1/R1B1R1K1/w Re1xBe6 Reinfeld.481.1001 r2Nqb1r/pQ1bp1pp/1pn1p3/2kp4/P1p2B2/2P5/1PP2PPP/R3KB1R/w Qb7xNc6+ Reinfeld.482.1001 3rn2k/3q1ppp/pp1p4/3Pp1Q1/nP2P3/6P1/5PBP/2R1R1K1/w Bg2h3 Reinfeld.483.1001 1r4k1/4pp1p/6p1/3PQn2/2R5/7P/1q2NPP1/6K1/w Rc4c8+ Reinfeld.484.1001 r3r2k/6Rp/p2q1Qp1/5n2/P5R1/3Np2P/6B1/7K/w Rg4h4 Reinfeld.485.1001 4r1k1/p1pq1p1p/8/3p4/5Q2/1P3PP1/P1P3KP/4R3/w Qf4g4+ Reinfeld.486.1001 1b1rrnk1/1b2q1pp/pp2p3/3nN3/2P4Q/3B2N1/PB4PP/3R1RK1/w Rf1xNf8+ Reinfeld.487.1001 r1b2rk1/5ppp/p1R2n2/1p1p4/3P4/3BP1P1/qP1N1PP1/3QK2R/w Rc6xNf6 Reinfeld.488.1001 R7/6kn/3p1rp1/3B3p/3Q4/2P4P/6PK/4q3/w Ra8a7+ Reinfeld.489.1001 r1b2rk1/ppp2pp1/2np1q1p/1B2p3/Pb2P3/2NP1N2/1PP2PPP/R2Q1RK1/w Nc3d5 Reinfeld.490.1001 8/8/2R5/1Q4r1/1p2kq2/1P5P/3n2P1/6K1/w Qb5xPb4+ Reinfeld.491.1001 5Q2/p1r2ppp/4pk2/3pN3/3Pn3/2q1P3/5PPP/5RK1/w Qf8d8+ Reinfeld.492.1001 2r2r2/3bqpk1/p7/1pn1p1pQ/1B2P3/1B3R2/PP3PP1/2R3K1/w Rc1xNc5 Reinfeld.493.1001 3rbn1k/p1p2n1p/1p2pNp1/6q1/2BP4/1N3Q1P/PP4P1/5RK1/w Nf6xBe8 Reinfeld.494.1001 r1b1r1k1/3q1ppp/p1n5/1pp3B1/3bB3/5N2/PP3PPP/R2QR1K1/w Be4f5 Reinfeld.495.1001 rnb2r1k/pp4pp/2p1Pp2/3p1P2/4N2q/1BB5/P3Q2P/6RK/w Ne4xPf6 Reinfeld.496.1001 r1b5/pp2qpk1/2p1pnp1/4N1Rr/3P3P/P2BP3/1P3P2/3QK2R/w Ne5xPg6 Reinfeld.497.1001 5k2/pb3p1p/1p1q3n/8/2Q3P1/P3B2P/1P3P2/2R3K1/w Qc4c7 Reinfeld.498.1001 2kr3r/pp2q1pp/2p1b3/4Pp2/2B2P2/2Q2R2/PP4PP/2R4K/w Qc3a3 Reinfeld.499.1001 r5k1/pp5p/3p1np1/2pP4/8/8/PPP1Q1PP/6K1/w Qe2e6+ Reinfeld.500.1001 r3k3/6b1/1pb1r1p1/3n4/1pQp4/P2P4/2P5/1KBN1R2/w Rf1e1 Reinfeld.501.1001 rn1qk2r/p2b3p/1p2p1p1/1B5Q/4P3/B1P1n3/P1P3PP/R4RK1/w Qh5xPh7 Reinfeld.502.1001 6k1/pB2pp1p/Pp1rb1p1/8/1P6/4B1Pn/5PKP/2R5/w Bb7c8 Reinfeld.503.1001 r1b1k1nr/ppp2ppp/1bP2q2/8/2B5/BQ6/P4PpP/RN1R2K1/w Bc4xPf7+ Reinfeld.504.1001 rn2kb1r/pp3ppp/8/2nR4/2B1q3/4BQP1/PPP4P/2K4R/w Be3xNc5 Reinfeld.505.1001 r1b1r1k1/pp3p1p/1q2p1pQ/2b1P1B1/8/P2B3P/1P3PP1/2R1R1K1/w Rc1xBc5 Reinfeld.506.1001 r5k1/5qnp/p5pB/1ppr4/3p1PP1/3P3P/PP4Q1/R3R1K1/w Re1e7 Reinfeld.507.1001 2rnn1k1/p1qrpp2/1p1p2p1/4b1P1/3NP3/P1NRBQ1P/1PP5/5RK1/w Nd4e6 Reinfeld.508.1001 2r3rk/3q1p1p/5p2/1p1p1b2/2pN3R/P1P1R3/1P3PPP/3Q2K1/w Re3e7 Reinfeld.509.1001 rB1R4/2Q3pk/5q1p/4p3/6n1/6P1/5P1P/6K1/w Qc7c2+ Reinfeld.510.1001 r5rk/1pp1n1pp/p1n1b1q1/3p1p2/7R/2QB1N2/PB3PPP/4R1K1/w Re1xBe6 Reinfeld.511.1001 6k1/3bbpp1/1pNq1n1p/4p3/1PP1B3/6B1/4QPPP/6K1/w Bg3xPe5 Reinfeld.512.1001 3R4/1p6/2pN3k/p6p/2b2r1P/P4P2/5K2/8/w Kf2g3 Reinfeld.513.1001 6k1/pp3r2/4b1pp/3RN3/2p3P1/5P2/rPP3P1/4R1K1/w Rd5d6 Reinfeld.514.1001 r3r3/ppp1qnkp/5pb1/2P3p1/1P2P3/P1Q2P2/1B4PP/2KR1B1R/w Rd1d7 Reinfeld.515.1001 r5b1/pqr3kp/1pn3p1/1Bp2pN1/4p3/2P3QP/PPPR1PP1/3R2K1/w Qg3xRc7+ Reinfeld.516.1001 rnbk2r1/ppp4p/4p3/1B1P4/5B1q/2N2Qp1/PPP3P1/R5K1/w Bf4xPg3 Reinfeld.517.1001 b4rk1/2Rn1pp1/p3qb1p/1p1ppN1N/6P1/PP2B2P/1P1Q4/6K1/w Rc7xNd7 Reinfeld.518.1001 4k1r1/2pq2p1/pp1pNn1r/3PnQ1p/2P5/6PP/PP2R1B1/4R1K1/w Re2xNe5 Reinfeld.519.1001 r3r1k1/pb1qbp1p/1pn3pB/3N4/3pQ3/6P1/PP2PPBP/2RR2K1/w Qe4xBe7 Reinfeld.520.1001 1r1r2k1/pbq2pb1/1p2p1p1/2p5/4N2R/2PBQ1P1/PPP2P2/1K5R/w Rh4h8+ Reinfeld.521.1001 b1r3k1/3N1pp1/2nRp2p/p3P3/1p3P2/5B2/PP3KPP/8/w Nd7b6 Reinfeld.522.1001 4r3/ppp2k1r/3p2p1/2PP4/5P2/P1B2QPq/1P3R2/6K1/b Re8e3 Reinfeld.523.1001 1r2kb2/p4p2/b1p1p3/8/3P4/8/qBKN1PPP/Q6R/b Rb8xBb2+ Reinfeld.524.1001 br4k1/5pp1/4p2p/2N5/8/Q1qP1P2/6PP/R5K1/b Rb8b1+ Reinfeld.525.1001 r4r1k/7p/1p1p1Pq1/2pP4/bPP1Qp1P/p2K4/P3BP2/4R2R/b Ba4c2+ Reinfeld.526.1001 5bk1/5pp1/3N2b1/2B4p/6P1/1R4QP/1P2rP1K/5q2/b Bf8xNd6 Reinfeld.527.1001 3r2k1/6pp/p1R1P3/P2p4/3P4/1B3Pq1/1P3QPr/6K1/b Rh2h1+ Reinfeld.528.1001 4r1k1/1pp2bbp/p1n3p1/5p2/5N2/2N2P2/PPP1B1PP/1K1R4/b Bg7xNc3 Reinfeld.529.1001 2kr4/p4p2/1p2p1n1/2p2p2/2P2P2/2PPK1R1/P4R1r/2B5/b Rd8xPd3+ Reinfeld.530.1001 8/8/p5p1/1p2p2p/2bp3P/P3k1P1/1KPR1R2/4r3/b Bc4e2 Reinfeld.531.1001 r3r1k1/ppp2pp1/2nb3p/3n1b2/7B/2PN4/PP1NBPPP/R2K3R/b Re8xBe2 Reinfeld.532.1001 3r1r1k/4b1p1/1p5p/2p1Pp2/q1B2P2/4Pb1P/1BR2Q1K/6R1/b Be7h4 Reinfeld.533.1001 2r5/3rkpp1/pn1bpn1p/1p6/1P6/P1N1PB1P/1B1R1PP1/3R1K2/b Nb6c4 Reinfeld.534.1001 r3r1k1/pppq1ppp/8/8/1Q4n1/7P/PPP2PP1/RNB1R1K1/b Qd7d6 Reinfeld.535.1001 2q3k1/5pb1/p5pp/1p6/3rPP2/P7/NP2Q1PP/3R2K1/b Qc8c4 Reinfeld.536.1001 r1b1k2r/pp2npbp/3pp1p1/2p5/1q1nPP2/2NPB1P1/P1PQN1BP/1R2K2R/b Nd4xNe2 Reinfeld.537.1001 r3k1nr/ppp2ppp/8/3Bp3/3nPPb1/2P3P1/PP1PN2q/R1BQKR2/b Nd4c2+ Reinfeld.538.1001 N1br2k1/pp3ppp/2n5/5nq1/4p3/2P1P1P1/PP3K1P/RNQ2B1R/b Rd8d1 Reinfeld.539.1001 2r4k/p3qp2/1pn3rp/5b2/4NQ2/2P1P2P/P5BK/1R3R2/b Rg6xBg2+ Reinfeld.540.1001 r1b1k2r/ppp1bppp/2nq4/8/2B3n1/2p2N1P/PP2QPP1/RNB2RK1/b Nc6d4 Reinfeld.541.1001 r4rk1/5ppp/pq2p3/2b5/3N4/1Q2PPP1/7P/R2R2K1/b Bc5xNd4 Reinfeld.542.1001 r3k1nr/p5b1/2qpp2p/1Q2n1p1/3N1p2/2P5/PP4PP/RNB2RK1/b Ne5f3+ Reinfeld.543.1001 r3k1r1/pp3p1p/4p3/4n3/b1qNP3/4B2P/P4PP1/R1Q3KR/b Qc4xNd4 Reinfeld.544.1001 1br1r1k1/p2q1ppp/1p6/4p3/1PPp1n1n/P2P1PNP/1B1Q3K/3R2NR/b Qd7xPh3+ Reinfeld.545.1001 5rk1/5pp1/2pp4/p1b4q/Pp2P2P/1B2B3/1PP1QPr1/1R3K2/b Rg2g1+ Reinfeld.546.1001 rn1q1r2/4bpk1/p3p3/1pN1N1np/2pP4/4PpBb/PPQ4P/1B1RK1R1/w Ne5c6 Reinfeld.547.1001 6k1/1b1q1p1r/pp1p1Q1p/2pPrP1N/4P3/6P1/PP5P/4RRK1/w Qf6xRe5 Reinfeld.548.1001 3nR3/r1BP1rpk/2p4p/p1p2p2/8/7P/P4PP1/3R2K1/w Re8xNd8 Reinfeld.549.1001 3r1b2/p4bkp/1p1P1p2/r3p1p1/2q1N3/2N2P2/1P1R2PP/2QR3K/w Ne4xPf6 Reinfeld.550.1001 r2qkb1r/1b1n1p1p/p2pp3/1p3N2/8/2N3P1/PPP2P1P/R1BQR1K1/w Re1xPe6+ Reinfeld.551.1001 r1b1kb1r/1p3ppp/p1n3q1/8/3B4/5B2/PPPQ1P1P/2KR3R/w Bd4f6 Reinfeld.552.1001 r3k2r/pp1b1pbn/1qp1n1pp/8/P1Q1PB2/2N3NP/BPP3P1/3R1R1K/w Rd1xBd7 Reinfeld.553.1001 2r2rk1/pbpnqp2/1p2pb2/6p1/3PN1P1/2PB1N2/PPQ2P2/1K1R3R/w Bd3a6 Reinfeld.554.1001 r2r4/1q1n1Qpk/p3Pb2/1p1p1N2/1P1p4/8/P5PP/2R1R1K1/w Re1e5 Reinfeld.555.1001 2q3r1/4Q1p1/p1kP1p1p/2r1p3/Pp6/6P1/1P3P1P/R2R2K1/w Pd6d7 Reinfeld.556.1001 r4rk1/p1pb1qp1/3n1p1R/2pPpN2/2P5/P1PB4/4Q1PP/5RK1/w Nf5e7+ Reinfeld.557.1001 2r2bk1/1p4p1/p3N2p/1q6/4Q3/1P5P/P4PP1/4R1K1/w Ne6g5 Reinfeld.558.1001 2r3rk/3qbppp/8/ppnpPP2/5P2/4BNR1/PP5P/2RQ3K/w Pe5e6 Reinfeld.559.1001 r4rk1/1bn2qnp/3p1B1Q/p2P1pP1/1pp5/5N1P/PPB2P2/2KR3R/w Pg5g6 Reinfeld.560.1001 2r2rk1/pp1b1ppp/1qn1p3/3pP3/3P2n1/2PB1R2/PP1N2PP/R1BQ3K/w Bd3xPh7+ Reinfeld.561.1001 2r2rk1/pp4b1/2nppq2/5b2/2B1pP2/1PN1B3/PP5Q/2K3RR/w Nc3d5 Reinfeld.562.1001 r2q1n1k/1p5p/2p1p1p1/1b6/5BN1/6P1/4r1PK/1RR3Q1/w Rb1xBb5 Reinfeld.563.1001 4b1rk/pnq1P1r1/1p3Qp1/1Pp5/2Pp4/3B2N1/P3RPP1/4R1K1/w Re2e4 Reinfeld.564.1001 2r3kr/ppp2n1p/7B/5q1N/1bp5/2Pp4/PP2RPPP/R2Q2K1/w Re2e8+ Reinfeld.565.1001 1r5r/1bq1bpk1/p1p1pNp1/1p2P1P1/1P1P3N/P2Q4/6P1/3R1RK1/w Nf6d5 Reinfeld.566.1001 2r1nrk1/p4p1p/1p2p1pQ/nPqbRN2/8/P2B4/1BP2PPP/3R2K1/w Nf5e7+ Reinfeld.567.1001 r4rk1/ppp3p1/2bpq3/5pPR/3Qn3/5N2/PPP2PP1/2K4R/w Nf3e5 Reinfeld.568.1001 5r2/5rk1/3p1ppR/p2Np1n1/Pp2P3/5Pq1/1PP1Q3/1K5R/w Pf3f4 Reinfeld.569.1001 6qk/1p2Q2p/pbb3p1/5pN1/1P1p1P2/3P4/P2B2PP/6K1/w Pb4b5 Reinfeld.570.1001 2n2r1k/1r1qb1pp/2p2p2/ppP3P1/5P1N/1P1N4/KP6/2QR1B2/w Nd3e5 Reinfeld.571.1001 r1b2k2/pppq1prp/3p1Qp1/8/2B5/2P5/PPP2PPP/R3R1K1/w Bc4xPf7 Reinfeld.572.1001 r3rbk1/ppqb1pp1/2p3P1/8/2n3P1/2N5/PPP2P2/1KQR3R/w Rh1h8+ Reinfeld.573.1001 r1b4k/ppp2Bb1/6Pp/3pP3/1qnP1p1Q/8/PPP3P1/1K1R3R/w Qh4d8+ Reinfeld.574.1001 rn1qkb1r/pp2pppp/3n4/4NQ2/P1pp4/2N5/1P3PPP/R1B1KB1R/w Bf1xPc4 Reinfeld.575.1001 2kr2nr/ppp2ppp/1b6/1B2q3/8/4BP2/PPQ3PP/3RR2K/w Be3g5 Reinfeld.576.1001 6k1/p4p1p/3p1p2/2p1r3/2PnrqN1/P6P/1P1Q1PP1/3R1RK1/b Nd4e2+ Reinfeld.577.1001 r4rk1/pp1qn3/3p4/b1pPP1p1/8/2N1PpP1/PP1Q1P1K/R1N1R3/b Kg8g7 Reinfeld.578.1001 3rr1k1/2p3pR/1p6/p1nPP3/2P5/2Nq1p2/PP6/2K1Q2R/b Qd3xRh7 Reinfeld.579.1001 2rr1b2/8/ppkq1pP1/3pp3/2p5/2BPPpP1/BQ3P2/1RRN1n1K/b Qd6b8 Reinfeld.580.1001 r3k2r/pp3p1p/2nq4/P3nbp1/1bPpp3/1P4PP/3BPPN1/RN1QKB1R/b Pe4e3 Reinfeld.581.1001 k1q1bbrr/1p3pp1/p7/5n1n/PP2N2p/1NP5/1BB1Q1PP/2R2R1K/b Be8b5 Reinfeld.582.1001 3r3k/p3Qp1p/4p3/1pR4P/3qr3/P5R1/1P3PP1/6K1/w Rc5d5 Reinfeld.583.1001 6k1/6pp/2r1q3/4B3/3pn3/1Q6/6PP/5RK1/w Be5d6 Reinfeld.584.1001 r1k1r3/ppp1np1p/5N2/8/2BQ2bq/3P4/PPP5/5RK1/w Bc4e6+ Reinfeld.585.1001 rn1qr3/pb5p/1p3b1R/5Pp1/2pp2k1/3B4/PP1B2PP/5RK1/w Bd3e4 Reinfeld.586.1001 2r2bnr/3b1k1p/p3pP2/1p2q2p/3NN2Q/8/1PP3PP/2BR1RK1/w Rf1f5 Reinfeld.587.1001 2b1rnk1/r1q2ppp/4pb2/2p1N2Q/2P1B3/1P6/1B3PPP/3R1RK1/w Rd1d7 Reinfeld.588.1001 4rrk1/ppp2p1p/3q1B2/2bpp3/R7/1PPb1Q2/1P1N1PPP/4R1K1/w Nd2e4 Reinfeld.589.1001 r1bq2k1/ppp3rp/2n1P3/2Bp2pQ/5p2/2PB4/P1PP2PP/4RRK1/w Pe6e7 Reinfeld.590.1001 r2k4/pb2np2/1p1p1p1Q/1BP1qPr1/3pPN2/P6R/6PP/R5K1/w Nf4e6+ Reinfeld.591.1001 1rb2rk1/7p/p3p3/2Pp4/3Q1q2/2R5/P1P3BP/K2R4/w Rc3g3+ Reinfeld.592.1001 1rb2rk1/p1p2ppp/2q5/3R4/2P1N3/bP4B1/P1Q2P1P/1K5R/w Bg3d6 Reinfeld.593.1001 2r3r1/3q3p/p6b/Pkp1B3/1p1p1P2/1P1P1Q2/2R3PP/2R3K1/w Be5c7 Reinfeld.594.1001 r4rk1/pq4pp/4P3/3p3Q/2pP1P2/4P2P/PbK5/1N4RR/w Pe6e7 Reinfeld.595.1001 r3rnk1/1p5p/p2P2pn/3q4/P3bR2/3Np1PP/1Q4BK/2R5/w Rc1c7 Reinfeld.596.1001 2r1r2k/1b5p/p2QNq2/3p1P2/3Pp3/8/6RP/6RK/w Ne6f8 Reinfeld.597.1001 r1b1rqk1/5p2/5Pp1/ppp1B1Q1/8/1P1P3R/P5PP/5RK1/w Qg5xPg6+ Reinfeld.598.1001 Q2b1k2/p4p1r/3PnR2/P3P1q1/1p4p1/6Nr/1P5P/5RBK/w Rf6xNe6 Reinfeld.599.1001 1r4r1/1p1b1p1k/pq5b/4pP1R/3NP1P1/6K1/PP1Q2B1/3R4/w Nd4e6 Reinfeld.600.1001 r1r3k1/pb1q1ppp/1p6/P1pp4/3P4/Q1P1PN2/5PPP/RR4K1/w Pa5a6 Reinfeld.601.1001 r6k/1p2RQ1p/3p4/p1q3r1/8/1P4N1/P1b3PP/5R1K/w Ng3f5 Reinfeld.602.1001 5r1k/6p1/pb3pQB/5P2/2P1K3/3P3R/4q1PP/8/w Rh3e3 Reinfeld.603.1001 2b2r2/1pn3pk/r7/p3N3/2Q2p1N/7R/Pq4PP/5R1K/w Qc4e6 Reinfeld.604.1001 4r1k1/pp6/1q4p1/2b1pr2/5BQ1/6P1/PP1R1P1P/3R3K/w Rd2d6 Reinfeld.605.1001 1r5k/2q2p1p/p2p3B/5PQ1/n1p5/2b4P/PrB3P1/2R1R1K1/w Re1e5 Reinfeld.606.1001 8/3k4/R3pp2/1P6/2P5/1r3p2/2K5/8/b Rb3b1 Reinfeld.607.1001 6k1/p4p2/1bp3p1/P2p4/1P4qp/2PQ4/4rPP1/2B2RK1/b Bb6e3 Reinfeld.608.1001 3r3k/p5p1/1p5p/3bpP2/4Bq2/1P5K/P5Q1/6R1/b Pg7g5 Reinfeld.609.1001 3R4/2B5/8/5k2/1b2b3/4K2p/3p4/8/b Bb4d6 Reinfeld.610.1001 r3r1k1/1pp2ppp/p2b4/7q/3P4/1Q4Pb/PP3P1P/RNBR2K1/b Re8e3 Reinfeld.611.1001 r1r3k1/6p1/3Rp2p/1b3p2/3Q4/1P6/3N2qP/1K4R1/b Bb5d3+ Reinfeld.612.1001 r3r1k1/2p5/1pNp2b1/pQ3pq1/2PPp1R1/P1P1P1n1/6P1/3BR1K1/b Ng3e2+ Reinfeld.613.1001 6k1/2q2rp1/3R2n1/p7/1p1B4/1P2P1QP/P2P1PP1/6K1/b Ng6f4 Reinfeld.614.1001 3r1rk1/ppp2ppp/7q/8/2B2n2/2Q4P/PP1N1P1K/3R1R2/b Rd8d3 Reinfeld.615.1001 1br3k1/1p4p1/p3p2r/5pq1/3Nb3/P1B1PpP1/1P1R3P/2R1Q1K1/b Pf3f2+ Reinfeld.616.1001 5rk1/1p4pp/3p4/p1P1n2Q/q2BP3/2P4P/3p2P1/3R2K1/b Ne5f3+ Reinfeld.617.1001 1r4r1/p2kb2p/bq2p3/3p1p2/5P2/2BB3Q/PP4PP/3RKR2/b Rg8g3 Reinfeld.618.1001 2r2rk1/qp3ppp/pR6/4Pp2/5P2/1Q2PB2/PP1b3P/3R2K1/b Rc8c3 Reinfeld.619.1001 r1bqr1k1/1p3pb1/2pp2pp/pP2n2n/2PNP3/2N1BP2/P5PP/R2QRBK1/b Pc6c5 Reinfeld.620.1001 4q1k1/pp5p/6p1/2pBp3/2P3R1/PPQ1P1P1/1B4PK/3r1r2/b Qe8f7 Reinfeld.621.1001 1k6/p2q2pp/1p3p2/2pn4/3P2PP/Q1P2PK1/P3r3/6RR/b Qd7d6+ Reinfeld.622.1001 1r4k1/5r1p/1qPb1Pp1/p1Np2Pn/P3p2P/KP2Q2N/3B1P2/2R5/b Pd5d4 Reinfeld.623.1001 2r3k1/p3qpbp/b5p1/3P4/N3rB2/8/PP1Q2PP/3RR2K/b Rc8c2 Reinfeld.624.1001 6k1/4P1pp/1p1n4/p7/8/1P3PP1/4B1KP/8/w Be2c4+ Reinfeld.625.1001 5r1k/6p1/5pPp/2pBpP1P/p2nP3/q7/3Q4/6RK/w Qd2xPh6+ Reinfeld.626.1001 Rr4k1/1P1n1p2/6p1/3p1N1p/1Pn1p3/6PP/6P1/2R3K1/w Nf5e3 Reinfeld.627.1001 r1b1n2k/1p4pp/p1p5/4r1B1/1b6/1BN5/PP3PPP/R2R3K/w Pf2f4 Reinfeld.628.1001 6k1/p4ppp/Prb5/2QpNq2/5P2/2P1P3/6PP/R5K1/w Qc5xRb6 Reinfeld.629.1001 5k2/p2q2pp/1p1Pr3/3QPp2/1B6/P7/1P4PP/6K1/w Qd5xRe6 Reinfeld.630.1001 8/4Pk1p/6p1/1r6/8/5N2/2B2PPP/b5K1/w Pe7e8=Q+ Reinfeld.631.1001 8/8/2P1kpp1/1R2p3/1b3PP1/4B1K1/8/1r6/w Pf4f5+ Reinfeld.632.1001 2r1k3/ppP1r1pp/3R4/5R2/8/6P1/P4PP1/6K1/w Rd6d8+ Reinfeld.633.1001 6rk/p6p/1pp1P2r/5P2/3RP1n1/8/PP5P/6RK/w Rg1xNg4 Reinfeld.634.1001 4k3/p1P3p1/2q1np1p/3N4/8/1Q3PP1/6KP/8/w Qb3b5 Reinfeld.635.1001 8/1P1R4/1r4kp/p5p1/3p2P1/4PK2/1P3P1P/8/w Rd7d6+ Reinfeld.636.1001 2q3k1/pp2P2p/3p1Q1p/2pP2r1/4P3/6N1/P5PP/7K/w Qf6e6+ Reinfeld.637.1001 2r3k1/1p3p2/pn1P2pp/4p3/6Q1/6B1/1q3PPP/5RK1/w Qg4xRc8+ Reinfeld.638.1001 8/p3k2p/1p2pnPP/5p2/P1PP1N2/5K2/8/8/w Nf4h5 Reinfeld.639.1001 3qr1k1/pp3Rp1/2ppP2p/8/4N3/1B4P1/PP5P/4R1K1/w Rf7f8+ Reinfeld.640.1001 5k2/p1q2p1p/2Pr2p1/4Q3/P7/6P1/5P1P/2R3K1/w Qe5xRd6+ Reinfeld.641.1001 5k2/6b1/2p4p/P1pr4/2Q5/1P4P1/2P4P/7K/w Qc4xRd5 Reinfeld.642.1001 5k2/ppq1r1b1/4P3/3Q2R1/P7/8/1P5P/6RK/w Rg5xBg7 Reinfeld.643.1001 1r1b2k1/pp3ppp/P2P1n2/3p4/8/6P1/1P3PKP/2R1R3/w Rc1c8 Reinfeld.644.1001 3Q4/p3b1k1/2p2rPp/2q5/4B3/P2P4/8/6RK/w Qd8f8+ Reinfeld.645.1001 1k1r4/pP2q3/8/Q7/8/6bP/6P1/2R4K/w Rc1c8+ Reinfeld.646.1001 r3qr2/ppp1ppkP/3p1nb1/6Q1/3P3N/8/PPP1PPP1/R3KB1R/w Ph7h8=Q+ Reinfeld.647.1001 3rk3/P2np2p/2p3p1/8/4N3/1P2P3/5PP1/3R2K1/w Rd1xNd7 Reinfeld.648.1001 8/p1k2p2/5n2/4pP2/1P6/2pB1K2/8/8/b Pe5e4+ Reinfeld.649.1001 r1b1k1nr/ppp2p1p/2nb4/8/Q2N3q/1PP3p1/P2PP1PP/RNBK1B1R/b Qh4xPh2 Reinfeld.650.1001 2r3k1/5pb1/3Qp2p/5p2/5P2/R3N3/1pP1q1PP/1K6/b Rc8xPc2 Reinfeld.651.1001 6k1/p1pp4/1p2p1p1/2P1r1N1/7P/3Q4/PP3pq1/1K3R2/b Qg2xRf1+ Reinfeld.652.1001 7r/7P/8/8/2k3K1/8/1p6/7R/b Rh8xPh7 Reinfeld.653.1001 r1bqkb1r/pppp1p2/2n2P1p/6p1/8/6B1/Pp2QPPP/RN2KBNR/b Qd8e7 Reinfeld.654.1001 r4r1k/4N2p/4n1p1/4Pp2/1p1P1PP1/1q5P/p5R1/3R1QK1/b Qb3xRd1 Reinfeld.655.1001 2kr3r/1b5p/p1q1p1p1/2b1P3/P1p5/1B1p2B1/5PPP/2RR1QK1/b Pc4xBb3 Reinfeld.656.1001 7k/7p/4rN2/p7/2P5/P2n3P/5pRK/1R2r3/b Pf2f1=N+ Reinfeld.657.1001 8/8/2p2k2/5p2/6Pp/2K2B2/1N3PP1/r7/b Ra1a3+ Reinfeld.658.1001 7r/1pR5/6k1/3p4/p3n1np/4P3/PPP3PP/5R1K/b Ne4g3+ Reinfeld.659.1001 2k1r3/1pp5/p2p4/3P1p2/3N2p1/5PPp/PPPK2n1/6R1/b Re8e1 Reinfeld.660.1001 2r4k/3q2bp/4Q3/1pB2p2/1P6/3p4/P4PPP/4R1K1/b Pd3d2 Reinfeld.661.1001 r1b1kb1r/pp1p1ppp/2n3n1/Q3P3/4P3/1p3NB1/P1P2PPP/RN2KB1R/b Pb3b2 Reinfeld.662.1001 5k2/p4pp1/8/4b3/5PP1/3NP3/P1p5/5K2/b Be5b2 Reinfeld.663.1001 2rk4/1b1p3p/pp2p3/5p2/1PPp2rq/P2B2N1/5QpP/3RR1K1/b Qh4xPh2+ Reinfeld.664.1001 5b2/1k6/1p2bB2/5pK1/1p6/p4P2/P6P/2N5/b Be6xPa2 Reinfeld.665.1001 6r1/5k2/8/3pb3/p1p2p2/P1PnpP1P/1P6/2BR1KN1/b Rg8xNg1+ Reinfeld.666.1001 3r3k/3P1ppp/p3q3/1pR1P3/2p5/Q5PP/P4P1K/8/w Rc5c8 Reinfeld.667.1001 1R2rq1k/2p3p1/Q2p1pPp/8/4P3/8/P1r3PP/1R4K1/w Rb8xRe8 Reinfeld.668.1001 r5k1/6pp/4q3/pb1pNp2/1n1P4/1Q2P1P1/1B1n1PBP/R5K1/w Qb3xNb4 Reinfeld.669.1001 7k/p2r1ppp/1pQ2bq1/3B4/4P3/2BR2Pb/PP3P1P/6K1/w Bd5e6 Reinfeld.670.1001 5rkr/1p3ppp/8/p7/4R3/Q7/PPPq2PP/4R2K/w Qa3xRf8+ Reinfeld.671.1001 5r1k/3b2p1/p6p/1pRpR3/1P1P4/P4pPq/5Qn1/1B4K1/w Qf2xPf3 Reinfeld.672.1001 5rk1/6pp/3P4/2Q2p2/6n1/2P5/P1q3PP/R4RK1/w Qc5c4+ Reinfeld.673.1001 4rrk1/1pp1R1pp/p7/q1P5/8/5P2/PPQ4P/5R1K/w Qc2b3+ Reinfeld.674.1001 3R1r1k/6pp/5p2/5B1b/p1p5/q4P2/PrPQ2PP/4R2K/w Qd2c3 Reinfeld.675.1001 6kr/pp4p1/2n5/3qpNNp/2Qp4/2n5/P4PPP/4R1K1/w Re1xPe5 Reinfeld.676.1001 r1b3k1/1p2rppp/3Np3/pB2n3/8/P7/1P3PPP/3R1RK1/w Nd6f5 Reinfeld.677.1001 5r1k/pp5p/2p2n2/5N2/4qP2/2Q5/1PP4K/3R4/w Qc3xNf6+ Reinfeld.678.1001 2r1r1k1/1p1q1ppp/3p1b2/p2P4/2Q5/5N2/PP2RPPP/4R1K1/w Qc4c7 Reinfeld.679.1001 r1b2r1k/ppp3pp/3b4/4Npq1/2B5/8/PPP2PPP/R2QR1K1/w Qd1xBd6 Reinfeld.680.1001 2r3k1/Q4Rpp/p1q1n3/P2pP3/8/1pP5/1P4PP/5R1K/w Rf7xPg7+ Reinfeld.681.1001 Rnk5/1p4pp/1Pp2pq1/2B1r3/1P6/7P/3r2PQ/5RK1/w Ra8xNb8+ Reinfeld.682.1001 5rk1/ppq2ppp/2p5/4bN2/4P3/6Q1/PP3PPP/3R2K1/w Nf5h6+ Reinfeld.683.1001 r3r1k1/3R1ppp/p3p1q1/2p5/2p5/5Q2/PPP3PP/1K1R4/w Qf3xRa8 Reinfeld.684.1001 5r1k/1p4p1/2p4p/8/2QPp3/8/PP3qPP/2R4K/b Pb7b5 Reinfeld.685.1001 3r1b1k/pp4p1/2p1Qp2/5N2/PP2Pp2/2Pq4/5PKP/5R2/b Pf4f3+ Reinfeld.686.1001 5rk1/1pp3bp/3p2p1/2PPp3/1P2P3/2Q1B3/4q1PP/R5K1/b Bg7h6 Reinfeld.687.1001 2r3k1/p3bppp/1p2p3/q2pP3/3P4/1Rr2B2/P1PQ1PPP/2R3K1/b Rc3xPc2 Reinfeld.688.1001 2rr2k1/5pp1/pN2pb2/Q7/1R6/P2q4/5PPP/5RK1/b Rc8c1 Reinfeld.689.1001 1r2r1k1/p2q1pbp/6p1/4n3/5Q2/2N3Pb/PPP2PBP/R1BR2K1/b Qd7xRd1+ Reinfeld.690.1001 r1r3k1/p2qbppp/4b3/3p2P1/1pnP1P2/3Q2N1/PP1B3P/1K1NRR2/b Be6f5 Reinfeld.691.1001 5r1k/ppp3pp/2b1p3/8/2PPP3/P1BQ4/5qPP/4R2K/b Bc6xPe4 Reinfeld.692.1001 8/pQRq2pk/4p2p/3r1p2/3P4/4P3/PP3PPP/6K1/b Rd5c5 Reinfeld.693.1001 6k1/1bp2ppp/p2p1b2/7R/Q1P5/P3q3/1r3NPP/5RK1/b Qe3xNf2+ Reinfeld.694.1001 3r2k1/p4ppp/1q6/8/8/2R1P3/P3QPPP/6K1/b Qb6b2 Reinfeld.695.1001 3r2k1/1p3p1p/3rq1p1/1Q1n4/2R5/4PB2/5PPP/2R3K1/b Nd5xPe3 Reinfeld.696.1001 7Q/1bq1kp2/p3p2p/8/PNp1r3/6P1/1P3P2/3R2K1/b Qc7d6 Reinfeld.697.1001 4k3/8/2pr1Q2/p2qp3/Pp2N3/1P1P4/2P3PP/7K/b Qd5xNe4! Reinfeld.698.1001 3rr1k1/p4p1p/1p2p1pB/2n1q3/2P3Q1/1P6/P1R2PPP/3R2K1/b Qe5e4 Reinfeld.699.1001 3r1rk1/q4ppp/p1Rnp3/8/1p6/1N3P2/PP3QPP/3R2K1/b Nd6e4 Reinfeld.700.1001 5r1k/1p4pp/8/3Pp1R1/1q6/8/PP4PP/2Q4K/b Qb4d2 Reinfeld.701.1001 1r3rk1/3b2p1/3q1nQp/R7/2p1p3/2N4P/PP2R1P1/1B5K/b Nf6g4 Reinfeld.702.1001 r1b1qrk1/2pp1ppp/pb1n1Bn1/1p6/3PPQN1/1BP5/PP3PPP/RN3RK1/w Qf4h6 Reinfeld.703.1001 rn1qr2Q/pbppk1p1/1p2pb2/4N3/3P4/2N5/PPP3PP/R4RK1/w Qh8xPg7+ Reinfeld.704.1001 r1kq1bnr/pp4pp/2nPp3/4N3/2Q2p2/8/PPPP2PP/R1B1KB1R/w Qc4xNc6+ Reinfeld.705.1001 6k1/pp5p/2p3q1/6BP/2nPr1Q1/8/PP3R1K/8/w Bg5h6 Reinfeld.706.1001 r1bqn1rk/1p3pp1/p1nbp2p/2pp3P/5P2/PP1BPN2/1BPP2Q1/2K3RR/w Bd3h7 Reinfeld.707.1001 6rr/ppqb1pkp/2pb1pn1/3p3Q/3P1P1N/3B1RN1/PPP3PP/5RK1/w Qh5h6+ Reinfeld.708.1001 r4rk1/p1R2ppp/1p1bp3/3qB3/3PR3/5Q1P/PP3PP1/6K1/w Rc7d7 Reinfeld.709.1001 4r1k1/p1qr1p2/2pb1BP1/1p5p/3P1n1R/1B3P2/PP3PK1/2Q4R/w Qc1xNf4 Reinfeld.710.1001 2k4r/1pp1q1p1/2n1b3/1Q3p1p/2Pr2n1/6P1/3NPPBP/R4RK1/w Qb5xPb7+ Reinfeld.711.1001 6k1/1q4p1/1b1p1nP1/3Pp2Q/1pr1B3/1p6/1P6/2B2R1K/w Qh5h7+ Reinfeld.712.1001 r3bk1r/1pp2p2/p1p1qNn1/4P1Q1/8/8/PPP2PP1/R1BR2K1/w Qg5h6+ Reinfeld.713.1001 3rrnk1/pp3ppp/q2b4/3R4/4Q1NP/2B5/PP3PP1/4R1K1/w Rd5g5 Reinfeld.714.1001 2kr3r/pp3pp1/2n5/2P4p/Q1B2Bn1/1NP2pPq/P4PbP/3RR1K1/w Qa4xNc6+ Reinfeld.715.1001 r1b1k1nr/pp1q1pbp/2pp4/3NP1B1/2Bn4/3P4/PPP2QPP/R4RK1/w Nd5c7+ Reinfeld.716.1001 r2r3k/p5pp/4R3/2q2p1Q/1nBR4/4P3/1P3PPP/6K1/w Qh5xPh7+ Reinfeld.717.1001 rnbk1b1r/ppqpnQ1p/4p1p1/2p1N1B1/4N3/8/PPP2PPP/R3KB1R/w Qf7e8+ Reinfeld.718.1001 b1r3k1/7p/p3R1qB/1pPr2p1/3b2N1/5P2/PQ4P1/3R2K1/w Qb2xBd4 Reinfeld.719.1001 r2q4/3rk3/1pRp3p/1P1PpRpP/p3P1P1/PpQ5/8/1K6/w Qc3xPe5+ Reinfeld.720.1001 r3r2k/p1q3pp/2p3n1/1p2Pp2/5P2/1BP3Q1/P5PP/R4R1K/w Qg3xNg6 Reinfeld.721.1001 q1r1rkn1/pb2b2p/1p1p2p1/2nP1N2/2P5/1P1BQ3/PB3PPP/2R1R1K1/w Bb2g7+ Reinfeld.722.1001 r6r/1Rp3n1/3k1pq1/3Pp1pp/4P1P1/2B1QP1P/7R/1b4K1/w Qe3b6+ Reinfeld.723.1001 2b5/p3b3/q1p1ppk1/2p3Pp/2P2P1P/1P1NB1K1/P3Q3/8/w Pf4f5+ Reinfeld.724.1001 2Q2n2/2R4p/1p1qpp1k/8/3P3P/3B2P1/5PK1/r7/w Qc8xNf8+ Reinfeld.725.1001 r1b1qN1k/1pp3p1/p2p3n/4p1B1/8/1BP4Q/PP3KPP/8/w Qh3xNh6+ Reinfeld.726.1001 r3nrk1/pp3p1p/2b1pBpQ/q1p1P3/6P1/3BP1R1/P3KP1P/q7/w Qh6xPh7+ Reinfeld.727.1001 2r3k1/pr2qp1p/n3p1p1/B1n1N3/5P2/P3P3/4Q1PP/2RR2K1/w Qe2xNa6 Reinfeld.728.1001 rn4kr/ppq1pp1p/5bpB/5R2/2B5/8/PPP3PP/R2Q3K/w Qd1d5 Reinfeld.729.1001 1k5r/Npn2p2/1N1p4/R1pPp3/4P1q1/1P2Pb2/1PPK4/5Q2/w Qf1xBf3 Reinfeld.730.1001 r3qb1r/pppbk1p1/2np2np/4p2Q/2BPP3/2P5/PP3PPP/RNB2RK1/w Qh5g5+ Reinfeld.731.1001 2kr3r/R1p3p1/2bp1pq1/2p3np/4PB2/3PQ2P/1P4BK/5R2/w Qe3xPc5 Reinfeld.732.1001 b2qr1k1/5ppp/pn6/1p1n1N2/3PR3/P2B4/1B3PPP/2Q3K1/w Qc1g5 Reinfeld.733.1001 r3kb1r/p1q1pppp/2n2n2/1p6/1PN3b1/P3PN2/1B3PPP/R2QKB1R/w Nc4e5 Reinfeld.734.1001 r1b2rk1/pp1n1ppp/4p3/q2N2b1/1p1P3P/4PN2/P1Q2PP1/R3KB1R/w Qc2xPh7+ Reinfeld.735.1001 3qrbk1/ppp1r2n/3pP2p/3P4/2P4P/1P3Q2/PB6/R4R1K/w Qf3f7+ Reinfeld.736.1001 r5rk/q1pb3p/1p1p1PpQ/2nPp3/2P1P3/2N2P2/Pp6/1K1R1BR1/w Qh6xPh7+ Reinfeld.737.1001 r1b2r2/3pNpkp/3pn1p1/2pN3P/2PnP3/q3QP2/4BKP1/1R5R/w Qe3h6+ Reinfeld.738.1001 2rqnrk1/pp3ppp/1b1p4/3p2Q1/2n1P3/3B1P2/PB3P1P/R5RK/w Qg5xPg7+ Reinfeld.739.1001 rn1q1r1k/p2pNppp/bp1Q4/2p1PN2/2B5/P1R5/5PPP/5RK1/w Qd6g6 Reinfeld.740.1001 r3k1nr/pp1n2pp/1bp1N1q1/6B1/2B1p3/8/PPP2RPP/R2Q3K/w Qd1xNd7+ Reinfeld.741.1001 rn4nr/pppq2bk/7p/5b1P/4NBQ1/3B4/PPP3P1/R3K2R/w Qg4g6+ Reinfeld.742.1001 rn3rk1/pbppq1pp/1p2pb2/4N2Q/3PN3/3B4/PPP2PPP/R3K2R/w Qh5xPh7+ Reinfeld.743.1001 r2r2k1/ppp1q1n1/3p2p1/3P1pP1/3Q1P1R/6N1/PPP5/2K4R/w Rh4h8+ Reinfeld.744.1001 2b2r2/rpp2pkp/3pq3/2pR2P1/2n1P1N1/2P2B2/1P3Q1P/1K5R/b Qe6xRd5 Reinfeld.745.1001 3r2k1/p3R1p1/1pq2pQp/8/8/1P4P1/PB3P1P/3b2K1/b Qc6h1+ Reinfeld.746.1001 1k1r1b1r/Rpp2ppp/4b3/1q2N3/5Q2/1PN5/2nP1PPP/2BKR3/b Be6xPb3 Reinfeld.747.1001 3r3k/Q5pp/4Nq1n/3B1p2/5P2/4B3/Pr2n1PP/3R1K2/b Qf6xNe6 Reinfeld.748.1001 7Q/2p1k1pp/1b1p1n2/pP2p2q/P1B1Pn2/B1P2bP1/R2N1P1P/4R1K1/b Qh5xPh2+ Reinfeld.749.1001 4r1k1/p1pb1ppp/Qbp1r3/8/1P6/2Pq1B2/R2P1PPP/2B2RK1/b Qd3xBf3 Reinfeld.750.1001 r4rk1/ppp2pp1/7p/3P4/2P1Nnq1/5bB1/PPP2PPP/RN2QRK1/b Qg4h3 Reinfeld.751.1001 4R3/4q1kp/6p1/1Q3b2/1P1b1P2/6KP/8/8/b Qe7h4+ Reinfeld.752.1001 7k/1p4pp/P7/2b5/P4n1N/1Q3P1q/R4P1P/4r1RK/b Qh3f1 Reinfeld.753.1001 5rk1/1p2ppbp/p2pb1p1/q7/P1rBPPn1/5B2/1PP1N1PP/R2QR1K1/b Rc4xBd4 Reinfeld.754.1001 r3k2r/2p2p2/p2p1n2/1p2p3/4P2p/1PPPPp1q/1P5P/R1N2QRK/b Nf6g4 Reinfeld.755.1001 5rk1/pp4pp/4p3/2R3Q1/3n4/2q4r/P1P2PPP/5RK1/b Qc3g3 Reinfeld.756.1001 R7/P3k3/8/8/8/8/7K/r7/w Ra8h8 Reinfeld.757.1001 r5k1/p7/4Nnp1/3q4/8/4Q2R/PP2KP1P/8/w Rh3h8+ Reinfeld.758.1001 r2q1r2/1ppk1pQp/p2pb3/1P2n3/P7/2P5/4RPPP/1NB1R2K/w Re2xNe5 Reinfeld.759.1001 3r3r/pRn2k1B/2p5/4q3/2p3Q1/4B3/P1P4P/7K/w Qg4g6+ Reinfeld.760.1001 r1bq1rk1/pp1n2bp/3n2p1/3Npp2/2P5/1P2P1P1/P3N1BP/R1BQ1RK1/w Bc1a3 Reinfeld.761.1001 8/k5r1/8/2KB4/8/8/8/1R6/w Rb1a1+ Reinfeld.762.1001 3q2Q1/r2k4/1ppr1p1B/p2ppP2/P3P3/1BPP4/1P3PK1/7R/w Qg8h7+ Reinfeld.763.1001 3Q4/5knp/1nN3p1/2p5/5P2/1q6/1P4PP/6K1/w Nc6e5+ Reinfeld.764.1001 1n2k2r/rp4pp/pN3p2/2n1p3/4P3/N7/PP2KPPP/R6R/w Ra1c1 Reinfeld.765.1001 8/b6Q/p3kpn1/1p1q1b2/3PpP2/1P2P3/PB5P/5BK1/w Qh7g8+ Reinfeld.766.1001 1R1Rbrk1/p5pp/2pQ4/2P1p3/5q2/8/P4PPP/6K1/w Qd6xRf8+ Reinfeld.767.1001 rn3rk1/pbp1qppp/1p2pn2/3p4/1bPP1B2/5NP1/PP2PPBP/RN1Q1RK1/w Pc4c5 Reinfeld.768.1001 3R4/3R3p/5p1k/6n1/8/1P2QPPq/r7/6K1/w Rd7xPh7+ Reinfeld.769.1001 r2rbb1Q/3q1k2/6pp/np1p4/8/P3P3/1B3PPP/1BR2RK1/w Rc1c7 Reinfeld.770.1001 3rr1k1/pp1q1pp1/2b3np/4P3/3B1P2/1P2N1Pn/P1R3BP/Q1R4K/w Rc2xBc6 Reinfeld.771.1001 r4r2/pp2Q3/5p1p/6k1/7R/8/PPq2PPP/R5K1/w Qe7g7+ Reinfeld.772.1001 r1b1k2r/2q2ppp/p1n1pn2/1pb5/3N4/2N1P3/PP2BPPP/R1BQ1RK1/w Nd4xNc6 Reinfeld.773.1001 8/8/2Q4p/5p1k/P7/5PP1/b6K/q7/w Qc6e8+ Reinfeld.774.1001 3rq2r/2pbn1k1/1p3p2/p1b1p1pp/P1N1P3/1PPB2P1/2N1QPP1/3R1RK1/b Bd7g4 Reinfeld.775.1001 1k1r3r/1pp3p1/p3R3/7p/1b6/8/PP3PPP/R1Bq1QK1/b Qd1xQf1+ Reinfeld.776.1001 r1bqk2r/1pp2ppp/pb1p4/4n3/PPB1P3/2P5/R3QPPP/1NB1R1K1/b Ne5xBc4 Reinfeld.777.1001 2k1r3/2p4p/5b2/1NpK4/4p1bN/1P4P1/P4P2/7R/b Re8e5+ Reinfeld.778.1001 1r4k1/prp1ppbp/2b2np1/3P4/2p2B2/2N1PN1P/PP1R1PP1/2K4R/b Nf6xPd5 Reinfeld.779.1001 r4rk1/1bp3pp/4p3/1p1q4/p2P4/P5P1/1PPQR1NP/2KR4/b Qd5a2 Reinfeld.780.1001 1k6/1Pb5/K1P4p/B5p1/6P1/5p1P/4p3/8/w Ba5b6 Reinfeld.781.1001 2r2rk1/pp1q1ppp/3bpn2/3p1P2/1P1Q4/P1N1P3/1BP2P1P/R3K2R/w Nc3xPd5 Reinfeld.782.1001 8/2R4p/6pk/2R2b2/8/5KP1/7r/8/w Pg3g4 Reinfeld.783.1001 r3k2r/ppp2ppp/1bn1b1q1/6NN/2pp4/8/PPP2PPP/R1BQR1K1/w Ng5xBe6 Reinfeld.784.1001 r1bq1b1r/pppp2kp/2N2np1/3Q4/8/8/PPP2PPP/RNB1K2R/w Bc1h6+ Reinfeld.785.1001 r1b3kb/2qnrp1p/1ppNn1pB/2P1P3/1P6/2N3PP/3Q1PB1/3RR1K1/w Bg2xPc6 Reinfeld.786.1001 8/kp6/4R3/1P2K3/8/3pp3/8/8/w Ke5d6 Reinfeld.787.1001 2k1r3/2p2pp1/1n6/N1q3Pp/Pn6/4B3/4QP1P/1K1R4/w Rd1d8+ Reinfeld.788.1001 2k4r/pppr2pp/8/3q4/N4n2/Q1R4P/PP3PP1/5RK1/w Na4b6+ Reinfeld.789.1001 5r2/q3ppkp/3p2p1/3P4/Nr2PPn1/1R3BP1/P3N2P/R2Q2K1/w Na4b6 Reinfeld.790.1001 r1b1qrk1/ppp2ppp/2np3n/2b1pPNQ/2B1P3/2NP4/PPP3P1/R1B2K1R/w Ng5xPh7 Reinfeld.791.1001 r5r1/pppn1p1k/3p1p1p/3PpP1P/q3P3/P1PB4/2PQ1P2/2K3RR/w Rg1g6 Reinfeld.792.1001 r1b1r1k1/pp3pbp/2p3p1/q2n4/3N4/1P2PB2/PBQ2PPP/3R1RK1/w Nd4xPc6 Reinfeld.793.1001 r2qr1k1/pb1nb1pp/1p2pn2/2p1Np2/2PP1B2/3B1N2/PP2QPPP/R4RK1/w Ne5f7 Reinfeld.794.1001 4r1rk/pp1qppbp/3p4/3nnPB1/R3P2R/1P6/1PP1B2P/3Q3K/w Be2b5 Reinfeld.795.1001 rn1r1k2/ppp1ppbQ/3qb1p1/4N3/3P2P1/2N1P3/PP3P2/R1B1K2R/w Pe3e4 Reinfeld.796.1001 r1bqr1k1/pppnbppp/2np4/8/2BNP3/2N4P/PPP2PP1/R1BQR1K1/w Bc4xPf7+ Reinfeld.797.1001 6k1/6p1/p3br2/1p1pQ3/5r2/1P1B2R1/1P3qPP/2R4K/w Rc1c8+ Reinfeld.798.1001 r1b1k3/1pq2pQ1/p3p1p1/4n3/3NN1pr/8/PPP5/2KR1R2/w Nd4b5 Reinfeld.799.1001 2r5/1R2pk2/3pN1p1/3Pp1Pp/4P3/rR6/5PKP/2b5/w Rb7c7 Reinfeld.800.1001 r2q1r2/pp1n1pk1/2pb1pp1/8/2BP2Pp/5Q2/PPP2PK1/R1B4R/w Bc1h6+ Reinfeld.801.1001 rk5r/ppp1bq1p/2n5/2N3B1/6Q1/8/PPP2PPP/R5K1/w Nc5d7+ Reinfeld.802.1001 rnb1rqk1/pp3ppp/1n6/2p1pN2/2PPP3/2PB4/P4QPP/R1B2RK1/w Nf5h6+ Reinfeld.803.1001 r6r/pp3Bb1/2n1PkNp/1qpP4/5Bp1/2P3Nb/PP3K1P/R7/w Kf2e3 Reinfeld.804.1001 5rk1/Q4p2/1Rr1p1b1/2P4p/3P1qn1/P5pP/3R2P1/2B2BK1/b Bg6d3 Reinfeld.805.1001 8/8/pQ2pppk/2p5/5P2/KPn5/2P2P2/1r6/b Nc3a4 Reinfeld.806.1001 3rr2k/p5p1/1p1bpq1p/1Q6/2R5/1P4N1/P5PP/5R1K/b Bd6xNg3 Reinfeld.807.1001 4r1k1/pb3pbp/6p1/q2p4/N2NnPn1/1P1Q2P1/PB5P/2R2BK1/b Bb7a6 Reinfeld.808.1001 2r4r/kp6/p7/3P4/2R5/1P2p3/P4PP1/4R1K1/b Rh8h1+ Reinfeld.809.1001 2r1r1k1/p2n1p1p/5pp1/qQ1P1b2/N7/5N2/PP3RPP/3K1B1R/b Rc8c1+ Reinfeld.810.1001 r2qk2r/ppp2pp1/2np1n2/2b1p1B1/2B1P3/3P1Np1/PPP2PP1/RN1Q1RK1/b Nf6g4 Reinfeld.811.1001 7Q/p1pk1ppp/5n2/3pq3/3n4/2NP2P1/PPPKbP1P/R6R/b Nd4f3+ Reinfeld.812.1001 8/p1pk2Bp/8/1p3R2/4r2p/KP1n2P1/P1b4P/5R2/b Re4a4+ Reinfeld.813.1001 r1b1qrk1/pppnb1pp/4p3/2PpNp2/3PnP2/6P1/PP1NP1BP/R1BQ1RK1/b Nd7xPc5 Reinfeld.814.1001 1k1r3r/1Pp2ppp/8/1Bb2bn1/3P1pq1/2P2N2/PP4PP/R1BQ2KR/b Rd8xPd4 Reinfeld.815.1001 5rk1/p2p2bp/1pq1p1p1/8/2P2Bn1/1PNQ2P1/P4P1P/3R2K1/b Pg6g5 Reinfeld.816.1001 6k1/1R3p2/p1p5/2P3b1/1P2P1p1/5p1p/5P2/6K1/b Bg5e3 Reinfeld.817.1001 5rk1/pb3pp1/5n1p/1p2n3/1P1qp3/2N5/P2PQPPP/R1B2RK1/b Ne5f3+ Reinfeld.818.1001 2rr2k1/5pp1/p3p2p/3b4/P2RPB2/5P2/1p3KPP/3R4/b Pe6e5 Reinfeld.819.1001 1k1r1b1r/p1p1q3/2p1p3/4Ppp1/4nP2/P2BQ3/1PP3PB/2KR3R/b Rh8xBh2 Reinfeld.820.1001 7k/2p1b1pp/8/1p2P3/1P3r2/2P3Q1/1P5P/R4qBK/b Qf1xRa1 Reinfeld.821.1001 1r3b1k/p4rpp/4pp2/3q4/2ppbPPQ/6RK/PP5P/2B1NR2/b Pg7g5 Reinfeld.822.1001 rn3rk1/ppq3pp/2pb1p2/4N3/3PR3/6Q1/PPP2PPP/R1B3K1/w Qg3b3+ Reinfeld.823.1001 rnb1kb1r/pp3p2/2p4p/7q/3PN2P/1B4p1/PPP2KP1/R1BQN2R/w Kf2e3 Reinfeld.824.1001 6k1/p4p1p/2p2npQ/q1n1pP2/1pBrP3/8/PPP3P1/1NK4R/w Pf5xPg6 Reinfeld.825.1001 1kr4b/p1p5/p1B5/6nP/8/1P6/K1Q5/5qNR/w Ng1f3 Reinfeld.826.1001 2kr4/pppb1p1p/2n1ppr1/3P4/2PN4/6Pq/P1P1BP1P/R2Q1RK1/w Pd5xNc6 Reinfeld.827.1001 Q7/7p/1R4p1/3P4/4Pp1P/1b3P1K/3k1q2/2R5/w Qa8a2+ Reinfeld.828.1001 2rq1r1k/3b1pp1/p3pb1p/1p6/1PN1B3/4PN2/2Q2PPP/3R1RK1/w Rd1xBd7 Reinfeld.829.1001 1nkr4/1pp2p1R/1P6/2b3P1/3q1P2/8/1P2Q3/R1B2K2/w Bc1e3 Reinfeld.830.1001 6k1/5pb1/1p1N3p/p5p1/5q2/Q6P/PPr5/3RR2K/w Re1e8+ Reinfeld.831.1001 r7/b1q1kPp1/p2p3p/1p1P4/2NR2P1/PPQ2P2/6K1/8/w Rd4e4+ Reinfeld.832.1001 1r3r2/p5kp/3p1pp1/qnp1pP2/1p2P2N/3P4/PPPQ1P1P/1K1R2R1/w Pf5xPg6 Reinfeld.833.1001 k7/2p1rp1P/KpP2R2/7r/1P6/8/8/8/w Rf6h6 Reinfeld.834.1001 1k6/1p2p3/3p4/Qp1P1p2/2P2Pp1/P3Rn2/KP1q4/6r1/w Qa5d8+ Reinfeld.835.1001 8/kp6/p7/P4Q2/6pp/4q3/8/7K/w Qf5f2 Reinfeld.836.1001 7Q/3b1Np1/4p1kp/p1ppP3/8/P7/1rq3PP/5RK1/w Rf1f6+ Reinfeld.837.1001 1rb1r1k1/2q1pp1p/p2p2pB/2pP4/1pP2Q2/1P1n4/P4PPP/2R1R1K1/w Qf4f6 Reinfeld.838.1001 Q7/5p1k/5qp1/7p/4Q3/2r3NK/6PP/4q3/w Qa8g8+ Reinfeld.839.1001< k5r1/p5Qp/8/3q4/8/8/P4NPP/1R4K1/w Rb1b5 Reinfeld.840.1001 7k/6p1/3R3p/1PpQ4/2P1Rr1q/1P1PKP2/1B6/8/b Qh4e1+ Reinfeld.841.1001 3rk2r/1p1b1pp1/p1n5/2RQP1Bp/1P6/8/1P2qPPP/3R2K1/b Qe2xRd1+ Reinfeld.842.1001 4rrk1/ppp2ppp/2nb3q/3N3b/2BP4/P2QpN1P/1PP3P1/4RRK1/b Pe3e2 Reinfeld.843.1001 r4rk1/5p2/4p1p1/1pqpP1NP/1pn2P2/7Q/PPP4P/1K1RR3/b Ra8xPa2 Reinfeld.844.1001 5rk1/pb3ppp/3qp3/1p1n4/3PB1nQ/6P1/P1r2P1P/R1B2RK1/b Nd5f6 Reinfeld.845.1001 4qk2/8/Q4P2/1p2p3/1P2P2B/P2r3P/5P1K/8/b Rd3xPh3+ Reinfeld.846.1001 r1b2rk1/pp3pp1/2p2nnp/8/4P3/P1N2NP1/1q2BPP1/R2Q1RK1/w Nc3a4 Reinfeld.847.1001 r3kb1r/pp1n1pp1/2p1pn2/6Bp/3P3P/2PQ2N1/PP2NPq1/R3K2R/w Ne2f4 Reinfeld.848.1001 5bk1/3b1r2/2pp1p2/1p3Pp1/1PqNP1N1/2PR2Q1/r5PP/3R3K/w Ng4e3 Reinfeld.849.1001 r1b1r1k1/1p1n1p1p/2ppnqp1/8/p1P1P3/5P2/PbNQNBPP/1R2RBK1/w Rb1xBb2 Reinfeld.850.1001 r1b1rnk1/1p4pp/p1p2p2/3pN2n/3P1PPq/2NBPR1P/PPQ5/2R3K1/w Bd3xPh7+ Reinfeld.851.1001 rn2kb1r/pp3ppp/2b1pq2/8/3P4/3B1N2/PP3PPP/R1BQK2R/w Bc1g5 Reinfeld.852.1001 2k1r3/ppp5/6n1/1q1p3p/3Prp2/P1P2QnP/1P1B1RP1/K2N2R1/b Ng6h4 Reinfeld.853.1001 r1bqk2r/2p1bppp/p2p1n2/1p6/3QP3/1B6/PPP2PPP/RNB1R1K1/b Pc7c5 Reinfeld.854.1001 r2qk3/p2n1p1p/1p2pnr1/2p5/3PpQ2/P1P1B1P1/2P1KPBP/R6R/b Nf6d5 Reinfeld.855.1001 r1bb1rk1/ppp3pp/2np1n2/4p2q/2P1Pp2/1PNP1NP1/PB1Q1PBP/4RR1K/b Bc8g4 Reinfeld.856.1001 5rk1/2pq1rbp/ppn1bpp1/4p3/4P1NB/1P1PN2P/1PP2RP1/4QRK1/b Pg6g5 Reinfeld.857.1001 r2qk2r/pbpn1ppp/1p1ppb2/8/2PP1B2/P3PN2/1P1QBPPP/R3K2R/b Pg7g5 Reinfeld.858.1001 1rb2k2/4n3/pp1Np1p1/4Pp1p/1P3P2/2R2B2/P4KPP/8/w Rc3c7 Reinfeld.859.1001 2rk4/p1rqn1p1/P1n1p2p/3pPp2/BP1P1P2/2R2N2/2R3PP/2Q3K1/w Ph2h4 Reinfeld.860.1001 7k/5R1p/3p3q/pp1Pp3/4P2P/1PP3RK/1P6/8/w Rg3g5 Reinfeld.861.1001 8/7Q/6p1/7p/6qk/8/7K/8/w Qh7e7+ Reinfeld.862.1001 8/1p3pkp/p2r1rp1/8/8/2B5/PP5P/5RK1/w Rf1xRf6 Reinfeld.863.1001 8/8/8/6pp/6pk/1R6/6KP/8/w Rb3h3+ Reinfeld.864.1001 8/5p2/4p1kp/3pP3/3P1K2/b4NPP/8/8/b Ba3c1+ Reinfeld.865.1001 8/6pp/1p1k4/1P2p3/2K3P1/5P2/8/2b2N2/b Bc1f4 Reinfeld.866.1001 8/8/3p4/3P2p1/3kBp2/5P1b/3r3P/6RK/b Kd4e3 Reinfeld.867.1001 4r3/1kp5/1pb5/p2q1PB1/P1pP3p/2P4P/3Q3K/5R2/b Re8g8 Reinfeld.868.1001 2b3k1/8/2p5/2Pp2p1/3P1bP1/P1P1p2K/2q1B3/4R2Q/b Bc8a6 Reinfeld.869.1001 6k1/3q2pp/p2bp3/3p1r2/1p1Pp3/3bQ1PP/PP1B1rB1/1N2R1RK/b Ph7h6 Reinfeld.870.1001 1n5r/R5pp/2rNpp2/2k5/8/4P3/1P2P1KP/3R4/w Pb2b4+ Reinfeld.871.1001 3rkb1r/pp3p1p/1q4p1/4nN2/4N3/8/PP2QPPP/R4RK1/w Qe2b5+ Reinfeld.872.1001 r4b1r/ppp3pp/4Q3/4p3/2Pqk3/8/PP1P1PPP/2B1K2R/w Qe6g4+ Reinfeld.873.1001 r3k2r/pppqnppp/3p4/3P1bN1/2B1R3/5Q2/PP3PPP/R5K1/w Bc4b5 Reinfeld.874.1001 rnb3kr/1p1nqppp/p3p3/2ppP3/3P1N2/2NB1Q2/PPP2PP1/R3K2R/w Bd3xPh7+ Reinfeld.875.1001 3q4/p2nbk1p/2R1p1pB/1p1rPp2/8/5N1P/PPQ2PP1/7K/w Rc6xPe6 Reinfeld.876.1001 1r5r/4kp1p/pq3pn1/b2B3Q/1p2P3/2PP4/PP4PP/R1B2R1K/w Rf1xPf6 Reinfeld.877.1001 6rr/1pp1k3/3p2p1/3P4/2P1PRQN/2q5/2n1K3/7R/w Rf4f7+ Reinfeld.878.1001 qn1kr2r/1pRbb3/pP5p/P2pP1pP/3N1pQ1/3B4/3B1PP1/R5K1/w Qg4xBd7+ Reinfeld.879.1001 2r4r/1pq1kpp1/p3pn1p/8/2P2bPP/2B5/PPB1Q3/1K1R1R2/w Rf1xBf4 Reinfeld.880.1001 r1bqk2r/pppn1pp1/5n1p/2B5/2B1p3/2N5/PPP1Q1PP/R4RK1/w Qe2xPe4+ Reinfeld.881.1001 r6r/pp2kp2/1qpbpppQ/8/3N4/3R3P/PPP2PP1/4R1K1/w Re1xPe6+ Reinfeld.882.1001 8/p5Q1/2ppq2p/3n1ppk/3B4/2P2P1P/P5P1/6K1/w Pg2g4+ Reinfeld.883.1001 3r3r/p2k2pp/2p1bp2/q7/4B3/B7/PQ3PPP/1R4K1/w Be4xPc6+ Reinfeld.884.1001 4bk1r/rQ3p1q/p4p2/3P1p1p/2Pb3N/6P1/PP4BP/R3R2K/w Re1xBe8+ Reinfeld.885.1001 r2qk1r1/pp2bpp1/2p1p1bp/8/2BP1B1P/6R1/PPP1QPP1/2KR4/w Rg3xBg6 Reinfeld.886.1001 r2q3r/pp1nbkpp/4p3/3p3P/b1p2B2/2P2N1R/PP1RQPP1/1BK5/w Bb1g6+ Reinfeld.887.1001 r3kb1r/1bq1nppp/p7/1pp5/4Q3/1B3N2/PP3PPP/R1BR2K1/w Bb3xPf7+ Reinfeld.888.1001 r3kb1r/p1p1p1pp/qp1p4/n2PN1B1/4Q3/8/PPP3PP/R3K2R/w Ne5f7 Reinfeld.889.1001 rnb1qknr/ppp1b2p/8/5p1Q/2BPP3/7p/PPP3PP/RNB1K2R/w Qh5h6+ Reinfeld.890.1001 rnbq2nr/ppp3pp/3p4/8/4P1Q1/2N1k1b1/PPP4p/R4R1K/w Ra1d1 Reinfeld.891.1001 rq2kb1r/1b1n1ppp/p1n5/1p1Np3/4P3/1B1RBN2/PP2QPPP/R5K1/w Nf3g5 Reinfeld.892.1001 r1bq1b1r/pppknBp1/2np4/4pPNp/6Q1/8/PPPP1PPP/RNB2RK1/w Pf5f6+ Reinfeld.893.1001 disch 2r1kr2/2qnbp1R/2p1p3/1pP1N1p1/p2PQ3/P7/1P1B1P2/2KR4/w Ne5xPf7 Reinfeld.894.1001 rn2k2r/pp1b1ppp/q3pB2/8/3NP3/8/P4PPP/2RQ2KR/w Nd4xPe6 Reinfeld.895.1001 r1b1k2r/2qn1p1p/1p2p1p1/p3P1B1/2pP2Q1/2P5/PPB3PP/R4RK1/w Rf1xPf7 Reinfeld.896.1001 rnbq2kr/ppp3pp/4P2n/3p2NQ/4p3/B1P5/P1P2PPP/R3KB1R/w Qh5f7+ Reinfeld.897.1001 2rn1knr/pp4p1/2q4p/2bN1pN1/5B2/1Q6/PP4PP/3RR2K/w Nd5e7 Reinfeld.898.1001 4r3/5r1p/R1p2pp1/1p1bk3/4pNPP/2P1K3/2P2P2/3R4/w Rd1xBd5+ Reinfeld.899.1001 r1k1q3/pp1b2R1/5Q2/3NPp2/3P1p2/5P2/PP5P/2K5/w Qf6d6 Reinfeld.900.1001 1r4k1/p4ppp/8/1B6/3rP2K/8/PPP3q1/R1BQ1R2/b Rb8xBb5 Reinfeld.901.1001 N1b2rk1/pp3ppp/8/8/1P6/Kn1pQ3/P1q2PPP/3R3R/b Nb3a5 Reinfeld.902.1001 3rr1k1/pp3ppp/6q1/2b2b2/5P2/3P1Q1P/PPPB2P1/R2K2NR/b Bf5xPd3 Reinfeld.903.1001 7r/ppNkn1pp/2n1p3/8/1b3B2/8/PPb1KPPP/R4B1R/b Nc6d4+ Reinfeld.904.1001 r3kbnr/ppp3pp/2n1P3/4p3/2Ppq3/P4N2/1P1K2PP/RNBQ1B1R/b Bf8b4+ Reinfeld.905.1001 K7/P1k3p1/7p/2n1p3/3nP3/4B1PP/8/3B4/b Nc5d7 Reinfeld.906.1001 3r1rk1/p1q2ppp/3bb3/3pB3/1p6/2P2Q1P/PPB2PP1/3RR1K1/w Bc2xPh7+ Reinfeld.907.1001 r1bqnrk1/pp2bp1p/2p3p1/3pR2Q/8/1PNB4/PBPP1PPP/R5K1/w Nc3xPd5 Reinfeld.908.1001 5k2/5r2/1p3bRp/2p1p3/p1P1Pp1q/3N1P2/PP6/1K4Q1/w Nd3xPc5 Reinfeld.909.1001 2rq4/1p2pk2/p1rp1ppQ/3Nn3/4P3/7R/PPP3PP/5R1K/w Rf1xPf6+ Reinfeld.910.1001 r1b1r1k1/pppqnpbp/3p4/3N2B1/4B3/2P5/PP4PP/R2Q1RK1/w Be4xPh7+ Reinfeld.911.1001 r2q1rk1/1b2bp2/ppn1p1p1/3P2Np/2P4Q/P2B4/1B3PPP/R4RK1/w Qh4xPh5 Reinfeld.912.1001 r5k1/1ppq1pb1/p2p1n1p/3P2p1/7Q/1P1B2RP/PBP2PP1/6K1/w Bb2xNf6 Reinfeld.913.1001 2r2r2/3qbpkp/p3n1p1/2ppP3/6Q1/1P1B3R/PBP3PP/5R1K/w Rh3xPh7+ Reinfeld.914.1001 2rnr1k1/ppq2p1p/5Qp1/2N5/4b3/2P1B1b1/PP2B1P1/3R1R1K/w Be3h6 Reinfeld.915.1001 1q1r1r1k/p1nbbpp1/1p3n1p/2p5/4NP2/PPNPPB1P/1B2Q3/2R3RK/w Rg1xPg7 Reinfeld.916.1001 r2b1rk1/2q2p1p/p3b2Q/1pn3B1/4Pp2/P1NB4/1PP3PP/R6K/w Bg5f6 Reinfeld.917.1001 r2q1rk1/4b1pp/p3b1n1/1p1pP3/2pP4/7R/PPB2PPP/R1BQ1NK1/w Rh3xPh7 Reinfeld.918.1001 7k/1p1bbn2/1q2p2p/p2pP1p1/1PpP1rNP/P1P3Q1/1B2B3/6RK/w Ng4xPh6 Reinfeld.919.1001 2kr3r/pp2bppp/2p1bq2/8/4QB2/2PB4/PPP2PPP/3RR1K1/w Qe4xPc6+ Reinfeld.920.1001 2kr3r/pp2bppp/4bn2/1Nppq3/7Q/3B4/PPPB1PPP/1K1R4/w Bd2f4 Reinfeld.921.1001 5rk1/1b3p1p/pp3p2/3n1N2/1P6/P1qB1PP1/3Q3P/4R1K1/w Qd2h6 Reinfeld.922.1001 6r1/3rnpk1/p3q1pR/1pp1P1P1/3pQ3/1P4K1/1PPR1P1N/8/w Rh6h7+ Reinfeld.923.1001 r1bqnrk1/ppp2p2/2np1bpp/3NN3/3PQ3/3B4/PPP2PPP/R1B1R1K1/w Ne5xPf7 Reinfeld.924.1001 r1q2r1k/3bb1Np/p1p5/3pp2Q/6R1/2P1R3/1P3PPP/2B3K1/w Ng7e6 Reinfeld.925.1001 2r2rk1/1p1b1ppp/p4b2/3Bp3/4P3/B3Q3/2qP2PP/4RR1K/w Rf1xBf6 Reinfeld.926.1001 6rk/r3npbp/p3qp2/1ppNpR1Q/4P3/2P3RP/PPB2PP1/6K1/w Nd5xPf6 Reinfeld.927.1001 2rq1rk1/pp3ppp/3p4/6P1/b3pP2/1N4Q1/PPP3P1/2KR3R/w Rh1xPh7 Reinfeld.928.1001 4rr1k/1ppb3p/2q3p1/p7/3n4/1BP1B3/PP3PP1/2K2Q1R/w Rh1xPh7+ Reinfeld.929.1001 r2q1r2/pb3pk1/1ppbp1pp/7n/2PP4/1P1Q1N2/P1B2PPP/2B1RRK1/w Re1xPe6 Reinfeld.930.1001 2rb3k/5prp/p2p1N2/1pq1p3/4P2Q/1PP3R1/P5PP/R6K/w Qh4xPh7+ Reinfeld.931.1001 4r3/p2qppkp/3p2b1/1p1N4/2r1P1RQ/2P4P/PP4P1/5RK1/w Rg4xBg6+ Reinfeld.932.1001 1n1r1rn1/1p1qb1kp/p2p1pp1/2pPp1P1/4P2N/2P3P1/PPB2PK1/R1BQ3R/w Nh4f5+ Reinfeld.933.1001 3rr1k1/pb3p1p/qp2p1pB/2p4n/3pN3/2P2B1Q/PP5P/R2R3K/w Qh3xNh5 Reinfeld.934.1001 r2qr3/1bpn1pk1/pp2p1p1/4P3/4N3/3B1Q2/PPP2PP1/1K1R3R/w Rh1h7+ Reinfeld.935.1001 r1b1qrk1/pp1p1ppp/8/n3p1BQ/2B1P3/8/P1P2PPP/3R1RK1/w Bg5f6 Reinfeld.936.1001 r3nrk1/2p1Q1pp/p1b1Pp2/np4B1/6q1/1B3N2/PP3PPP/R3R1K1/w Qe7xRf8+ Reinfeld.937.1001 3rr2k/1ppq1p1p/pbn5/3pPP2/3P4/1B1RBQ2/PP3PK1/7R/w Rh1xPh7+ Reinfeld.938.1001 r4r2/1q3pkp/p1b1p1n1/1p4QP/4P3/1BP3P1/P4P2/R2R2K1/w Ph5h6+ Reinfeld.939.1001 1k5r/1r1B2pp/1PQ5/4pp2/R7/3q3P/5PP1/6K1/w Bd7c8 Reinfeld.940.1001 r3r1k1/pp3ppp/3b4/3q4/1n1B1P2/3B1P2/PP2Q2P/1K1R2R1/w Rg1xPg7+ Reinfeld.941.1001 2r1n1k1/2q1prbp/p2p2p1/1p1P2Q1/3B2P1/3B1P2/PPP5/2KR3R/w Rh1xPh7 Reinfeld.942.1001 r4rb1/pp2q1bk/1np2npp/2N1Np2/3P1P2/4P1PB/PPQB3P/R4RK1/w Bh3xPf5 Reinfeld.943.1001 r1b1qrk1/2p4p/pb1ppp2/1p2pN2/3PP3/2P5/PP2QPPP/RN1R2K1/w Qe2g4+ Reinfeld.944.1001 r4rk1/ppqbppb1/2np2p1/2p5/2PP3N/2PQB1P1/P3P1BP/R4RK1/w Nh4xPg6 Reinfeld.945.1001 r5k1/pp5p/4r3/n2q4/3B4/3B4/P5PP/Q4RK1/w Bd3xPh7+ Reinfeld.946.1001 5rrk/1q2ppb1/p6p/1pnPP2Q/2p2P2/2N4P/PP2B1R1/6RK/w Rg2xBg7 Reinfeld.947.1001 r3r1k1/1p1n1p1p/pq3p2/3P3N/4P3/P2b4/1B1Q2PP/R6K/w Qd2h6 Reinfeld.948.1001 r1bq2k1/n1p4p/p5N1/8/1pP2Qn1/1P6/PB3PP1/2K2B1R/w Rh1xPh7 Reinfeld.949.1001 r2N1n1k/4R1bp/1p1B2p1/p7/2B5/8/PP3PbP/4K3/w Re7xBg7 Reinfeld.950.1001 r1b2r2/1p1nq1bk/1np1p1pp/p7/3PN2N/1P2B3/P1Q1BPPP/2RR2K1/w Nh4xPg6 Reinfeld.951.1001 3n1rk1/2qb2rp/pn2p1p1/1p1pP1P1/1P1N1PQR/P2BB3/2P3K1/7R/w Rh4xPh7 Reinfeld.952.1001 1r3rk1/1p5p/1qppb1p1/p7/2P1N3/1P4P1/PQ2PP2/2KR3R/w Rh1xPh7 Reinfeld.953.1001 r1b4k/ppp1Q1Rp/1n1q1np1/8/2BP4/P7/1PP2PPP/R1B3K1/w Qe7e8+ Reinfeld.954.1001 2k4r/ppprq1pp/4p3/2PnP3/2BP1R1P/1Q6/PP4P1/5RK1/w Pc5c6 Reinfeld.955.1001 3r4/4bpk1/p2qpnp1/1p1bN1Bp/3P1Q2/P1P4R/5PPP/1B4K1/w Rh3xPh5 Reinfeld.956.1001 rnbq1rk1/pppp1ppp/8/8/2B5/2B5/P4PPP/R2Q1RK1/w Qd1g4 Reinfeld.957.1001 r1bqr1k1/pp1nbppp/2n1p3/2ppP3/3P1N1P/2PB1N2/PP2QPP1/R1B1K2R/w Bd3xPh7+ Reinfeld.958.1001 8/pp2rkp1/2p2r2/3p1PR1/3P4/3qP2R/PP3Q1K/8/w Rg5xPg7+ Reinfeld.959.1001 4q2r/pb3pk1/1pN1pn1p/2b3p1/1P5P/2P2QB1/P1B2PP1/3R2K1/w Qf3xNf6+ Reinfeld.960.1001 2kr2nr/ppp1q1pp/2npbp2/3B4/4P3/B1Q2N2/P4PPP/1R2R1K1/w Rb1xPb7 Reinfeld.961.1001 1kb3rr/1p2n2q/1Np2p2/1p6/1P1N1P1p/8/2P1RQPP/R6K/w Nd4xPb5 Reinfeld.962.1001 2r4k/rR2b2p/5p1B/3Bp3/q1Pn2b1/P5P1/7P/2Q1NR1K/w Rf1xPf6 Reinfeld.963.1001 r2q1rk1/2pbbpp1/p4B1p/1n1pP1NQ/2p5/2P5/P1B2PPP/R4RK1/w Qh5xPh6 Reinfeld.964.1001 rn1qr1k1/pbp2pb1/1p4p1/3p4/3P4/2NBPN2/PPQ2PP1/R3K2R/w Bd3xPg6 Reinfeld.965.1001 rnbq1rk1/pppp1ppp/1b1P2n1/6N1/2B1P3/2N5/PP3PPP/R1BQK2R/w Qd1h5 Reinfeld.966.1001 r4rk1/pbq1bp2/1p2p1p1/6Np/2P3n1/2B4Q/PPB2PPP/3R1RK1/w Rd1d7 Reinfeld.967.1001 rn1q1rk1/pp2bppb/4p2p/3p3N/3P1N2/8/PPP1QPPP/R1B1R1K1/w Nh5xPg7 Reinfeld.968.1001 1q3r2/p5pk/1ppN1bpp/4p2n/2P1Q3/1P4PB/P2RPP1P/6K1/w Qe4xPg6+ Reinfeld.969.1001 4rr2/p1q2p1k/1p1RbQp1/4Pp1p/2P4R/5N1P/PP4P1/7K/w Rh4xPh5+ Reinfeld.970.1001 2kr3r/pp1b3p/2p1pqp1/3p4/5B1b/3Q2N1/P1P3PP/1R3R1K/w Qd3a6! Reinfeld.971.1001 rq4k1/pp1nrppp/4bn2/6R1/3QP3/P4PN1/4B1PP/2B2RK1/w Rg5xPg7+ Reinfeld.972.1001 rnb2k2/ppqpRr2/2p3p1/8/3Q4/8/P4PPP/R5K1/w Qd4h8+ Reinfeld.973.1001 r1bq1rk1/ppppnpp1/1b5p/1Bn1P1B1/2Q5/2P2N2/PP3PPP/RN3RK1/w Qc4h4 Reinfeld.974.1001 kr3b1r/pp2q2p/n2p1ppn/N1pPp3/P3P3/1R4N1/1PPBQPPP/5RK1/w Qe2xNa6 Reinfeld.975.1001 r2r2k1/1p2bp1p/p2p2p1/1b1Pp3/4B3/1Pq1B2Q/P1P2RPP/2R3K1/w Rf2xPf7 Reinfeld.976.1001 5r2/1p4k1/p1pbP2p/3p1rpq/2P2P2/6RN/PP1Q3P/6RK/w Nh3xPg5 Reinfeld.977.1001 3r3k/b3n1p1/p4pQp/1p6/2qp3R/P4N1P/1PPB1PP1/6K1/w Rh4xPh6+ Reinfeld.978.1001 r1bq1rk1/ppp3p1/7p/3P2n1/2PQ1p2/1N5P/PPP2PPK/R1B2R2/b Ng5f3+ Reinfeld.979.1001 r1b1r1k1/pp3ppp/2pb3q/3p4/3P2nP/1PN2BP1/PB2PP2/R2QR1K1/b Bd6xPg3 Reinfeld.980.1001 8/p7/2p1p2p/4P1pQ/P4b2/5Pkb/1P1r4/4R1K1/b Bf4e3+ Reinfeld.981.1001 6k1/2p3bp/p1p3p1/3pnr2/7r/B4PqP/PP1NQRP1/3R2K1/b Rh4xPh3 Reinfeld.982.1001 2k2r2/2p5/1pq5/p1p1n3/P1P2n1B/1R4Pp/2QR4/6K1/b Nf4e2+ Reinfeld.983.1001 r1b3k1/pp3pp1/5q1p/3pr3/1Q1n4/P1NB4/1P3PPP/R4RK1/b Nd4f3+ Reinfeld.984.1001 3r2k1/Q4p2/Bp2p1pp/3r4/1P1n3q/P7/1P3PPP/2R1R1K1/b Nd4f3+ Reinfeld.985.1001 5nk1/5rpp/p3pr2/P1Q1p2q/4Pn2/2P1N3/1P3PPP/R3N1RK/b Qh5xPh2+ Reinfeld.986.1001 rr4k1/4pp1p/p2p1bp1/q2P3P/1p4P1/P4P2/1PPQ4/2KR1B1R/b Bf6xPb2+ Reinfeld.987.1001 3q2k1/1bR2ppp/p3p3/4Q3/5N2/P4PPK/1P1r3P/8/b Bb7xPf3 Reinfeld.988.1001 1r4k1/p4p1p/3p1QpP/2nPP1P1/8/7q/PrBR4/K5R1/b Rb2b1+ Reinfeld.989.1001 6rk/pp2pp1p/3q2rb/3P1b2/3P1P2/1P3Q1P/PB1N1R1K/2R5/b Bh6xPf4+ Reinfeld.990.1001 8/3R2pp/5k2/5P2/5BP1/7K/4q2P/8/b Qe2f3+ Reinfeld.991.1001 3r2k1/pbq2p1p/1p2pnp1/3r4/1PN5/2PB1P2/P1Q3PP/3RR2K/b Rd5h5 Reinfeld.992.1001 6k1/5p2/4p1p1/p2bP1Pp/3P2qP/PP6/2Q4K/2B5/b Qg4xPh4+ Reinfeld.993.1001 r6k/p1Q5/2p1b1rq/4p3/B3P3/4P3/PPP3P1/4RRK1/b Rg6xPg2+ Reinfeld.994.1001 3r2k1/2p1bppp/4b3/p2pP3/qr1N1B1P/8/1PPQ1PP1/1K1RR3/b Rb4xPb2+ Reinfeld.995.1001 1k1r2r1/p1p3q1/2p2p2/3pn3/1P1b2bB/1QN5/P4PPP/1R2RBK1/b Ne5f3+ Reinfeld.996.1001 3q1rk1/pb3ppp/1p2p3/2r1n3/8/P1N1P3/1PQ2PPP/R1B2RK1/b Ne5f3+ Reinfeld.997.1001 2k5/1pp2ppp/4p3/1P5q/5n2/P1N2r1P/1PQ3PK/3R4/b Nf4xPh3 Reinfeld.998.1001 r3k2r/1p3ppp/pb1p4/4PQ2/2B2Pn1/N3q3/PP4PP/R4R1K/b Qe3g1+ Reinfeld.999.1001 r2q1rk1/ppp2ppp/3b2n1/1N1P4/2BBP3/P4pP1/1PQ2PbP/R3R1K1/b Ng6f4 Reinfeld.1000.1001 7k/p4q1p/1pb5/2p5/4B2Q/2P1B3/P6P/7K/b Qf7f1+ Reinfeld.1001.1001 gnuchess-4.0.pl70/test/CHESSTEST/sherev.fin100644 21542 13 11667 5527662451 17360 0ustar cracraftuser#M.I. Shereshevsky: Endgame strategy. 60 positions. Very hard and strategic, #Correctness far from clear compared with, say, Reinfeld, or even Speelman. # r3r1k1/1b2Pp1p/2nR4/2p1RP2/8/8/BP3PPP/1K6/w Rd6xNc6 (Shereshevsky_ES) (page 13, M.I. Shereshevsky: Endgame strategy.) 8/1PK3pk/2PR1p2/5P1p/8/1r6/1r6/8/w Rd6d4 (Shereshevsky_ES) (page 17) 2r5/5p2/k6p/p3NP2/1p2p3/8/2PR2PP/6K1/b Pe4e3 (Shereshevsky_ES) (page 17) r1b1r1k1/pp3p2/2p2qn1/4p1p1/4PnPp/2PBNP2/PPQ2R1P/R3N2K/b Nf4xBd3 (Shereshevsky_ES) (page 19) 1r2r3/1b1n2kp/p1p3p1/Pp3p2/3PN3/5P2/1P1R2PP/1BR3K1/w Ne4d6 (Shereshevsky_ES) (page 20) 5rk1/3bppbp/6p1/n7/1R1NP3/6P1/2r2PBP/2B2RK1/b Bg7xNd4 (Shereshevsky_ES) (page 22) r1r3k1/4b1pp/pp2pp2/n2p4/1N1P1B1P/2P3P1/P3PP2/1R3RK1/w Nb4d3 (Shereshevsky_ES) (page 25) 1r6/4k3/2Bpp3/2p1b2p/2P2prP/pP1R4/P3KP2/7R/b Pd6d5 (Shereshevsky_ES) (page 26) 1r6/8/3kp3/2pP3p/B2b1prP/pP1R1K2/P4P2/7R/b Kd6xPd5 (Shereshevsky_ES) (page 26) 8/5p2/p3p1p1/1pbkP2p/5P1P/1P4P1/P3KB2/8/w Bf2e1 (Shereshevsky_ES) (page 27) 8/p5k1/2p2p2/4p1p1/1p2P3/1P4PP/1PP5/5K2/b Pg5g4 (Shereshevsky_ES) (page 30) 8/p6p/3k4/p3p3/2rBK2P/P7/3R4/8/b Kd6e6 (Shereshevsky_ES) (page 31) 8/2r5/4R3/6P1/4P1P1/2p2k2/2K5/8/b Kf3f4 (Shereshevsky_ES) (page 33) r7/p2k3p/1pR3p1/1P1p1p2/3P1P2/4P1P1/4KP2/8/w Pf2f3 (Shereshevsky_ES) (page 36) 8/p2kr3/1p4pp/1P1p1p2/3P1PPK/2R1PP2/8/8/w Kh4g3 (Shereshevsky_ES) (page 37) 8/1p1r1p2/k1p2Rpp/P6P/2PP2P1/3K4/8/8/w Pg4g5 (Shereshevsky_ES) (page 40) 2r2k2/p4ppp/8/2p1pP2/1pR1B3/1PbPPKP1/P6P/8/w Pa2a4 (Shereshevsky_ES) (page 42) 8/8/8/4p3/4P1PK/4kP2/8/3b2N1/w Pg4g5 (Shereshevsky_ES) (page 52) 6k1/5p2/2r1p1p1/3p1n2/3P3p/1P5P/3RNPP1/6K1/b Rc6b6 (Shereshevsky_ES) (page 53) r3kb1r/1p2pppp/1pn5/3p1b2/3P4/4PN2/PP1B1PPP/R3KB1R/b Bf5d7 (Shereshevsky_ES) (page 56) 1R6/6k1/6pp/4p3/1P2r2P/6K1/5PP1/8/w Ph4h5 (Shereshevsky_ES) (page 62-3) 6R1/1k4P1/3K4/1p4r1/p7/P7/1P6/8/b Pb5b4 (Shereshevsky_ES) (page 66) 1r4k1/2n2ppp/2B1p3/8/RP6/4P3/5PPP/6K1/w Pg2g4 (Shereshevsky_ES) (page 71) 8/2p1r3/3p1kp1/p1p4p/P3BP1P/1Pb2KP1/2P5/3R4/w Rd1d5 (Shereshevsky_ES) (page 77) 4r3/pp4pp/2knr3/2p5/2P1p3/4N3/PPK3PP/4RR2/b Re6h6 (Shereshevsky_ES) (page 78) 1k1n3r/8/pp2p2b/3pPp2/1P1NnP2/2P1N3/P1K4R/2B5/b Pb6b5 (Shereshevsky_ES) (page 83) 1k1n1b1r/8/p7/1p1pP3/1P2nP2/2P1N3/P1K3R1/2B5/b Kb8b7 (Shereshevsky_ES) (page 83) 2r1r1k1/p2n1ppp/3bp3/2pp4/3P4/B3PP2/PP2NP1P/2R1K2R/b Pe6e5 (Shereshevsky_ES) (page 92) 3r4/pk6/1p4pp/2p5/4n3/2P3P1/PPK1R2P/R2N1r2/b Ne4d6 (Shereshevsky_ES) (page 94) 1R6/6kp/3p2pn/3P4/2Pp1PK1/8/8/8/w Kg4g5 (Shereshevsky_ES) (page 97) r4r2/5pk1/p2p1bp1/1p1P4/8/3B4/PPP4P/1K1R2R1/w Ph2h3 (Shereshevsky_ES) (page 98) r2r4/1p3kp1/2pR2np/2P1p3/1P6/4P3/1B3PPP/5RK1/w Rd6d1 (Shereshevsky_ES) (page 99) 2r5/1p2kppp/p3bn2/2Rp4/1P1N4/3BPP2/1P3KPP/8/b Ke7d8 (Shereshevsky_ES) (page 112) 6k1/1pnb1ppp/p7/3p4/P2N4/1P1BP3/5PPP/6K1/w Pa4a5 (Shereshevsky_ES) (page 114) 8/1p1bk2p/p5p1/P2pp3/5P2/1P1BP1P1/3K3P/8/b Bd7b5 (Shereshevsky_ES) (page 115) 3r2k1/pp1r2pp/2n2p2/3p4/8/1P2PKP1/PB1R1P1P/3R4/w Pg3g4 (Shereshevsky_ES) (page 116) 8/p5p1/1pp1n1P1/3k1p2/P2P4/1P2BPK1/8/8/b Pa7a5 (Shereshevsky_ES) (page 118) r4rk1/pb3ppp/1p3n2/8/4P3/1B1nBP2/P2N2PP/R4RK1/w Nd2c4 (Shereshevsky_ES) (page 130) 8/1p1nkpbp/p2p1np1/2pP4/P1P2B2/1PN4P/2B2PP1/6K1/w Pa4a5 (Shereshevsky_ES) (page 139) 8/1p1nkpbp/p2p1np1/2pP4/P1P2B2/2N4P/1P3PP1/3B2K1/w Pa4a5 (Shereshevsky_ES) (page 140) 8/3n4/pp1p1k2/P1nP1p2/1BP2P2/4K3/8/3B4/w Bb4xNc5 (Shereshevsky_ES) (page 141) 8/p3r3/B1p3kp/2Np4/4b3/2P1n1P1/PP3RP1/2K5/w Ba6b7 (Shereshevsky_ES) (page 156) r6r/1p1k3p/p2p1bp1/3Rp3/4P1P1/1PP5/1P3P2/2B1K2R/w Pg4g5 (Shereshevsky_ES) (page 157) 3r1rk1/2n3np/p3p1p1/2pp2P1/1pP2P1P/1P2PB2/P4N2/3R1RK1/w Nf2g4 (Shereshevsky_ES) (page 159) 7r/pBn1kp1p/4p3/6p1/1P2P3/4PP2/7P/3R2K1/w Rd1c1 (Shereshevsky_ES) (page 160) 8/8/3k2p1/pnp5/5KPP/BP6/8/8/w Ph4h5 (Shereshevsky_ES) (page 162) 5rk1/1b1nr1bp/pp1p2p1/2P2p2/2P5/P1N2NPP/1P3RPK/1B3R2/b Pb6xPc5 (Shereshevsky_ES) (page 163) 8/1b1nk2p/p5p1/2p2p2/2P5/P1PR2PP/B5PK/4r1N1/b Re1c1 (Shereshevsky_ES) (page 163) rnb1k2r/pp2pp1p/3p3b/5p2/3P4/2N5/PPP2PPP/1K1R1BNR/w Pg2g3 (Shereshevsky_ES) (page 171) 2k5/rp3n2/p1p3p1/N1Pp1pp1/P2Pr1P1/4PK1P/1R3P2/6R1/w Ph3h4 (Shereshevsky_ES) (page 175) r3kb1r/pppn3p/5pp1/4p3/2N1P3/2P1B3/PP3PPP/R2K3R/w Pb2b4 (Shereshevsky_ES) (page 184) 2kr3r/ppp1b2p/1n4p1/N3pp2/1P2P3/P1P1B3/2K2PPP/R6R/w Be3xNb6 (Shereshevsky_ES) (page 184) 2q2rk1/4b1pp/pn2p3/2p1P3/2P1Q3/1N4P1/P5NP/3R2K1/b Rf8d8 (Shereshevsky_ES) (page 186) r2r2k1/p1R3pp/p1n1pp2/3B4/8/6P1/1P2PP1P/2R3K1/b Pe6xBd5 (Shereshevsky_ES) (page 187) 5k2/R5p1/1r2ppBp/p6P/1n2P1P1/1P3PK1/8/8/w Pe4e5 (Shereshevsky_ES) (page 188-9) 8/6kp/2rn2p1/8/1p4P1/1B5P/3R4/6K1/b Nd6e4 (Shereshevsky_ES) (page 191-2) 8/7R/5kp1/2n5/1p4P1/1B5P/6K1/2r5/w Bb3f7 (Shereshevsky_ES) (page 192) 2r2rk1/pp2n1b1/3p1npp/3Ppp2/N3P3/4BP2/PP3NPP/R3K2R/w Na4c3 (Shereshevsky_ES) (page 194) 2R5/8/1p4kp/p1b2pp1/P1B3P1/1P2PK1P/3r1P2/8/w Bc4e6 (Shereshevsky_ES) (page 203) 4k3/3npp1p/b2p2p1/3P4/P1p1B3/2N3PP/4PP2/6K1/w Pf2f4 (Shereshevsky_ES) (page 209; this is the last position I've taken from M.I. Shereshevsky: Endgame strategy.) gnuchess-4.0.pl70/test/CHESSTEST/speelman.fin100644 21542 13 35003 5527662451 17656 0ustar cracraftuser#This file contains Endgame test positions from these sources #Jon S. Speelman: Endgame Preparation, Batsford, 1981, #Jon S. Speelman: Analysing The Endgame, Batsford 1981. #I.A. Horowitz: How to win in the chess endings, #Tartan books, David McKay co inc. New York 1957. #Y. Averbakh: Chess endings, essential knowledge, Pergamon 1987. # #At the end there are also a few easy problems I cooked up just to test #whether the testee knows about underpromotion and certain standard #wins and draws. # #The present file is a good test for the computer since a lot of them #involve stalemate, perpetual check, draw by repetition, and "fortess #building" draw themes, i.e. things it is hard for a computer to get #right, or where it is easy to have a bug. Also, theories of #"corresponding squares" or "coordinate squares" are really just #special cases of dynamic programming -- such positions ought to be #readily solvable with transposition tables but harder to solve without #them. A terrific torture test for a chess program is the mate in 200 #problem; if a program can solve it, it must be doing something right! #Be warned though: although I think there is usually a unique best move #in each position, this is not as certain as in the Reinfeld and Larsen #sets. Also, problem correctness is not as certain either. On the #bright side, I mention that in D. Hooper's: Pocket guide to endings, #are about 300 positions, all completely analysed, and of these 300, #only 35 have >=7 men on the board. Thus nearly 90% of all "endgame #knowledge" concerns positions with <=6 men (and all such positions are #databasable?). # # # begin examples from (Speelman_EP) 6R1/8/8/8/1k1K4/8/1p4p1/8/w Kd4d5 (Speelman_EP) (draws. EP page 14, 4) 8/8/2p5/K1P1p3/4Pk2/8/3pB3/8/w Ka5b6 (Speelman_EP) (page 14, 5) 4k3/8/2pK4/2Pp1b2/7R/7p/8/8/w Rh4h5 (Speelman_EP) (page 15, 7) 8/4k2N/7p/8/1p6/8/4K3/8/w Ke2d3 (Speelman_EP) (page 15, 9) 8/8/B3P3/3k4/5K2/2P4b/8/8/w Ba6c8 (Speelman_EP) (page 16, 11) 6b1/2p5/2p1P3/p1P4p/k5B1/3r4/1P4K1/5R2/w Rf1f4+ (Speelman_EP) (page 17, 14) 8/3p4/P3p1N1/8/6k1/1b6/8/6K1/w Ng6e7 (Speelman_EP) (page 19,17) 8/7n/1p1p1n2/p1pPpBp1/P1P1Pp1k/2P2P2/3BKP2/8/b Pg5g4 (Speelman_EP) (page 20, 19) 2KB4/1P6/2k5/8/8/8/7b/8/w Bd8h4 (Speelman_EP) (page 20, 21) 1r6/4P1P1/8/7k/8/7N/8/4K3/w Nh3f4+ (Speelman_EP) (22 page 21) 8/1p6/p1pPk1p1/3p2K1/PP1Pp2P/4P3/8/8/b Pa6a5 (Speelman_EP) (25 page 22) 8/8/p3k1p1/1p2p2p/1P2K1PP/5P2/P7/8/b Pg6g5 (Speelman_EP) (26 page 23) 8/8/4b1p1/2Bp3p/5P1P/1pK1Pk2/8/8/b Pg6g5 (Speelman_EP) (27 page 23) 6r1/4k3/1p2p3/p1rp1p1p/P2RpP2/1KP1R1PP/1P6/8/b Ph5h4 (Speelman_EP) (28 page 23) 8/5pk1/p3p3/3n2p1/r6p/3N2PP/PR1KPP2/8/b Pg5g4 (Speelman_EP) (page 23, 29) 2b5/1r6/2kBp1p1/p2pP1P1/2pP4/1pP3K1/1R3P2/8/b Rb7b4 (Speelman_EP) (page 24, 30) 3k4/7p/8/2P5/K7/8/8/8/w Ka4b5 (Speelman_EP) (page 27, 39) 8/6K1/8/ppp2k2/8/1P6/1P5P/8/w Ph2h4 (Speelman_EP) (1... Kg4 2. Kg6! draws, and makes black sweat too page 27,40) 8/4p2p/8/1K1k4/P7/5P2/8/8/b Kd5e6 (Speelman_EP) (41 page 27, corrected by Elie Ebvic) 8/1pPK3b/8/8/8/5k2/8/8/w Kd7c8 (Speelman_EP) (42 page 28) 6k1/8/7Q/7K/2q3PP/8/8/8/b Qc4f7+ (Speelman_EP) (page 29, 43; stalemate or perp chck is forced) 8/kp6/p7/P4Qp1/7p/4q3/8/7K/w Qf5f2 (Speelman_EP) (forcing stalemate; 44 page 29) 8/8/2p5/pkp3R1/7B/P7/2p3K1/8/w Pa3a4+ (Speelman_EP) (45 page 29) 8/2B2p1p/8/3K4/6k1/8/7P/8/b Pf7f5 (Speelman_EP) (47 page 30) 8/6pp/5p2/3k1PP1/5K1P/8/8/8/w Kf4g4 (Speelman_EP) (52 page 32) 3k4/p1p5/8/2p1p3/4P3/PpPP2K1/1P6/8/b Pc5c4 (Speelman_EP) (53 page 32; a "self-stalemate" saves the game!) 8/4p3/8/3P3p/P2pK3/6P1/7b/3k4/w Pd5d6 (Speelman_EP) (page 33, 54 leads to stalemate) 8/6P1/8/8/q2Q4/2K5/8/7k/b Qa4a1+ (Speelman_EP) (getting perpetual check, page 35, 60) 8/R5pp/2p1k3/2p2p2/2P5/1P2P1P1/P3r2P/6K1/b Pg7g5 (Speelman_EP) (getting perpetual check, page 35, 61) 6k1/8/4K3/1R5p/8/2N5/n2q3B/8/w Nc3e4 (Speelman_EP) (forcing both sides to draw by repetition p37, 66.) 1R6/8/8/5bp1/4p2k/8/B1p2PKP/8/w Rb8b1 (Speelman_EP) (an example of "building a fortress" to get a draw, p38, 72) 5B1k/7p/6P1/4NnP1/8/8/K4p2/8/w Pg6g7+ (Speelman_EP) (forcing a peculiar draw, page 39, 73) 8/6kp/6p1/1B3p2/5P2/3K2P1/4n2P/8/b Ne2xPf4+ (Speelman_EP) (forcing a B and wrong RP draw p39, 74) 8/5ppp/8/8/1pK5/kP3P2/6PP/8/b Ph7h6 (Speelman_EP) (forcing eventual zugzwang page 44, 82) 8/8/7b/P1k5/3N4/8/5PKp/8/w Kg2h1 (Speelman_EP) (page 47, 89, forcing a zugwang and winning) k7/8/3p4/p2P1p2/P2P1P2/K7/8/8/w Ka3b2 (Speelman_EP) (102 page 54, lasker) 8/k7/3p4/p2P1p2/P2P1P2/8/8/K7/w Ka1b1 (Speelman_EP) (102 page 54, reichhelm) k7/1p5p/7P/8/1P6/8/2K5/8/w Kc2d3 (Speelman_EP) (107 page 58) k7/7p/3p1p1P/3P2p1/3P2P1/8/6P1/K7/b Ka8b7 (Speelman_EP) (page 60, 109. This draws. "Coordinate squares") 7k/1p6/1P2p3/1P2P3/4P1p1/6P1/8/K7/w Ka1a2 (Speelman_EP) (wins, page 60, 110, "coordinate squares") 7k/1p6/1P2p3/1P2P3/4P1p1/6P1/8/K7/b Kh8g8 (Speelman_EP) (draws, page 60, 110, "coordinate squares") 6k1/3p4/3p4/3P4/4P1p1/6P1/8/K7/w Ka1b1 (Speelman_EP) (wins, page 61,111 "corresponding squares") 8/8/6k1/B5Pp/6pK/6P1/8/n7/w Ba5e1 (Speelman_EP) (holds the draw, page 63,117 "corresponding squares") 2k5/1pP1p2p/1K2p2P/3bP3/8/8/2N5/8/w Nc2a3 (Speelman_EP) (page 64,119. White wins, "corresponding squares") 2b5/1p6/pPp2k2/P1PpN2p/3P1K1P/8/8/8/w Kf4f3 (Speelman_EP) (120 page 65) 8/5b2/p2k4/1p1p1p1p/1P1K1P1P/2P1PB2/8/8/w Bf3e2 (Speelman_EP) (page 65, 121. White wins, "corresponding squares") 6n1/p1BN3b/p1p3np/p1p3pq/6kr/K1P2r1p/2PPQ3/8/w Qe2e6+ (Speelman_EP) (EP page 68, 126. In this incredible problem by W. Joergensen, white mates in 200 and all his moves are unique! It ought to be possible to solve it by computer if forcing lines are investigated deeply and transposition tables are used...? The only captures in the solution are 60. KxPa3, 141. QxPc4+, and 180. KxPa3. It ends 200. Qe2 mate.) 6k1/5p2/6p1/1P1R3p/5P2/8/5KPP/1r6/w Kf2e3 (Speelman_EP) (page 79, 138) 8/6p1/5k2/8/5KP1/8/7P/8/w Kf4f3 (Speelman_EP) (page 81, 141) 1r4k1/5p1p/6p1/2R5/8/4P1P1/5P1P/6K1/b Ph7h5 (Speelman_EP) (page 84, 146) 5k2/6p1/7p/4PK1P/5PPb/1B6/8/8/w Pg4g5 (Speelman_EP) (page 88, 152) 2R5/4ppk1/p6p/8/8/8/P2b2KP/8/w Pa2a3 (Speelman_EP) (page 92, 157) 2k5/2b5/pp6/4p3/1P4P1/1KP2p2/1P1R4/8/w Rd2d5 (Speelman_EP) (page 92, 158) 8/8/p1p5/P7/1PP3p1/4kb1p/7R/6K1/w Pb4b5 (Speelman_EP) (page 93, 159) 8/1B6/3r2p1/5p1p/5P1P/4k1P1/8/6K1/b Pg6g5 (Speelman_EP) (page 95, 162) B7/8/1r4p1/5p1p/3k1P1P/6P1/5K2/8/b Rb6b2+ (Speelman_EP) (page 96, 164) 4Q3/5K2/8/7N/6k1/8/8/7q/w Qe8g8+ (Speelman_EP) (page 108,179) 5k2/p1p3p1/1p2p3/8/7P/5PP1/P4P2/6K1/b Pe6e5 (Speelman_EP) (page 114, 186) 8/p1pk1ppp/2p5/2K5/8/8/PPP2PPP/8/w Pb2b4 (Speelman_EP) (page 114, 187) 4r3/2p5/7R/3k4/2p2PP1/5K2/8/8/w Rh6h7 (Speelman_EP) (page 116, 191) 8/5kpp/p4p2/1p6/2rP1P2/P3K1P1/1R5P/8/b Kf7e6 (Speelman_EP) (page 116, 192) 6k1/5p2/2r1p1p1/3p1n2/3P3p/1P5P/3RNPP1/6K1/b Rc6b6 (Speelman_EP) (page 122, 203) 6k1/5p2/2n1p1p1/3p4/3P4/1P1R2PP/5K2/2rN4/b Rc1b1 (Speelman_EP) (page 123, 204) R7/2r2pkp/2pb2p1/3p4/3P4/3NPPP1/7P/6K1/b Pg6g5 (Speelman_EP) (page 124, 205; makes h2 weak) 8/N5pp/8/3k4/3pnP2/6P1/P6P/6K1/b Pd4d3 (Speelman_EP) (page 129, 211) 8/8/8/8/5k2/2pP4/2P5/4K3/b Kf4f3 (Speelman_EP) (page 130, 215. draws) 6k1/4n1pp/8/3p1n1N/p1pP4/PpP2P2/1B3KPP/8/w Nh5f4 (Speelman_EP) (page 131, 216) 5bk1/7p/3p4/2pPp2P/2P1N1P1/8/5K2/8/w Pg4g5 (Speelman_EP) (page 132, 219) 8/8/8/6p1/1K3p1p/5P1P/1k4P1/8/w Kb4c4 (Speelman_EP) (page 134, 223) 8/5pkp/1n4p1/1P6/3K2P1/2N4P/8/8/w Nc3d5 (Speelman_EP) (page 134, 224) 8/p5k1/6pp/1p1PP3/7P/8/P6K/8/w Ph4h5 (Speelman_EP) (page 141, 233) 8/5kp1/p2r4/8/4P3/3PK3/8/R7/w Ra1a5 (Speelman_EP) (page 142, 235) 8/5k2/5p2/2P3p1/1P4R1/4K3/7r/8/w Pc5c6 (Speelman_EP) (page 142, 236) 2b5/p6p/2B3p1/2P1k3/1P1pp3/8/P4KPP/8/b Bc8g4 (Speelman_EP) (page 143, 237) 8/KPb5/P7/1k6/6p1/5p2/5B2/8/w Pb7b8=Q+ (Speelman_EP) (page 143, 238) 8/p3k2p/1p2p1p1/bP6/P1K5/2N1P3/2R2PPP/7r/w Nc3e4 (Speelman_EP) (page 144, 240) 8/p3k1K1/1p1p1p2/5P2/P3r3/1P4P1/2P4P/3B4/w Ph2h4 (Speelman_EP) (page 145, 243) rr4k1/6p1/b3p2p/2RpNp2/p2P4/Pp2PP2/1P4PP/2R3K1/w Kg1f2 (Speelman_EP) (page 146, 244) 4r3/5pk1/p4p1p/p3rP2/8/2PRp2P/PPK1R1P1/8/w Pg2g3 (Speelman_EP) (page 147, 246) 3k4/5p2/p4K2/p1r1n2p/B1P1p3/P3P3/5P2/7R/w Ba4d1 (Speelman_EP) (page 148, 248) 5k2/p1p4R/1pr5/3p1pP1/P2P1P2/2P2K2/8/8/w Kf3g3 (Speelman_EP) (page 149, 252) 4k3/5pK1/4pP2/3pPb2/5N2/2P5/8/8/w Kg7g8 (Speelman_EP) (page 151, 255) 8/p6p/2k1b3/2P3K1/P3N1p1/8/7P/8/b Pa7a5 (Speelman_EP) (page 153, 259) 8/2Bn4/1p2ppk1/p1p4p/P1P1P2K/1P3P2/6P1/8/w Pg2g3 (Speelman_EP) (page 154, 261) 8/p4k2/1p2pp2/6p1/1P4P1/P5N1/3n1PP1/6K1/b Pb6b5 (Speelman_EP) (page 155, 262) 8/6pk/4KnNp/7P/5PP1/8/8/8/w Ke6f7 (Speelman_EP) (page 155, 263) 8/8/8/2p1p3/1pPkPp2/pP3P2/P1BK4/5b2/b Bf1xPc4 (Speelman_EP) (page 157, 267) 4b3/6k1/1p1pP3/p2P3p/6p1/1P4K1/P1B4P/8/w Bc2d3 (Speelman_EP) (page 158, 268) b7/P4k2/P5p1/2B2pKp/7P/5PP1/8/8/w Pf3f4 (Speelman_EP) (page 159, 269) 8/r7/P3p1k1/8/8/R7/6PK/8/w Ra3a5 (Speelman_EP) (page 161, 273) 2kr4/1p6/p1p1np2/P3p1p1/1PP1P2p/5P2/2R1NKPP/8/b Rd8d3 (Speelman_EP) (277 page 163) 1r4k1/2R3bp/2P3p1/8/4p1P1/6P1/1B3P2/6K1/b Bg7xBb2 (Speelman_EP) (281 page 166; the last position I've taken from EP.) begin examples from Speelman_ATE 8/5k1p/8/5K2/5P1P/8/8/8/w Kf5e5 (Speelman_ATE) (ATE page 11, 4) 8/5k1p/8/5K2/5P1P/8/8/8/b Kf7e7 (Speelman_ATE) (ATE page 11, 4) 8/7p/4k1p1/8/5P2/5K1P/5P2/8/w Kf3g4 (Speelman_ATE) (ATE page 15, 10. Wins.) 8/1p2k2p/8/P4K2/8/7P/8/8/w Kf5g5 (Speelman_ATE) (page 18, 15) 4k3/7R/4K3/4P3/8/8/8/4r3/b Ke8f8 (Speelman_ATE) (page 19,16) 4R3/2k5/4K3/4P3/8/8/8/4r3/b Re1h1 (Speelman_ATE) (page 20,17) 4R3/2k5/4K3/4P3/8/8/8/4r3/w Ke6f7 (Speelman_ATE) (page 20,17, but not same mover) 1r6/R3K1k1/4P3/8/8/8/8/8/w Ke7d6+ (Speelman_ATE) (page 21,19) 4k3/7R/8/4PK2/8/8/8/3r4/w Kf5e6 (Speelman_ATE) (page 22, 20) 7r/4k3/8/8/2P5/2K5/8/3R4/w Kc3b4 (Speelman_ATE) (page 24, 21) 7r/4k3/8/8/2P5/2K5/8/3R4/b Rh8d8 (Speelman_ATE) (page 24, 21, other side moves) 8/8/8/8/1P3k2/7r/1K6/4R3/w Kb2c2 (Speelman_ATE) (page 27,25) 8/8/8/8/1P3k2/7r/1K6/4R3/b Kf4f5 (Speelman_ATE) (page 27,25, other side moves) r7/P3K3/8/8/1k6/8/8/R7/b Kb4c5 (Speelman_ATE) (page 30, 29) 8/8/7K/4k2P/P7/3R4/r7/8/w Rd3f3 (Speelman_ATE) (ATE page 31, 31. Continues ...Rxa4, 2. Kg5!) 8/2k1b3/2P5/3K1P1B/8/8/8/8/w Kd5e6 (Speelman_ATE) (page 32, 33) n6k/8/8/6P1/3K4/3B4/8/8/w Kd4c5 (Speelman_ATE) (page 43,53) 7k/6nP/6PK/8/6B1/8/8/8/w Kh6g5 (Speelman_ATE) (page 44,57) 8/8/6p1/6K1/R3k2P/8/p7/r7/b Ke4d5 (Speelman_ATE) (page 50,65) 8/5K2/8/4pk2/4R3/8/8/8/w Re4e2 (Speelman_ATE) (page 52, 68) 6R1/8/7k/5p2/6p1/4K2p/8/8/w Ke3e2 (Speelman_ATE) (page 53,69) 8/3B1p1p/6p1/4k3/8/4K1PP/8/8/w Pg3g4 (Speelman_ATE) (ATE page 59, 79. The only win.) 7N/2K5/8/8/7p/2k5/8/8/w Nh8f7 (Speelman_ATE) (page 61,83. draws) 8/2R5/3K4/4P3/2p1p1p1/2r5/8/6k1/w Pe5e6 (Speelman_ATE) (ATE page 62, 86. draws.) 3k4/3p3p/3p4/PK6/4P3/8/8/8/w Kb5b6 (Speelman_ATE) (page 65, 94) 8/7K/8/3p4/7B/4p2N/8/1k6/w Nh3f4 (Speelman_ATE) (page 66, 95) 8/2P5/1P6/8/K3n3/6kb/8/8/w Pb6b7 (Speelman_ATE) (page 66,96 forces a draw ...Nc5+ 2. Kb5 Nxb7 3. c8=N Bxc8 4. Kb6 Nd7 5. Kc7 etc) 8/1nP5/8/1K6/8/6kb/8/8/w Pc7c8=N (Speelman_ATE) (same as above some moves later) 4k1K1/6P1/8/8/8/8/7r/5R2/w Rf1f4 (Speelman_ATE) (page 72, 103. Lucena posn, white wins.) 1r6/R7/5p1k/5Qp1/4n1B1/4P2P/2q2PP1/6K1/b Rb8b1+ (Speelman_ATE) (page 72, 102, stalemate combo) 8/6p1/4p2p/8/3k4/7P/2PK2P1/8/b Ph6h5 (Speelman_ATE) (page 92,136) 3K2k1/3R3p/5r1p/5P1P/6P1/8/8/8/b Kg8h8 (Speelman_ATE) (page 102,148) B3k3/8/1PP5/n2b3p/1n4P1/4K3/8/8/w Pc6c7 (Speelman_ATE) (page 67,97. The last position I've taken from ATE.) begin examples from (Horowitz) 8/2k1p3/4P3/2KP4/8/8/8/8/w Pd5d6+ (Horowitz) page 61, horowitz 8/8/2k3pp/8/pK3PP1/8/1P6/8/b Kc6d5 (Horowitz) page 66 8/8/4kp2/5p1p/8/3KP1P1/7P/8/b Ke6e5 (Horowitz) (2. Ke2 Ke4 3. Kf2 h4! 4. gxh4 f4 and draw since the doubled rook pawns are useless page 69) 8/8/8/1p6/1Pp5/2K3Pk/7P/8/w Kc3d4 (Horowitz) (this is supposed to be mate in 22. page 71) 7N/2K5/8/8/7p/2k5/8/8/w Nh8f7 (Horowitz) (..h3 2. Ng5 h2 Ne4+ leading to a draw page 80) 4n3/8/8/8/8/8/p7/k2K4/w Kd1c2 (Horowitz) (page 87 the only draw. A question of parity.) 8/5p2/4p3/4P1k1/K5P1/8/5N2/8/w Ka4b4 (Horowitz) (page 91. this wins.) 8/8/8/8/3KNk1p/7P/8/8/w Kd4d5 (Horowitz) (page 92. white wins. 1...Kf5 2. Nc3!! Kf4 3. Ne2+ Kf3 4. Ng1+!! Kg2 5. Ke4 KxNg7 6. Kf3!!!) 5K2/8/p7/1k6/8/8/1P1N4/8/w Nd2b3 (Horowitz) (page 93) 8/Bpk5/8/P2K4/8/8/8/8/w Kd5d4 (Horowitz) (page 100) 8/8/1k6/1p1K4/1P6/6B1/P7/8/w Bg3e1 (Horowitz) (page 102) 5K2/k7/4P1p1/8/8/8/4b3/8/w Kf8e7 (Horowitz) (draws) page 106 2KB4/1P6/2k5/8/8/8/7b/8/w Bd8h4 (Horowitz) page 111 wins 8/p1K2p2/8/3p4/2k5/6P1/8/2B5/b Pd5d4 (Horowitz) page 113 wins 2b1k3/p1P5/3K4/8/1P6/8/P7/8/w Kd6c6 (Horowitz) (page 115. wins) 1k6/8/1P6/3B1p2/3K1Pb1/8/8/8/w Kd4e5 (Horowitz) (page 116) 5K2/R7/8/4p3/8/p5p1/1k4P1/8/w Kf8e7 (Horowitz) (page 141) 8/6KQ/8/8/8/2p5/8/k7/w Qh7h3 (Horowitz) (page 176) 3k4/pp6/2pK2p1/3p3p/8/2P4P/PP4P1/8/w Pb2b4 (Horowitz) (followed by a4 and b5, allegedly the only win according to many pages of analysis by Max Euwe on an ending that came up in practice, page 191.) 4k3/8/r3P3/5K2/8/8/8/1R6/b Ra6a2 (Horowitz) (no comment) r3k3/8/8/4PK2/8/8/8/1R6/w Kf5f6 (Horowitz) (last position I've taken from Horowitz) begin examples from (Averbakh) 8/5K1k/8/5N2/8/3p4/3N4/8/w Nd2e4 (Averbakh) (9 page 6, mate in 4) 8/8/8/8/N7/P7/2k5/7K/w Na4b2 (Averbakh) (57 page 33) B7/8/K7/2k5/8/2P5/8/8/w Ba8d5 (Averbakh) (58 page 33) 8/1K6/P7/kn6/4N3/8/8/8/w Ne4c5 (Averbakh) (65 page 36) 8/8/8/1p2bk1p/7P/4KP2/8/4B3/b Be5f6 (Averbakh) (122 page 75) 8/8/4b1p1/2Bp3p/5P1P/1pK1Pk2/8/8/b Pg6g5 (Averbakh) (128 page 79) 8/8/2k3p1/5p2/2KP3p/2N1bP1P/6P1/8/w Nc3d5 (Averbakh) (130 page 81) 8/2kb4/p1p2pp1/2Pp4/3N1PP1/1P4K1/P7/8/w Pg4g5 (Averbakh) (132 page 83) 8/5pk1/r5pp/P7/3R3P/6P1/5PK1/8/w Rd4a4 (Averbakh) (133 page 84) 3r4/7p/Rp4k1/5p2/4p3/2P5/PP3P1P/5K2/b Rd8d2 (Averbakh) (138 p 89) 8/5kpp/p4p2/1p6/2rP1P2/P3K1P1/1R5P/8/b Kf7e6 (Averbakh) (140 page 90) 6k1/6p1/7p/3q4/1P3Q2/7P/6PK/8/w Qf4b8+ (Averbakh) (143 page 93) 8/5p1k/2pQ2p1/2P2q2/1P5p/5P1P/6PK/8/w Pb4b5 (Averbakh) (144 page 94) begin examples from (WDS exercises) K7/P2k4/8/8/8/8/8/7N/b Kd7c8 (WDS exercises) (forces a draw, Kc7 loses) K7/P2k4/8/8/8/8/8/6N1/b Kd7c7 (WDS exercises) (forces a draw, Kc8 loses) 8/3q1P1k/1r6/8/8/8/K7/B7/w Pf7f8=N+ (WDS exercises) 8/5P1k/8/7K/8/8/8/8/w Pf7f8=R (WDS exercises) 4B1nk/5P2/6K1/8/8/8/8/8/w Pf7f8=B (WDS exercises) (Bob Holt; KBBvKN is a win, say databases) 8/2P1P1P1/3PkP2/8/4K3/8/8/8/w Pe7e8=B (WDS exercises) (and mate in 3: 1... Kxf6 (or d6, sym.), 2. g8=R! Ke6, 3. Rg6 mate. Other moves mate slower, or lead to stalemate. This is not a suitable test if your computer does not seek fastest mates.) 8/1p6/p3k1pp/4P3/4PK1P/P7/1P6/8/b Pb7b5 (WDS exercises) 7K/2p5/4p3/2p2kPP/8/4P3/2b5/4n3/w Pg5g6 (WDS exercises) gnuchess-4.0.pl70/test/CHESSTEST/winatchess.fin100644 21542 13 52036 5527662451 20227 0ustar cracraftuser#REINFELD, WIN AT CHESS, 300 POSITIONS. Note, #296 #has no solution, note the "*", and has been included merely for historical #interest. It should presumably be deleted before using this test. # 2rr3k/pp3pp1/1nnqbN1p/3pN3/2pP4/2P3Q1/PPB4P/R4RK1/w Qg3g6 WinAtChess.001 8/7p/5k2/5p2/p1p2P2/Pr1pPK2/1P1R3P/8/b Rb3xPb2 WinAtChess.002 5rk1/1ppb3p/p1pb4/6q1/3P1p1r/2P1R2P/PP1BQ1P1/5RKN/w Re3g3 WinAtChess.003 r1bq2rk/pp3pbp/2p1p1pQ/7P/3P4/2PB1N2/PP3PPR/2KR4/w Qh6xPh7+ WinAtChess.004 5k2/6pp/p1qN4/1p1p4/3P4/2PKP2Q/PP3r2/3R4/b Qc6c4+ WinAtChess.005 7k/p7/1R5K/6r1/6p1/6P1/8/8/w Rb6b7 WinAtChess.006 rnbqkb1r/pppp1ppp/8/4P3/6n1/7P/PPPNPPP1/R1BQKBNR/b Ng4e3 WinAtChess.007 r4q1k/p2bR1rp/2p2Q1N/5p2/5p2/2P5/PP3PPP/R5K1/w Re7f7 WinAtChess.008 3q1rk1/p4pp1/2pb3p/3p4/6Pr/1PNQ4/P1PB1PP1/4RRK1/b Bd6h2+ WinAtChess.009 2br2k1/2q3rn/p2NppQ1/2p1P3/Pp5R/4P3/1P3PPP/3R2K1/w Rh4xNh7 WinAtChess.010 r1b1kb1r/3q1ppp/pBp1pn2/8/Np3P2/5B2/PPP3PP/R2Q1RK1/w Bf3xPc6 WinAtChess.011 4k1r1/2p3r1/1pR1p3/3pP2p/3P2qP/P4N2/1PQ4P/5R1K/b Qg4xNf3+ WinAtChess.012 5rk1/pp4p1/2n1p2p/2Npq3/2p5/6P1/P3P1BP/R4Q1K/w Qf1xRf8+ WinAtChess.013 r2rb1k1/pp1q1p1p/2n1p1p1/2bp4/5P2/PP1BPR1Q/1BPN2PP/R5K1/w Qh3xPh7+ WinAtChess.014 1R6/1brk2p1/4p2p/p1P1Pp2/P7/6P1/1P4P1/2R3K1/w Rb8xBb7 WinAtChess.015 r4rk1/ppp2ppp/2n5/2bqp3/8/P2PB3/1PP1NPPP/R2Q1RK1/w Ne2c3 WinAtChess.016 1k5r/pppbn1pp/4q1r1/1P3p2/2NPp3/1QP5/P4PPP/R1B1R1K1/w Nc4e5 WinAtChess.017 R7/P4k2/8/8/8/8/r7/6K1/w Ra8h8 WinAtChess.018 r1b2rk1/ppbn1ppp/4p3/1QP4q/3P4/N4N2/5PPP/R1B2RK1/w Pc5c6 WinAtChess.019 r2qkb1r/1ppb1ppp/p7/4p3/P1Q1P3/2P5/5PPP/R1B2KNR/b Bd7b5 WinAtChess.020 5rk1/1b3p1p/pp3p2/3n1N2/1P6/P1qB1PP1/3Q3P/4R1K1/w Qd2h6 WinAtChess.021 r1bqk2r/ppp1nppp/4p3/n5N1/2BPp3/P1P5/2P2PPP/R1BQK2R/w Ng5xPf7,Bc4a2 WinAtChess.022 r3nrk1/2p2p1p/p1p1b1p1/2NpPq2/3R4/P1N1Q3/1PP2PPP/4R1K1/w Pg2g4 WinAtChess.023 6k1/1b1nqpbp/pp4p1/5P2/1PN5/4Q3/P5PP/1B2B1K1/b Bg7d4 WinAtChess.024 3R1rk1/8/5Qpp/2p5/2P1p1q1/P3P3/1P2PK2/8/b Qg4h4+ WinAtChess.025 3r2k1/1p1b1pp1/pq5p/8/3NR3/2PQ3P/PP3PP1/6K1/b Bd7f5 WinAtChess.026 7k/pp4np/2p3p1/3pN1q1/3P4/Q7/1r3rPP/2R2RK1/w Qa3f8+ WinAtChess.027 1r1r2k1/4pp1p/2p1b1p1/p3R3/RqBP4/4P3/1PQ2PPP/6K1/b Qb4e1+ WinAtChess.028 r2q2k1/pp1rbppp/4pn2/2P5/1P3B2/6P1/P3QPBP/1R3RK1/w Pc5c6 WinAtChess.029 1r3r2/4q1kp/b1pp2p1/5p2/pPn1N3/6P1/P3PPBP/2QRR1K1/w Ne4xPd6 WinAtChess.030 rb3qk1/pQ3ppp/4p3/3P4/8/1P3N2/1P3PPP/3R2K1/w Pd5d6,Qb7xRa8,Pd5xPe6 WinAtChess.031 6k1/p4p1p/1p3np1/2q5/4p3/4P1N1/PP3PPP/3Q2K1/w Qd1d8+ WinAtChess.032 8/p1q2pkp/2Pr2p1/8/P3Q3/6P1/5P1P/2R3K1/w Qe4e5+,Qe4f4 WinAtChess.033 7k/1b1r2p1/p6p/1p2qN2/3bP3/3Q4/P5PP/1B1R3K/b Bd4g1 WinAtChess.034 r3r2k/2R3pp/pp1q1p2/8/3P3R/7P/PP3PP1/3Q2K1/w Rh4xPh7+ WinAtChess.035 3r4/2p1rk2/1pQq1pp1/7p/1P1P4/P4P2/6PP/R1R3K1/b Re7e1+ WinAtChess.036 2r5/2rk2pp/1pn1pb2/pN1p4/P2P4/1N2B3/nPR1KPPP/3R4/b Nc6xPd4+ WinAtChess.037 4k3/p4prp/1p6/2b5/8/2Q3P1/P2R1PKP/4q3/w Rd2d8+ WinAtChess.038 r1br2k1/pp2bppp/2nppn2/8/2P1PB2/2N2P2/PqN1B1PP/R2Q1R1K/w Nc3a4 WinAtChess.039 3r1r1k/1p4pp/p4p2/8/1PQR4/6Pq/P3PP2/2R3K1/b Rd8c8 WinAtChess.040 1k6/5RP1/1P6/1K6/6r1/8/8/8/w Kb5a5,Kb5c5 WinAtChess.041 r1b1r1k1/pp1n1pbp/1qp3p1/3p4/1B1P4/Q3PN2/PP2BPPP/R4RK1/w Bb4a5 WinAtChess.042 r2q3k/p2P3p/1p3p2/3QP1r1/8/B7/P5PP/2R3K1/w Ba3e7,Qd5xRa8 WinAtChess.043 3rb1k1/pq3pbp/4n1p1/3p4/2N5/2P2QB1/PP3PPP/1B1R2K1/b Pd5xNc4 WinAtChess.044 7k/2p1b1pp/8/1p2P3/1P3r2/2P3Q1/1P5P/R4qBK/b Qf1xRa1 WinAtChess.045 r1bqr1k1/pp1nb1p1/4p2p/3p1p2/3P4/P1N1PNP1/1PQ2PP1/3RKB1R/w Nc3b5 WinAtChess.046 r1b2rk1/pp2bppp/2n1pn2/q5B1/2BP4/2N2N2/PP2QPPP/2R2RK1/b Nc6xPd4 WinAtChess.047 1rbq1rk1/p1p1bppp/2p2n2/8/Q1BP4/2N5/PP3PPP/R1B2RK1/b Rb8b4 WinAtChess.048 2b3k1/4rrpp/p2p4/2pP2RQ/1pP1Pp1N/1P3P1P/1q6/6RK/w Qh5xPh7+ WinAtChess.049 k4r2/1R4pb/1pQp1n1p/3P4/5p1P/3P2P1/r1q1R2K/8/w Rb7xPb6+ WinAtChess.050 r1bq1r2/pp4k1/4p2p/3pPp1Q/3N1R1P/2PB4/6P1/6K1/w Rf4g4+ WinAtChess.051 r1k5/1p3q2/1Qpb4/3N1p2/5Pp1/3P2Pp/PPPK3P/4R3/w Re1e7 WinAtChess.052 6k1/6p1/p7/3Pn3/5p2/4rBqP/P4RP1/5QK1/b Re3e1 WinAtChess.053 r3kr2/1pp4p/1p1p4/7q/4P1n1/2PP2Q1/PP4P1/R1BB2K1/b Qh5h1+ WinAtChess.054 r3r1k1/pp1q1pp1/4b1p1/3p2B1/3Q1R2/8/PPP3PP/4R1K1/w Qd4xPg7+ WinAtChess.055 r1bqk2r/pppp1ppp/5n2/2b1n3/4P3/1BP3Q1/PP3PPP/RNB1K1NR/b Bc5xPf2+ WinAtChess.056 r3q1kr/ppp5/3p2pQ/8/3PP1b1/5R2/PPP3P1/5RK1/w Rf3f8+ WinAtChess.057 8/8/2R5/1p2qp1k/1P2r3/2PQ2P1/5K2/8/w Qd3d1+ WinAtChess.058 r1b2rk1/2p1qnbp/p1pp2p1/5p2/2PQP3/1PN2N1P/PB3PP1/3R1RK1/w Nc3d5 WinAtChess.059 rn1qr1k1/1p2np2/2p3p1/8/1pPb4/7Q/PB1P1PP1/2KR1B1R/w Qh3h8+ WinAtChess.060 3qrbk1/ppp1r2n/3pP2p/3P4/2P4P/1P3Q2/PB6/R4R1K/w Qf3f7+ WinAtChess.061 6r1/3Pn1qk/p1p1P1rp/2Q2p2/2P5/1P4P1/P3R2P/5RK1/b Rg6xPg3+ WinAtChess.062 r1brnbk1/ppq2pp1/4p2p/4N3/3P4/P1PB1Q2/3B1PPP/R3R1K1/w Ne5xPf7 WinAtChess.063 8/6pp/3q1p2/3n1k2/1P6/3NQ2P/5PP1/6K1/w Pg2g4+ WinAtChess.064 1r1r1qk1/p2n1p1p/bp1Pn1pQ/2pNp3/2P2P1N/1P5B/P6P/3R1RK1/w Nd5e7+ WinAtChess.065 1k1r2r1/ppq5/1bp4p/3pQ3/8/2P2N2/PP4P1/R4R1K/b Qc7xQe5 WinAtChess.066 3r2k1/p2q4/1p4p1/3rRp1p/5P1P/6PK/P3R3/3Q4/w Re5xRd5 WinAtChess.067 6k1/5ppp/1q6/2b5/8/2R1pPP1/1P2Q2P/7K/w Qe2xPe3 WinAtChess.068 2k5/pppr4/4R3/4Q3/2pp2q1/8/PPP2PPP/6K1/w Pf2f3,Ph2h3 WinAtChess.069 2kr3r/pppq1ppp/3p1n2/bQ2p3/1n1PP3/1PN1BN1P/1PP2PP1/2KR3R/b Nb4a2+ WinAtChess.070 2kr3r/pp1q1ppp/5n2/1Nb5/2Pp1B2/7Q/P4PPP/1R3RK1/w Nb5xPa7+ WinAtChess.071 r3r1k1/pp1n1ppp/2p5/4Pb2/2B2P2/B1P5/P5PP/R2R2K1/w Pe5e6 WinAtChess.072 r1q3rk/1ppbb1p1/4Np1p/p3pP2/P3P3/2N4R/1PP1Q1PP/3R2K1/w Qe2d2 WinAtChess.073 5r1k/pp4pp/2p5/2b1P3/4Pq2/1PB1p3/P3Q1PP/3N2K1/b Qf4f1+ WinAtChess.074 r3r1k1/pppq1ppp/8/8/1Q4n1/7P/PPP2PP1/RNB1R1K1/b Qd7d6 WinAtChess.075 r1b1qrk1/2p2ppp/pb1pnn2/1p2pNB1/3PP3/1BP5/PP2QPPP/RN1R2K1/w Bg5xNf6 WinAtChess.076 3r2k1/ppp2ppp/6q1/b4n2/3nQB2/2p5/P4PPP/RN3RK1/b Nf5g3 WinAtChess.077 r2q3r/ppp2k2/4nbp1/5Q1p/2P1NB2/8/PP3P1P/3RR1K1/w Ne4g5+ WinAtChess.078 r3k2r/pbp2pp1/3b1n2/1p6/3P3p/1B2N1Pq/PP1PQP1P/R1B2RK1/b Qh3xPh2+ WinAtChess.079 r4rk1/p1B1bpp1/1p2pn1p/8/2PP4/3B1P2/qP2QP1P/3R1RK1/w Rd1a1 WinAtChess.080 r4rk1/1bR1bppp/4pn2/1p2N3/1P6/P3P3/4BPPP/3R2K1/b Be7d6 WinAtChess.081 3rr1k1/pp3pp1/4b3/8/2P1B2R/6QP/P3q1P1/5R1K/w Be4h7+ WinAtChess.082 3rr1k1/ppqbRppp/2p5/8/3Q1n2/2P3N1/PPB2PPP/3R2K1/w Qd4xBd7 WinAtChess.083 r2q1r1k/2p1b1pp/p1n5/1p1Q1bN1/4n3/1BP1B3/PP3PPP/R4RK1/w Qd5g8+ WinAtChess.084 kr2R3/p4r2/2pq4/2N2p1p/3P2p1/Q5P1/5P1P/5BK1/w Nc5a6 WinAtChess.085 8/p7/1ppk1n2/5ppp/P1PP4/2P1K1P1/5N1P/8/b Nf6g4+ WinAtChess.086 8/p3k1p1/4r3/2ppNpp1/PP1P4/2P3KP/5P2/8/b Re6xNe5 WinAtChess.087 r6k/p1Q4p/2p1b1rq/4p3/B3P3/4P3/PPP3P1/4RRK1/b Rg6xPg2+ WinAtChess.088 1r3b1k/p4rpp/4pp2/3q4/2ppbPPQ/6RK/PP5P/2B1NR2/b Pg7g5 WinAtChess.089 3qrrk1/1pp2pp1/1p2bn1p/5N2/2P5/P1P3B1/1P4PP/2Q1RRK1/w Nf5xPg7 WinAtChess.090 2qr2k1/4b1p1/2p2p1p/1pP1p3/p2nP3/PbQNB1PP/1P3PK1/4RB2/b Bb3e6 WinAtChess.091 r4rk1/1p2ppbp/p2pbnp1/q7/3BPPP1/2N2B2/PPP4P/R2Q1RK1/b Be6xPg4 WinAtChess.092 r1b1k1nr/pp3pQp/4pq2/3pn3/8/P1P5/2P2PPP/R1B1KBNR/w Bc1h6 WinAtChess.093 8/k7/p7/3Qp2P/n1P5/3KP3/1q6/8/b Pe5e4+ WinAtChess.094 2r5/1r6/4pNpk/3pP1qp/8/2P1QP2/5PK1/R7/w Nf6g4+ WinAtChess.095 r1b4k/ppp2Bb1/6Pp/3pP3/1qnP1p1Q/8/PPP3P1/1K1R3R/w Qh4d8+ WinAtChess.096 6k1/5p2/p5np/4B3/3P4/1PP1q3/P3r1QP/6RK/w Qg2a8+ WinAtChess.097 1r3rk1/5pb1/p2p2p1/Q1n1q2p/1NP1P3/3p1P1B/PP1R3P/1K2R3/b Nc5xPe4 WinAtChess.098 r1bq1r1k/1pp1Np1p/p2p2pQ/4R3/n7/8/PPPP1PPP/R1B3K1/w Re5h5 WinAtChess.099 8/k1b5/P4p2/1Pp2p1p/K1P2P1P/8/3B4/8/w Pb5b6+ WinAtChess.100 5rk1/p5pp/8/8/2Pbp3/1P4P1/7P/4RN1K/b Bd4c3 WinAtChess.101 2Q2n2/2R4p/1p1qpp1k/8/3P3P/3B2P1/5PK1/r7/w Qc8xNf8+ WinAtChess.102 6k1/2pb1r1p/3p1PpQ/p1nPp3/1q2P3/2N2P2/PrB5/2K3RR/w Qh6xPg6+ WinAtChess.103 b4r1k/pq2rp2/1p1bpn1p/3PN2n/2P2P2/P2B3K/1B2Q2N/3R2R1/w Qe2xNh5 WinAtChess.104 r2r2k1/pb3ppp/1p1bp3/7q/3n2nP/PP1B2P1/1B1N1P2/RQ2NRK1/b Qh5xPh4 WinAtChess.105 4rrk1/pppb4/7p/3P2pq/3Qn3/P5P1/1PP4P/R3RNNK/b Ne4f2+ WinAtChess.106 5n2/pRrk2p1/P4p1p/4p3/3N4/5P2/6PP/6K1/w Nd4b5 WinAtChess.107 r5k1/1q4pp/2p5/p1Q5/2P5/5R2/4RKPP/r7/w Qc5e5 WinAtChess.108 rn2k1nr/pbp2ppp/3q4/1p2N3/2p5/QP6/PB1PPPPP/R3KB1R/b Pc4c3 WinAtChess.109 2kr4/bp3p2/p2p2b1/P7/2q5/1N4B1/1PPQ2P1/2KR4/b Ba7e3 WinAtChess.110 6k1/p5p1/5p2/2P2Q2/3pN2p/3PbK1P/7P/6q1/b Qg1f1+ WinAtChess.111 r4kr1/ppp5/4bq1b/7B/2PR1Q1p/2N3P1/PP3P1P/2K1R3/w Re1xBe6 WinAtChess.112 rnbqkb1r/1p3ppp/5N2/1p2p1B1/2P5/8/PP2PPPP/R2QKB1R/b Qd8xNf6 WinAtChess.113 r1b1rnk1/1p4pp/p1p2p2/3pN2n/3P1PPq/2NBPR1P/PPQ5/2R3K1/w Bd3xPh7+ WinAtChess.114 4N2k/5rpp/1Q6/p3q3/8/P5P1/1P3P1P/5K2/w Ne8d6 WinAtChess.115 r2r2k1/2p2ppp/p7/1p2P1n1/P6q/5P2/1PB1QP1P/R5RK/b Rd8d2 WinAtChess.116 3r1rk1/q4ppp/p1Rnp3/8/1p6/1N3P2/PP3QPP/3R2K1/b Nd6e4 WinAtChess.117 r5k1/pb2rpp1/1p6/2p4q/5R2/2PB2Q1/P1P3PP/5R1K/w Rf4h4 WinAtChess.118 r2qr1k1/p1p2ppp/2p5/2b5/4nPQ1/3B4/PPP3PP/R1B2R1K/b Qd8xBd3 WinAtChess.119 r4rk1/1bn2qnp/3p1B1Q/p2P1pP1/1pp5/5N1P/PPB2P2/2KR3R/w Pg5g6 WinAtChess.120 6k1/5p1p/2bP2pb/4p3/2P5/1p1pNPPP/1P1Q1BK1/1q6/b Bc6xPf3+ WinAtChess.121 1k6/ppp4p/1n2pq2/1N2Rb2/2P2Q2/8/P4KPP/3r1B2/b Rd1xBf1+ WinAtChess.122 6k1/1b2rp2/1p4p1/3P4/PQ4P1/2N2q2/5P2/3R2K1/b Bb7xPd5,Re7c7 WinAtChess.123 6k1/3r4/2R5/P5P1/1P4p1/8/4rB2/6K1/b Pg4g3 WinAtChess.124 r1bqr1k1/pp3ppp/1bp5/3n4/3B4/2N2P1P/PPP1B1P1/R2Q1RK1/b Bb6xBd4+ WinAtChess.125 r5r1/pQ5p/1qp2R2/2k1p3/4P3/2PP4/P1P3PP/6K1/w Rf6xPc6+ WinAtChess.126 2k4r/1pr1n3/p1p1q2p/5pp1/3P1P2/P1P1P3/1R2Q1PP/1RB3K1/w Rb2xPb7 WinAtChess.127 6rk/1pp2Qrp/3p1B2/1pb1p2R/3n1q2/3P4/PPP3PP/R6K/w Qf7g6 WinAtChess.128 3r1r1k/1b2b1p1/1p5p/2p1Pp2/q1B2P2/4P2P/1BR1Q2K/6R1/b Bb7f3 WinAtChess.129 6k1/1pp3q1/5r2/1PPp4/3P1pP1/3Qn2P/3B4/4R1K1/b Qg7h6,Qg7h8 WinAtChess.130 2rq1bk1/p4p1p/1p4p1/3b4/3B1Q2/8/P4PpP/3RR1K1/w Re1e8 WinAtChess.131 4r1k1/5bpp/2p5/3pr3/8/1B3pPq/PPR2P2/2R2QK1/b Re5e1 WinAtChess.132 r1b1k2r/1pp1q2p/p1n3p1/3QPp2/8/1BP3B1/P5PP/3R1RK1/w Bg3h4 WinAtChess.133 3r2k1/p6p/2Q3p1/4q3/2P1p3/P3Pb2/1P3P1P/2K2BR1/b Rd8d1+ WinAtChess.134 3r1r1k/N2qn1pp/1p2np2/2p5/2Q1P2N/3P4/PP4PP/3R1RK1/b Ne6d4 WinAtChess.135 6kr/1q2r1p1/1p2N1Q1/5p2/1P1p4/6R1/7P/2R3K1/w Rc1c8+ WinAtChess.136 3b1rk1/1bq3pp/5pn1/1p2rN2/2p1p3/2P1B2Q/1PB2PPP/R2R2K1/w Rd1d7 WinAtChess.137 r1bq3r/ppppR1p1/5n1k/3P4/6pP/3Q4/PP1N1PP1/5K1R/w Ph4h5 WinAtChess.138 rnb3kr/ppp2ppp/1b6/3q4/3pN3/Q4N2/PPP2KPP/R1B1R3/w Ne4f6+ WinAtChess.139 r2b1rk1/pq4p1/4ppQP/3pB1p1/3P4/2R5/PP3PP1/5RK1/w Rc3c7 WinAtChess.140 4r1k1/p1qr1p2/2pb1Bp1/1p5p/3P1n1R/1B3P2/PP3PK1/2Q4R/w Qc1xNf4 WinAtChess.141 r2q3n/ppp2pk1/3p4/5Pr1/2NP1Qp1/2P2pP1/PP3K2/4R2R/w Re1e8,Pf5f6+ WinAtChess.142 5b2/pp2r1pk/2pp1pRp/4rP1N/2P1P3/1P4QP/P3q1P1/5R1K/w Rg6xPh6+ WinAtChess.143 r2q1rk1/pp3ppp/2p2b2/8/B2pPPb1/7P/PPP1N1P1/R2Q1RK1/b Pd4d3 WinAtChess.144 r1bq4/1p4kp/3p1n2/p4pB1/2pQ4/8/1P4PP/4RRK1/w Re1e8 WinAtChess.145 8/8/2Kp4/3P1B2/2P2k2/5p2/8/8/w Bf5c8 WinAtChess.146 r2r2k1/ppqbppbp/2n2np1/2pp4/6P1/1P1PPNNP/PBP2PB1/R2QK2R/b Nf6xPg4 WinAtChess.147 2r1k3/6pr/p1nBP3/1p3p1p/2q5/2P5/P1R4P/K2Q2R1/w Rg1xPg7 WinAtChess.148 6k1/6p1/2p4p/4Pp2/4b1qP/2Br4/1P2RQPK/8/b Be4xPg2 WinAtChess.149 r3r1k1/5p2/pQ1b2pB/1p6/4p3/6P1/Pq2BP1P/2R3K1/b Bd6f8,Bd6a3,Pe4e3 WinAtChess.150 8/3b2kp/4p1p1/pr1n4/N1N4P/1P4P1/1K3P2/3R4/w Na4c3 WinAtChess.151 1br2rk1/1pqb1ppp/p3pn2/8/1P6/P1N1PN1P/1B3PP1/1QRR2K1/w Nc3e4 WinAtChess.152 2r3k1/q4ppp/p3p3/pnNp4/2rP4/2P2P2/4R1PP/2R1Q1K1/b Nb5xPd4 WinAtChess.153 r1b2rk1/2p2ppp/p7/1p6/3P3q/1BP3bP/PP3QP1/RNB1R1K1/w Qf2xPf7+ WinAtChess.154 5bk1/1rQ4p/5pp1/2pP4/3n1PP1/7P/1q3BB1/4R1K1/w Pd5d6 WinAtChess.155 r1b1qN1k/1pp3p1/p2p3n/4p1B1/8/1BP4Q/PP3KPP/8/w Qh3xNh6+ WinAtChess.156 5rk1/p4ppp/2p1b3/3Nq3/4P1n1/1p1B2QP/1PPr2P1/1K2R2R/w Nd5e7+ WinAtChess.157 5rk1/n1p1R1bp/p2p4/1qpP1QB1/7P/2P3P1/PP3P2/6K1/w Re7xBg7+ WinAtChess.158 r1b2r2/5P1p/ppn3pk/2p1p1Nq/1bP1PQ2/3P4/PB4BP/1R3RK1/w Ng5e6+ WinAtChess.159 qn1kr2r/1pRbb3/pP5p/P2pP1pP/3N1pQ1/3B4/3B1PP1/R5K1/w Qg4xBd7+ WinAtChess.160 3r3k/3r1P1p/pp1Nn3/2pp4/7Q/6R1/Pq4PP/5RK1/w Qh4xRd8+ WinAtChess.161 r3kbnr/p4ppp/2p1p3/8/Q1B3b1/2N1B3/PP3PqP/R3K2R/w Bc4d5 WinAtChess.162 5rk1/2p4p/2p4r/3P4/4p1b1/1Q2NqPp/PP3P1K/R4R2/b Qf3g2+ WinAtChess.163 8/6pp/4p3/1p1n4/1NbkN1P1/P4P1P/1PR3K1/r7/w Rc2xBc4+ WinAtChess.164 1r5k/p1p3pp/8/8/4p3/P1P1R3/1P1Q1qr1/2KR4/w Re3e2 WinAtChess.165 r3r1k1/5pp1/p1p4p/2Pp4/8/q1NQP1BP/5PP1/4K2R/b Pd5d4 WinAtChess.166 7Q/ppp2q2/3p2k1/P2Ppr1N/1PP5/7R/5rP1/6K1/b Rf2xPg2+ WinAtChess.167 r3k2r/pb1q1p2/8/2p1pP2/4p1p1/B1P1Q1P1/P1P3K1/R4R2/b Qd7d2+ WinAtChess.168 5rk1/1pp3bp/3p2p1/2PPp3/1P2P3/2Q1B3/4q1PP/R5K1/b Bg7h6 WinAtChess.169 5r1k/6Rp/1p2p3/p2pBp2/1qnP4/4P3/Q4PPP/6K1/w Qa2xNc4 WinAtChess.170 2rq4/1b2b1kp/p3p1p1/1p1nNp2/7P/1B2B1Q1/PP3PP1/3R2K1/w Be3h6+ WinAtChess.171 5r1k/p5pp/8/1P1pq3/P1p2nR1/Q7/5BPP/6K1/b Qe5e1+ WinAtChess.172 2r1b3/1pp1qrk1/p1n1P1p1/7R/2B1p3/4Q1P1/PP3PP1/3R2K1/w Qe3h6+ WinAtChess.173 2r2rk1/6p1/p3pq1p/1p1b1p2/3P1n2/PP3N2/3N1PPP/1Q2RR1K/b Nf4xPg2 WinAtChess.174 r5k1/pppb3p/2np1n2/8/3PqNpP/3Q2P1/PPP5/R4RK1/w Nf4h5 WinAtChess.175 r1bq3r/ppp2pk1/3p1pp1/8/2BbPQ2/2NP2P1/PPP4P/R4R1K/b Rh8xPh2+ WinAtChess.176 r1b3r1/4qk2/1nn1p1p1/3pPp1P/p4P2/1p3BQN/PKPBN3/3R3R/b Qe7a3+ WinAtChess.177 3r2k1/p1rn1p1p/1p2pp2/6q1/3PQNP1/5P2/P1P4R/R5K1/w Nf4xPe6 WinAtChess.178 r1b2r1k/pp4pp/3p4/3B4/8/1QN3Pn/PP3q1P/R3R2K/b Qf2g1+ WinAtChess.179 r1q2rk1/p3bppb/3p1n1p/2nPp3/1p2P1P1/6NP/PP2QPB1/R1BNK2R/b Nf6xPd5 WinAtChess.180 r3k2r/2p2p2/p2p1n2/1p2p3/4P2p/1PPPPp1q/1P5P/R1N2QRK/b Nf6g4 WinAtChess.181 r1b2rk1/ppqn1p1p/2n1p1p1/2b3N1/2N5/PP1BP3/1B3PPP/R2QK2R/w Qd1h5 WinAtChess.182 1r2k1r1/5p2/b3p3/1p2b1B1/3p3P/3B4/PP2KP2/2R3R1/w Bg5f6 WinAtChess.183 4kn2/r4p1r/p3bQ2/q1nNP1Np/1p5P/8/PPP3P1/2KR3R/w Qf6e7+ WinAtChess.184 1r1rb1k1/2p3pp/p2q1p2/3PpP1Q/Pp1bP2N/1B5R/1P4PP/2B4K/w Qh5xPh7+ WinAtChess.185 r5r1/p1q2p1k/1p1R2pB/3pP3/6bQ/2p5/P1P1NPPP/6K1/w Bh6f8+ WinAtChess.186 6k1/5p2/p3p3/1p3qp1/2p1Qn2/2P1R3/PP1r1PPP/4R1K1/b Nf4h3+ WinAtChess.187 3RNbk1/pp3p2/4rQpp/8/1qr5/7P/P4P2/3R2K1/w Qf6g7+ WinAtChess.188 3r1k2/1ppPR1n1/p2p1rP1/3P3p/4Rp1N/5K2/P1P2P2/8/w Re7e8+ WinAtChess.189 8/p2b2kp/1q1p2p1/1P1Pp3/4P3/3B2P1/P2Q3P/2Nn3K/b Bd7h3 WinAtChess.190 2r1Rn1k/1p1q2pp/p7/5p2/3P4/1B4P1/P1P1QP1P/6K1/w Qe2c4 WinAtChess.191 r3k3/ppp2Npp/4Bn2/2b5/1n1pp3/N4P2/PPP3qP/R2QKR2/b Nb4d3+ WinAtChess.192 5bk1/p4ppp/Qp6/4B3/1P6/Pq2P1P1/2rr1P1P/R4RK1/b Qb3xPe3 WinAtChess.193 5rk1/ppq2ppp/2p5/4bN2/4P3/6Q1/PPP2PPP/3R2K1/w Nf5h6+ WinAtChess.194 3r1rk1/1p3p2/p3pnnp/2p3p1/2P2q2/1P5P/PB2QPPN/3RR1K1/w Pg2g3 WinAtChess.195 rr4k1/p1pq2pp/Q1n1pn2/2bpp3/4P3/2PP1NN1/PP3PPP/R1B1K2R/b Nc6b4 WinAtChess.196 7k/1p4p1/7p/3P1n2/4Q3/2P2P2/PP3qRP/7K/b Qf2f1+ WinAtChess.197 2br2k1/ppp2p1p/4p1p1/4P2q/2P1Bn2/2Q5/PP3P1P/4R1RK/b Rd8d3 WinAtChess.198 r1br2k1/pp2nppp/2n5/1B1q4/Q7/4BN2/PP3PPP/2R2RK1/w Rf1d1,Bb5xNc6 WinAtChess.199 2rqrn1k/pb4pp/1p2pp2/n2P4/2P3N1/P2B2Q1/1B3PPP/2R1R1K1/w Bb2xPf6 WinAtChess.200 2b2r1k/4q2p/3p2pQ/2pBp3/8/6P1/1PP2P1P/R5K1/w Ra1a7 WinAtChess.201 QR2rq1k/2p3p1/3p1pPp/8/4P3/8/P1r3PP/1R4K1/b Rc2xPa2 WinAtChess.202 r4rk1/5ppp/p3q1n1/2p2NQ1/4n3/P3P3/1B3PPP/1R3RK1/w Qg5h6 WinAtChess.203 r1b1qrk1/1p3ppp/p1p5/3Nb3/5N2/P7/1P4PQ/K1R1R3/w Re1xBe5 WinAtChess.204 r3rnk1/1pq2bb1/p4p2/3p1Pp1/3B2P1/1NP4R/P1PQB3/2K4R/w Qd2xPg5 WinAtChess.205 1Qq5/2P1p1kp/3r1pp1/8/8/7P/p4PP1/2R3K1/b Rd6c6 WinAtChess.206 r1bq2kr/p1pp1ppp/1pn1p3/4P3/2Pb2Q1/BR6/P4PPP/3K1BNR/w Qg4xPg7+ WinAtChess.207 3r1bk1/ppq3pp/2p5/2P2Q1B/8/1P4P1/P6P/5RK1/w Bh5f7+ WinAtChess.208 4kb1r/2q2p2/r2p4/pppBn1B1/P6P/6Q1/1PP5/2KRR3/w Re1xNe5+ WinAtChess.209 3r1rk1/pp1q1ppp/3pn3/2pN4/5PP1/P5PQ/1PP1B3/1K1R4/w Rd1h1 WinAtChess.210 r1bqrk2/pp1n1n1p/3p1p2/P1pP1P1Q/2PpP1NP/6R1/2PB4/4RBK1/w Qh5xNf7+ WinAtChess.211 rn1qr2Q/pbppk1p1/1p2pb2/4N3/3P4/2N5/PPP3PP/R4RK1/w Qh8xPg7+ WinAtChess.212 3r1r1k/1b4pp/ppn1p3/4Pp1R/Pn5P/3P4/4QP2/1qB1NKR1/w Rh5xPh7+ WinAtChess.213 r2r2k1/1p2qpp1/1np1p1p1/p3N3/2PPN3/bP5R/4QPPP/4R1K1/w Ne4g5 WinAtChess.214 3r2k1/pb1q1pp1/1p2pb1p/8/3N4/P2QB3/1P3PPP/1Br1R1K1/w Qd3h7+ WinAtChess.215 r2qr1k1/1b1nbppp/p3pn2/1p1pN3/3P1B2/2PB1N2/PP2QPPP/R4RK1/w Ne5xPf7 WinAtChess.216 r3kb1r/1pp3p1/p3bp1p/5q2/3QN3/1P6/PBP3P1/3RR1K1/w Qd4d7+ WinAtChess.217 6k1/pp5p/2p3q1/6BP/2nPr1Q1/8/PP3R1K/8/w Bg5h6 WinAtChess.218 7k/p4q1p/1pb5/2p5/4B2Q/2P1B3/P6P/7K/b Qf7f1+ WinAtChess.219 3rr1k1/ppp2ppp/8/5Q2/4n3/1B5R/PPP1qPP1/5RK1/b Qe2xRf1+ WinAtChess.220 r3k3/P5bp/2N1bp2/4p3/2p5/6NP/1PP2PP1/3R2K1/w Rd1d8+ WinAtChess.221 2r1r2k/1q3ppp/p2Rp3/2p1P3/6QB/p3P3/bP3PPP/3R2K1/w Bh4f6 WinAtChess.222 r1bqk2r/pp3ppp/5n2/8/1b1npB2/2N5/PP1Q2PP/1K2RBNR/w Nc3xPe4 WinAtChess.223 5rk1/p1q3pp/1p1r4/2p1pp1Q/1PPn1P2/3B3P/P2R2P1/3R2K1/b Rd6h6,Pe5e4 WinAtChess.224 4R3/4q1kp/6p1/1Q3b2/1P1b1P2/6KP/8/8/b Qe7h4+ WinAtChess.225 2b2rk1/p1p4p/2p1p1p1/br2N1Q1/1p2q3/8/PB3PPP/3R1RK1/w Ne5f7 WinAtChess.226 2k1rb1r/ppp3pp/2np1q2/5b2/2B2P2/2P1BQ2/PP1N1P1P/2KR3R/b Pd6d5 WinAtChess.227 r4rk1/1bq1bp1p/4p1p1/p2p4/3BnP2/1N1B3R/PPP3PP/R2Q2K1/w Bd3xNe4 WinAtChess.228 8/8/8/1p5r/p1p1k1pN/P2pBpP1/1P1K1P2/8/b Pb5b4,Rh5xNh4 WinAtChess.229 2b5/1r6/2kBp1p1/p2pP1P1/2pP4/1pP3K1/1R3P2/8/b Rb7b4 WinAtChess.230 r4rk1/1b1nqp1p/p5p1/1p2PQ2/2p5/5N2/PP3PPP/R1BR2K1/w Bc1g5 WinAtChess.231 1R2rq1k/2p3p1/Q2p1pPp/8/4P3/8/P1r3PP/1R4K1/w Rb8xRe8,Qa6b5 WinAtChess.232 5rk1/p1p2r1p/2pp2p1/4p3/PPPnP3/3Pq1P1/1Q1R1R1P/4NK2/b Nd4b3 WinAtChess.233 2kr1r2/p6p/5Pp1/2p5/1qp2Q1P/7R/PP6/1KR5/w Rh3b3 WinAtChess.234 5r2/1p1RRrk1/4Qq1p/1PP3p1/8/4B3/1b3P1P/6K1/w Re7xRf7+,Qe6xRf7+ WinAtChess.235 1R6/p5pk/4p2p/4P3/8/2r3qP/P3R1b1/4Q1K1/b Rc3c1 WinAtChess.236 r5k1/pQp2qpp/8/4pbN1/3P4/6P1/PPr4P/1K1R3R/b Rc2c1+ WinAtChess.237 1k1r4/pp1r1pp1/4n1p1/2R5/2Pp1qP1/3P2QP/P4PB1/1R4K1/w Bg2xPb7 WinAtChess.238 8/6k1/5pp1/Q6p/5P2/6PK/P4q1P/8/b Qf2f1+ WinAtChess.239 2b4k/p1b2p2/2p2q2/3p1PNp/3P2R1/3B4/P1Q2PKP/4r3/w Qc2xPc6 WinAtChess.240 2rq1rk1/pp3ppp/2n2b2/4NR2/3P4/PB5Q/1P4PP/3R2K1/w Qh3xPh7+ WinAtChess.241 r1b1r1k1/pp1nqp2/2p1p1pp/8/4N3/P1Q1P3/1P3PPP/1BRR2K1/w Rd1xNd7 WinAtChess.242 1r3r1k/3p4/1p1Nn1R1/4Pp1q/pP3P1p/P7/5Q1P/6RK/w Qf2e2 WinAtChess.243 r6r/pp3ppp/3k1b2/2pb4/B4Pq1/2P1Q3/P5PP/1RBR2K1/w Qe3xPc5+ WinAtChess.244 4rrn1/ppq3bk/3pPnpp/2p5/2PB4/2NQ1RPB/PP5P/5R1K/w Qd3xPg6+ WinAtChess.245 6R1/4qp1p/ppr1n1pk/8/1P2P1QP/6N1/P4PP1/6K1/w Qg4h5+ WinAtChess.246 2k1r3/1p2Bq2/p2Qp3/Pb1p1p1P/2pP1P2/2P5/2P2KP1/1R6/w Rb1xBb5 WinAtChess.247 5r1k/1p4pp/3q4/3Pp1R1/8/8/PP4PP/4Q1K1/b Qd6c5+ WinAtChess.248 r4rk1/pbq2pp1/1ppbpn1p/8/2PP4/1P1Q1N2/PBB2PPP/R3R1K1/w Pd4d5!,Pc4c5 WinAtChess.249 1b5k/7P/p1p2np1/2P2p2/PP3P2/4RQ1R/q2r3P/6K1/w Re3e8+ WinAtChess.250 k7/p4p2/P1q1b1p1/3p3p/3Q4/7P/5PP1/1R4K1/w Qd4e5,Qd4f4 WinAtChess.251 1rb1r1k1/p1p2ppp/5n2/2pP4/5P2/2QB4/qNP3PP/2KRB2R/b Re8e2 WinAtChess.252 k5r1/p4b2/2P5/5p2/3P1P2/4QBrq/P5P1/4R1K1/w Qe3e8+ WinAtChess.253 r6k/pp3p1p/2p1bp1q/b3p3/4Pnr1/2PP2NP/PP1Q1PPN/R2B2RK/b Nf4xPh3 WinAtChess.254 3r3r/p4pk1/5Rp1/3q4/1p1P2RQ/5N2/P1P4P/2b4K/w Rf6xPg6+ WinAtChess.255 3r1rk1/1pb1qp1p/2p3p1/p7/P2Np2R/1P5P/1BP2PP1/3Q1BK1/w Nd4f5 WinAtChess.256 4r1k1/pq3p1p/2p1r1p1/2Q1p3/3nN1P1/1P6/P1P2P1P/3RR1K1/w Rd1xNd4 WinAtChess.257 r3brkn/1p5p/2p2Ppq/2Pp3B/3Pp2Q/4P1R1/6PP/5R1K/w Bh5xPg6 WinAtChess.258 r1bq1rk1/ppp2ppp/2np4/2bN1PN1/2B1P3/3p4/PPP2nPP/R1BQ1K1R/w Qd1h5 WinAtChess.259 2r2b1r/p1Nk2pp/3p1p2/N2Qn3/4P3/q6P/P4PP1/1R3K1R/w Qd5e6+ WinAtChess.260 r5k1/1bp3pp/p2p4/1p6/5p2/1PBP1nqP/1PP3Q1/R4R1K/b Nf3d4 WinAtChess.261 6k1/p1B1b2p/2b3r1/2p5/4p3/1PP1N1Pq/P2R1P2/3Q2K1/b Rg6h6 WinAtChess.262 rnbqr2k/pppp1Qpp/8/b2NN3/2B1n3/8/PPPP1PPP/R1B1K2R/w Qf7g8+ WinAtChess.263 r2r2k1/1R2qp2/p5pp/2P5/b1PN1b2/P7/1Q3PPP/1B1R2K1/b Ra8b8 WinAtChess.264 2r1k2r/2pn1pp1/1p3n1p/p3PP2/4q2B/P1P5/2Q1N1PP/R4RK1/w Pe5xNf6 WinAtChess.265 r3q2r/2p1k1p1/p5p1/1p2Nb2/1P2nB2/P7/2PNQbPP/R2R3K/b Rh8xPh2+ WinAtChess.266 2r1kb1r/pp3ppp/2n1b3/1q1N2B1/1P2Q3/8/P4PPP/3RK1NR/w Nd5c7+ WinAtChess.267 2r3kr/ppp2n1p/7B/5q1N/1bp5/2Pp4/PP2RPPP/R2Q2K1/w Re2e8+ WinAtChess.268 2kr2nr/pp1n1ppp/2p1p3/q7/1b1P1B2/P1N2Q1P/1PP1BPP1/R3K2R/w Pa3xBb4 WinAtChess.269 2r1r1k1/pp1q1ppp/3p1b2/3P4/3Q4/5N2/PP2RPPP/4R1K1/w Qd4g4 WinAtChess.270 2kr4/ppp3Pp/4RP1B/2r5/5P2/1P6/P2p4/3K4/w Re6d6 WinAtChess.271 nrq4r/2k1p3/1p1pPnp1/pRpP1p2/P1P2P2/2P1BB2/1R2Q1P1/6K1/w Be3xPc5 WinAtChess.272 2k4B/bpp1qp2/p1b5/7p/1PN1n1p1/2Pr4/P5PP/R3QR1K/b Ne4g3+ WinAtChess.273 8/1p6/p5R1/k7/Prpp4/K7/1NP5/8/w Rg6b6 WinAtChess.274 r1b2rk1/1p1n1ppp/p1p2q2/4p3/P1B1Pn2/1QN2N2/1P3PPP/3R1RK1/b Nf4xPg2,Pb7b5 WinAtChess.275 r5k1/pp1RR1pp/1b6/6r1/2p5/B6P/P4qPK/3Q4/w Qd1d5+ WinAtChess.276 1r4r1/p2kb2p/bq2p3/3p1p2/5P2/2BB3Q/PP4PP/3RKR2/b Rg8xPg2,Rg8g3 WinAtChess.277 r2qkb1r/pppb2pp/2np1n2/5pN1/2BQP3/2N5/PPP2PPP/R1B1K2R/w Bc4f7+ WinAtChess.278 r7/4b3/2p1r1k1/1p1pPp1q/1P1P1P1p/PR2NRpP/2Q3K1/8/w Ne3xPf5 WinAtChess.279 r1r2bk1/5p1p/pn4p1/N2b4/3Pp3/B3P3/2q1BPPP/RQ3RK1/b Bf8xBa3 WinAtChess.280 2R5/2R4p/5p1k/6n1/8/1P2QPPq/r7/6K1/w Rc7xPh7+ WinAtChess.281 6k1/2p3p1/1p1p1nN1/1B1P4/4PK2/8/2r3b1/7R/w Rh1h8+ WinAtChess.282 3q1rk1/4bp1p/1n2P2Q/3p1p2/6r1/Pp2R2N/1B4PP/7K/w Nh3g5 WinAtChess.283 3r3k/pp4pp/8/1P6/3N4/Pn2P1qb/1B1Q2B1/2R3K1/w Nd4f5 WinAtChess.284 2rr3k/1b2bppP/p2p1n2/R7/3P4/1qB2P2/1P4Q1/1K5R/w Qg2xPg7+ WinAtChess.285 3r1k2/1p6/p4P2/2pP2Qb/8/1P1KB3/P6r/8/b Rd8xPd5+ WinAtChess.286 rn3k1r/pp2bBpp/2p2n2/q5N1/3P4/1P6/P1P3PP/R1BQ1RK1/w Qd1h5 WinAtChess.287 r1b2rk1/p4ppp/1p1Qp3/4P2N/1P6/8/P3qPPP/3R1RK1/w Nh5f6+ WinAtChess.288 2r3k1/5p1p/p3q1p1/2n3P1/1p1QP2P/1P4N1/PK6/2R5/b Qe6e5 WinAtChess.289 2k2r2/2p5/1pq5/p1p1n3/P1P2n1B/1R4Pp/2QR4/6K1/b Nf4e2+ WinAtChess.290 5r1k/3b2p1/p6p/1pRpR3/1P1P2q1/P4pP1/5QnP/1B4K1/w Ph2h3 WinAtChess.291 4r3/1Q1qk2p/p4pp1/3Pb3/P7/6PP/5P2/4R1K1/w Pd5d6+ WinAtChess.292 1nbq1r1k/3rbp1p/p1p1pp1Q/1p6/P1pPN3/5NP1/1P2PPBP/R4RK1/w Nf3g5 WinAtChess.293 3r3k/1r3p1p/p1pB1p2/8/p1qNP1Q1/P6P/1P4P1/3R3K/w Bd6f8,Nd4f5,Qg4f4 WinAtChess.294 4r3/p4r1p/R1p2pp1/1p1bk3/4pNPP/2P1K3/2P2P2/3R4/w Rd1xBd5+ WinAtChess.295 3r4/1p3k1p/p1b1p1p1/4Q1Pn/2B3KP/4pP2/PP2R1N1/6q1/b Rd8d4 WinAtChess.296 3r1rk1/p3qp1p/2bb2p1/2p5/3P4/1P6/PBQN1PPP/2R2RK1/b Bc6xPg2!,Bd6xPh2+ WinAtChess.297 3Q4/p3b1k1/2p2rPp/2q5/4B3/P2P4/7P/6RK/w Qd8h8+ WinAtChess.298 1n2rr2/1pk3pp/pNn2p2/2N1p3/8/6P1/PP2PPKP/2RR4/w Nc5a4 WinAtChess.299 b2b1r1k/3R1ppp/4qP2/4p1PQ/4P3/5B2/4N1K1/8/w Pg5g6 WinAtChess.300 gnuchess-4.0.pl70/test/CHESSTEST/testall100755 21542 13 1273 5556701677 16742 0ustar cracraftuser#!/bin/csh -x rm ../test/CHESSTEST/testlog rm ./test/CHESSTEST/*.testx* rm testx?? foreach i (../test/CHESSTEST/*.fin) echo $i # The last 2 arguments of testgen are the timing info for the test # number of moves time in minutes # 1 2 is 1 move in 2 minutes ../test/CHESSTEST/testgen $i bk testx 1 1 0 date>type foreach j (testx*) echo $i $j ./gnuchessr < $j |& tee -a type |& grep My >> $i.$j rm CL* end date>type rm bk*0 rm bk*1 rm bk*2 rm bk*3 rm bk*4 rm bk*5 rm bk*6 rm bk*7 rm bk*8 rm bk*9 rm testx* end foreach i (../test/CHESSTEST/*.testx??) ../test/CHESSTEST/cmpr $i $i.ANS >>../test/CHESSTEST/testlog end ../test/CHESSTEST/score ../test/CHESSTEST/testlog > ../test/CHESSTEST/test.result gnuchess-4.0.pl70/test/CHESSTEST/README100644 21542 13 2237 5527662451 16217 0ustar cracraftuserChess Test Suite by Kevin Lang and Warren Smith. The test suite is in the files ending with ".fin". Total of 5551 positions as of June 1993. Some extra positions are in "oldpos.wds", but they are not converted into our standard format. Also, "plagiarism" contains known repeats. The files ending ".gnu" are the results of a run of gnuchess 4.0 pl62, running on SGI Indigos with 50MHz R4000 MIPS RISC processors, at 1 minute CPU time per problem, on the corresponding .fin files. The ".gnu15" files are same but with 15 minutes CPU time per problem. The files ending ".ps" are documentation explaining everything. They need to be printed out on a "postscript" printer. "samplepos.ps" is the chessboard figure filling the blank spot on page 4 of "testpos.ps", which is the main item of documentation, in fact is the article we submitted to ICCA Journal. Please send known corrections, etc to Warren Smith: NEC Research Institute (Room 1D04) 4 Independence Way Princeton NJ 08540 USA Email: wds@research.NJ.NEC.COM Please note any modifications to the test suite below the line, with dates, name of modifier etc.: ---------------------------------------------------------------- gnuchess-4.0.pl70/test/CHESSTEST/Makefile100644 21542 13 461 5554026020 16736 0ustar cracraftuserMAKEFILE= Makefile ROOTDIR = $$HOME CC = $(CPREFIX)gcc -I/usr/ucbinclude # Directory where program is installed all: cmpr testgen score test: cmpr testgen score cd ../../src; ../test/CHESSTEST/testall cmpr: cmpr.c $(CC) $? -o $@ testgen: testgen.c $(CC) $? -o $@ score: score.c $(CC) $? -o $@ gnuchess-4.0.pl70/test/CHESSTEST/testpos.ps100644 21542 13 552537 5527662451 17461 0ustar cracraftuser%!PS-Adobe-2.0 %%Creator: dvips 5.47 Copyright 1986-91 Radical Eye Software %%Title: testpos.dvi %%Pages: 10 1 %%BoundingBox: 0 0 612 792 %%EndComments %%BeginProcSet: tex.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /exch load def /X{S N}B /TR /translate load N /isls false N /vsize 10 N /@rigin{ isls{[0 1 -1 0 0 0]concat}if 72 Resolution div 72 VResolution div neg scale Resolution VResolution vsize neg mul TR matrix currentmatrix dup dup 4 get round 4 exch put dup dup 5 get round 5 exch put setmatrix}N /@letter{/vsize 10 N}B /@landscape{/isls true N /vsize -1 N}B /@a4{/vsize 10.6929133858 N}B /@a3{ /vsize 15.5531 N}B /@ledger{/vsize 16 N}B /@legal{/vsize 13 N}B /@manualfeed{ statusdict /manualfeed true put}B /@copies{/#copies X}B /FMat[1 0 0 -1 0 0]N /FBB[0 0 0 0]N /nn 0 N /IE 0 N /ctr 0 N /df-tail{/nn 8 dict N nn begin /FontType 3 N /FontMatrix fntrx N /FontBBox FBB N string /base X array /BitMaps X /BuildChar{CharBuilder}N /Encoding IE N end dup{/foo setfont}2 array copy cvx N load 0 nn put /ctr 0 N[}B /df{/sf 1 N /fntrx FMat N df-tail} B /dfs{div /sf X /fntrx[sf 0 0 sf neg 0 0]N df-tail}B /E{pop nn dup definefont setfont}B /ch-width{ch-data dup length 5 sub get}B /ch-height{ch-data dup length 4 sub get}B /ch-xoff{128 ch-data dup length 3 sub get sub}B /ch-yoff{ ch-data dup length 2 sub get 127 sub}B /ch-dx{ch-data dup length 1 sub get}B /ch-image{ch-data dup type /stringtype ne{ctr get /ctr ctr 1 add N}if}B /id 0 N /rw 0 N /rc 0 N /gp 0 N /cp 0 N /G 0 N /sf 0 N /CharBuilder{save 3 1 roll S dup /base get 2 index get S /BitMaps get S get /ch-data X pop /ctr 0 N ch-dx 0 ch-xoff ch-yoff ch-height sub ch-xoff ch-width add ch-yoff setcachedevice ch-width ch-height true[1 0 0 -1 -.1 ch-xoff sub ch-yoff .1 add]{ch-image} imagemask restore}B /D{/cc X dup type /stringtype ne{]}if nn /base get cc ctr put nn /BitMaps get S ctr S sf 1 ne{dup dup length 1 sub dup 2 index S get sf div put}if put /ctr ctr 1 add N}B /I{cc 1 add D}B /bop{userdict /bop-hook known{bop-hook}if /SI save N @rigin 0 0 moveto}N /eop{clear SI restore showpage userdict /eop-hook known{eop-hook}if}N /@start{userdict /start-hook known{start-hook}if /VResolution X /Resolution X 1000 div /DVImag X /IE 256 array N 0 1 255{IE S 1 string dup 0 3 index put cvn put}for}N /p /show load N /RMat[1 0 0 -1 0 0]N /BDot 260 string N /rulex 0 N /ruley 0 N /v{/ruley X /rulex X V}B /V statusdict begin /product where{pop product dup length 7 ge{0 7 getinterval(Display)eq}{pop false}ifelse}{false}ifelse end{{gsave TR -.1 -.1 TR 1 1 scale rulex ruley false RMat{BDot}imagemask grestore}}{{gsave TR -.1 -.1 TR rulex ruley scale 1 1 false RMat{BDot}imagemask grestore}}ifelse B /a{ moveto}B /delta 0 N /tail{dup /delta X 0 rmoveto}B /M{S p delta add tail}B /b{ S p tail}B /c{-4 M}B /d{-3 M}B /e{-2 M}B /f{-1 M}B /g{0 M}B /h{1 M}B /i{2 M}B /j{3 M}B /k{4 M}B /w{0 rmoveto}B /l{p -4 w}B /m{p -3 w}B /n{p -2 w}B /o{p -1 w }B /q{p 1 w}B /r{p 2 w}B /s{p 3 w}B /t{p 4 w}B /x{0 S rmoveto}B /y{3 2 roll p a}B /bos{/SS save N}B /eos{clear SS restore}B end %%EndProcSet TeXDict begin 1000 300 300 @start /Fa 17 118 df<0020004001800380030006000E001C 001C003C0038003800780078007800F800F000F000F000F000F000F000F000F000F000F8007800 78007800380038003C001C001C000E000600030003800180004000200B297C9E13>40 D<800040003000380018000C000E000700070007800380038003C003C003C003E001E001E001E0 01E001E001E001E001E001E003E003C003C003C0038003800780070007000E000C001800380030 00400080000B297D9E13>I<78FCFCFCFC7806067D850D>46 D<00600001E0000FE000FFE000F3 E00003E00003E00003E00003E00003E00003E00003E00003E00003E00003E00003E00003E00003 E00003E00003E00003E00003E00003E00003E00003E0007FFF807FFF80111B7D9A18>49 D<1801801FFF001FFE001FFC001FF8001FC00018000018000018000018000019F8001E0E00180F 801007800007C00007E00007E00007E07807E0F807E0F807E0F807C0F007C0600F80381F001FFE 0007F000131B7E9A18>53 D<000FF008007FFE3801FC07F807E001F80F8000781F0000783F0000 383E0000387E0000187C000018FC000000FC000000FC000000FC000000FC000000FC000000FC00 7FFFFC007FFF7C0001F87E0001F83E0001F83F0001F81F0001F80F8001F807E001F801FC07F800 7FFE78000FF818201C7D9B26>71 D<03FC000E0E001C1F003C1F00781F00780E00F80000F80000 F80000F80000F80000F800007800007801803C01801C03000E0E0003F80011127E9115>99 D<01FC000F07001C03803C01C07801C07801E0F801E0F801E0FFFFE0F80000F80000F800007800 007C00603C00601E00C00F038001FC0013127F9116>101 D104 D<1E003F003F003F003F001E00000000000000000000000000FF00FF001F001F001F001F 001F001F001F001F001F001F001F001F001F001F00FFE0FFE00B1E7F9D0E>I108 D II114 D<1FD830786018E018E018F000FF807FE07FF01FF807FC007CC01CC01CE01CE0 18F830CFC00E127E9113>I<0300030003000300070007000F000F003FFCFFFC1F001F001F001F 001F001F001F001F001F001F0C1F0C1F0C1F0C0F08079803F00E1A7F9913>II E /Fb 2 63 df<60F0F06004047C830C>58 D62 D E /Fc 19 116 df<000101808053>48 D<00000000F80000000000000001040000000000000002020000 000000000002020000000000000002020000000000000002020000000000000002020000000000 000001040000000000000000F80000000000000000500000000000000000880000000000000001 040000000000000006030000000000000008008000000000000030006000000000000040001000 000000000180000C00000000000200000200000000000400000100000000000800000080000000 001000200040000000002000200020000000004000200010000000004000200010000000008000 200008000000008000200008000000008007FF0008000000010000200004000000010000200004 000000010000200004000000010000200004000000010000200004000000010000000004000000 010000000004000000008000000008000000008000000008000000004000000010000000004000 000010000000002000000020000000001007FF00400000000008F800F880000000000700000700 000000000400000100000000000400000100000000000400000100000000000400000100000000 000800000080000000000807FF008000000000087800F080000000000980000C80000000001600 0003400000000018000000C0000000000600000300000000000180000C0000000000007800F000 000000000007FF000000000000000104000000000000000202000000000000000C018000000000 0180F000780C0000007E7F000007F3F000038000000000000E000C000000200000018010000000 D800000040600000030600000030800003FC01FE0000084007FC000001FF001020380000000000 E02010C000000000001840090000000000000480060000000000000300454779CA53>66 D74 D76 DI79 D<000003F800000000000C06 000000000010010000000000200080000000002000800000000040004000000000400040000000 004000400000000040004000000000400040000000002000800000000020008000000000100100 00000000080200000000001E0F00000000006000C0000000018000300000000200000800000004 000004000000080000020000000800000200000010000001000000100000010000002000000080 000020000000800000200000008000002000000080000020000000800000200000008000001000 000100000010000001000000080000020000000800000200000004000004000000020000080000 000180003000000000400040000000018000300000000600000C00000008000002000000300000 018000004000000040000080000000200001000000001000020000000008000400000000040004 000000000400080000000002001000000000010010000000000100200000000000802000000000 008040000000000040400000000000404000000000004040000000000040800000000000208000 000000002080000000000020800000000000208000000000002080000000000020800000000000 208000000000002080000000000020800000000000207FFFFFFFFFFFC0334370CA53>I<1FF807 FFC03FF010080400402010100804004020101008040040201010080400402010100FFC007FE010 10000000000010100000000000101000000000001010000000000010100000000000101FFFFFFF FFFFF0080000000000200400000000004003000000000180008000000002000040000000040000 300000001800001FFFFFFFF0000010000000100000100000001000001000000010000010000000 100000100000001000001000000010000010000000100000100000001000001000000010000010 000000100000100000001000001000000010000010000000100000100000001000001000000010 000010000000100000100000001000001000000010000010000000100000100000001000001000 000010000010000000100000100000001000001FFFFFFFF0000020000000080000400000000800 00800000000400008000000002000100000000010002000000000080040000000000400FFFFFFF FFFFE0080000000000200800000000002008000000000020080000000000200800000000002008 000000000020FFFFFFFFFFFFFE8000000000000280000000000002800000000000028000000000 000280000000000002FFFFFFFFFFFFFE374072C753>82 DI90 D<00000001F00000000000000003F80000000000000007FC0000000000000007FC000000000000 0007FC0000000000000007FC0000000000000007FC0000000000000003F80000000000000001F0 0000000000000000400000000000000001F00000000000000003F80000000000000007FC000000 000000001FFF000000000000003FFF80000000000000FFFFE0000000000001FFFFF00000000000 07FFFFFC00000000000FFFFFFE00000000001FFFFFFF00000000003FFFFFFF80000000007FFF9F FFC000000000FFFF9FFFE000000000FFFF9FFFE000000001FFFF9FFFF000000001FFF001FFF000 000001FFF001FFF000000003FFFF9FFFF800000003FFFF9FFFF800000003FFFF9FFFF800000003 FFFF9FFFF800000003FFFFFFFFF800000003FFFFFFFFF800000003FFFFFFFFF800000001FFFFFF FFF000000001FFFFFFFFF000000000FFFFFFFFE000000000FFFFFFFFE0000000007FF803FFC000 0000003F80003F80000000001E03F80F00000000000E3FFF8E000000000007FFFFFC0000000000 07FFFFFC00000000000FFFFFFE00000000000FFFFFFE00000000000FFFFFFE00000000000FF001 FE00000000001F80003F00000000001E07FC0F0000000000183FFF83000000000018FFFFE30000 0000000BFFFFFA000000000003FFFFF8000000000000FFFFE00000000000000FFE000000000000 0001F00000000000000003F8000000000000000FFE000000000000003FFF80000000003FFFFFFF FFFF800003FFFFFFFFFFFFF8000FFFFFFFFFFFFFFE001FFFFFFF1FFFFFFF007FFFFFFC07FFFFFF C0FFFFFFE000FFFFFFE0FFFC0000000007FFE07FC000000000007FC03F0000000000001F801C00 00000000000700080000000000000200434778CA53>98 D106 D108 DI<0000000080000000000000C00180000000000000F003C000 0000000000F807C0000000000000FE0FC0000000000000FF9FE0000000000000FFFFE000000000 0000FFFFF0000000000000FFFFF0000000000000FFFFFFFE00000000007FFFF003C000000000FF FFF0003000000000FFFFFFF80800000001FFFFFFFF8600000003FFFFFFFFE100000007FFFFFFFF F08000000FFFFFFFFFFC4000001FFFFFFFFFFE2000003FC7FFFFFFFF1000003F8FFFFFFFFF8000 003F0FFFFFFFFFC800003F1FFFFFFFFFC400003E3FFFFFFFFFE400003C7FFFFFFFFFE200003DFF FFFFFFFFF200003FFFFFFFFFFFF100007FFFFFFFFFFFF900007FFFFFFFFFFFF80000FFFFFFFFFF FFFC8000FFFFFFFFFFFFFC8001FFFFFFFFFFFFFC4001FFFFFFFFFFFFFE4003FFFFFFFFFFFFFE40 07FFFFFFFFFFFFFE200FFFFFFFFFFFFFFF200FFFFFFFCFFFFFFF201FFFFFFF8FFFFFFF203FFFFF FE0FFFFFFF103FFFFFFC0FFFFFFF907FFFFFF00FFFFFFF907FFFFFC00FFFFFFF9079FFFF000FFF FFFF88F0FFFC000FFFFFFFC8E0FFF8001FFFFFFFC8E1FFF0001FFFFFFFC8E3FFE0001FFFFFFFCC EFFFC0001FFFFFFFC47FFFC0003FFFFFFFE47FFF80003FFFFFFFE43FFF80007FFFFFFFE41FFF00 00FFFFFFFFE407FF0000FFFFFFFFE6007E0001FFFFFFFFE6007C0003FFFFFFFFE200380007FFFF FFFFF20000000FFFFFFFFFF20000001FFFFFFFFFF20000003FFFFFFFFFF20000007FFFFFFFFFF3 000000FFFFFFFFFFF3000001FFFFFFFFFFF3000003FFFFFFFFFFF3000003FFFFFFFFFFF1000007 FFFFFFFFFFF9000007FFFFFFFFFFF900000FFFFFFFFFFFF900000FFFFFFFFFFFF900000FFFFFFF FFFFF900000FFFFFFFFFFFF900000FFFFFFFFFFFFF00000FFFFFFFFFFFFF48477BCC53>II<000003F800000000000FFE00000000001FFF00000000003FFF80000000003FFF800000 00007FFFC0000000007FFFC0000000007FFFC0000000007FFFC0000000007FFFC0000000003FFF 80000000003FFF80000000001FFF00000000000FFE00000000000FFE00000000007FFFC0000000 01FFFFF000000003FFFFF800000007FFFFFC00000007FFFFFC0000000FFFFFFE0000000FFFFFFE 0000001FFFFFFF0000001FFFFFFF0000001FFFFFFF0000001FFFFFFF0000001FFFFFFF0000001F FFFFFF0000001FFFFFFF0000001FFFFFFF0000000FFFFFFE0000000FFFFFFE00000007FFFFFC00 000007FFFFFC00000003FFFFF800000001FFFFF0000000007FFFC000000000FFFFE000000003FF FFF80000000FFFFFFE0000003FFFFFFF8000007FFFFFFFC00000FFFFFFFFE00001FFFFFFFFF000 03FFFFFFFFF80007FFFFFFFFFC0007FFFFFFFFFC000FFFFFFFFFFE001FFFFFFFFFFF001FFFFFFF FFFF003FFFFFFFFFFF803FFFFFFFFFFF803FFFFFFFFFFF807FFFFFFFFFFFC07FFFFFFFFFFFC07F FFFFFFFFFFC0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFF FFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFF FFFFFFFFE0334370CA53>I<3FF007FF007FE03FF007FF007FE03FF007FF007FE03FF007FF007F E03FF007FF007FE03FFFFFFFFFFFE03FFFFFFFFFFFE03FFFFFFFFFFFE03FFFFFFFFFFFE03FFFFF FFFFFFE030000000000060300000000000400FFFFFFFFFFF8007FFFFFFFFFE0001FFFFFFFFFC00 00FFFFFFFFF0000030000000600000100000004000001FFFFFFFC000001FFFFFFFC000001FFFFF FFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC00000 1FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFF C000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001F FFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC00000100000004000001000000060 00003FFFFFFFF000007FFFFFFFF80000FFFFFFFFFC0001FFFFFFFFFE0003FFFFFFFFFF00000000 00000000080000000000800FFFFFFFFFFF800FFFFFFFFFFF800FFFFFFFFFFF800FFFFFFFFFFF80 0FFFFFFFFFFF8008000000000080080000000000F8FFFFFFFFFFFFF8FFFFFFFFFFFFF8FFFFFFFF FFFFF8FFFFFFFFFFFFF8FFFFFFFFFFFFF8FFFFFFFFFFFFF8353F71C653>114 DI E /Fd 13 122 df<1FFFFC38381C203808603808403808407008807008007000 00700000E00000E00000E00000E00001C00001C00001C00001C000038000038000038000038000 0780007FF80016177A961A>84 D<072008E018E0306030C060C060C060C0C180C188C188438865 9038E00D0E7C8D12>97 D<07001880304060404080FF00C000C000C0008000C040C08043003C00 0A0E7B8D10>101 D<001C0036002E006C00600060006000C000C007FC00C000C001C001800180 01800180018003000300030003000300060006006600E400C80070000F1D81960B>I<1F000600 0600060006000C000C000C000C0019C01A601C201830306030603060306060C060C461846188C0 98C0E00E177D9612>104 D<030706000000000000384C4C4C8C18181830326262243808177D96 0B>I<3E0C0C0C0C181818183030303060606060C0D0D0D0D06007177C9609>108 D<387044984708460C8C180C180C180C18183018311861186230263038100E7D8D14>110 D<078018C0304060606060C060C060C06080C080C08180C10046003C000B0E7B8D12>I<38F045 18463846308C000C000C000C001800180018001800300030000D0E7D8D0F>114 D<07800C4018E018E038001E001F8007C000C060C0E0C0C180C3003E000B0E7D8D0F>I<030003 000600060006000600FF800C000C000C001800180018001800300031003100310032001C000914 7D930C>I<1C0826184618461886300C300C300C30186018601860186008C007C000C000807180 730066003C000D147D8D11>121 D E /Fe 9 58 df<0C003C00CC000C000C000C000C000C000C 000C000C000C000C000C000C00FF8009107E8F0F>49 D<1F00618040C08060C0600060006000C0 0180030006000C00102020207FC0FFC00B107F8F0F>I<1F00218060C060C000C0008001800F00 008000400060C060C060804060801F000B107F8F0F>I<0300030007000F000B00130033002300 4300C300FFE003000300030003001FE00B107F8F0F>I<20803F002C002000200020002F003080 2040006000600060C06080C061801F000B107F8F0F>I<0780184030C060C06000C000CF00F080 E040C060C060C060406060C030801F000B107F8F0F>I<40007FE07FC080808080010002000400 04000C0008000800180018001800180018000B117E900F>I<1F00318060C060C060C071803F00 0F00338061C0C060C060C060404060801F000B107F8F0F>I<1F00318060C0C040C060C060C060 40E021E01E600060004060C0608043003E000B107F8F0F>I E /Ff 56 121 df<60F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0600000000060F0F0600419779816>33 D<01C00001C00001C00001C00071C700F9CF807FFF001FFC0007F00007F0001FFC007FFF00F9CF 8071C70001C00001C00001C00001C00011127E9516>42 D<01C00001C00001C00001C00001C000 01C00001C00001C000FFFF80FFFF80FFFF8001C00001C00001C00001C00001C00001C00001C000 01C00011137E9516>I<387C7E7E3E0E1E1C78F060070B798416>II<70F8F8F8700505788416>I<000180000380000380000700000700000E00000E00001C00 001C0000380000380000700000700000E00000E00001C00001C000038000038000070000070000 0E00000E00001C00001C0000380000380000700000700000E00000E00000C0000011207E9C16> I<03E0000FF8001FFC001E3C00380E00780F00700700700700E00380E00380E00380E00380E003 80E00380E00380E00380F00780700700700700780F003C1E001E3C001FFC000FF80003E0001119 7E9816>I<01800380038007800F807F80FF807380038003800380038003800380038003800380 038003800380038003807FF87FFC7FF80E197C9816>I<07E0001FF8003FFC00783E00E00700F0 0780F00380600380000380000380000700000700000E00001C0000380000700000E00001C00003 80000F00001E03803803807FFF80FFFF807FFF8011197E9816>I<07E0001FF8003FFC00781E00 780700300700000700000700000E00003E0007FC0007F00007FC00001E00000700000300000380 000380600380F00380E00700781E003FFC001FF80007E00011197E9816>I<007C0000FC0000DC 0001DC00039C00039C00071C000F1C000E1C001E1C003C1C00381C00781C00F01C00FFFFE0FFFF E0FFFFE0001C00001C00001C00001C00001C0001FFC001FFC001FFC013197F9816>I<3FFE003F FE003FFE003800003800003800003800003800003800003800003BF0003FFC003FFE003C0F0030 0700000380000380600380F00380F00380E00700781E003FFC001FF80007E00011197E9816>I< 00F80003FC0007FE000F07001C0F00380F00780600700000700000E3F800EFFC00FFFE00F80F00 F00700F00380E00380E003807003807003807007803807003C1E001FFC000FF80003E00011197E 9816>II<07F0001FFC003FFE007C1F00F00780E00380E00380E003807007007C 1F001FFC0007F0001FFC003C1E00700700F00780E00380E00380E00380F007807007007C1F003F FE001FFC0007F00011197E9816>I<7FFF00FFFF80FFFF80000000000000000000000000000000 FFFF80FFFF807FFF00110B7E9116>61 D<0FE03FF87FFCF01EF00EF00E601E003C007800F001C0 038003800380038003800300000000000000000003000780078003000F197D9816>63 D<00F80003FC0007FE000F07001C3F80387F8078FF8071C3C071C3C0E381C0E381C0E381C0E381 C0E381C0E381C0E381C071C38071C38078FF00387E001C3C000F03C007FFC003FF0000FC001219 7E9816>I<7FF800FFFE007FFF001C0F001C07801C03801C03801C03801C07801C07001FFF001F FE001FFE001C1F001C03801C03C01C01C01C01C01C01C01C01C01C03C01C07807FFF80FFFF007F FC0012197F9816>66 D<01F18007FB800FFF801F0F803C0780380380700380700380F00000E000 00E00000E00000E00000E00000E00000E00000F000007003807003803803803C07001F0F000FFE 0007FC0001F00011197E9816>I<7FFFC0FFFFC07FFFC01C01C01C01C01C01C01C01C01C00001C 00001C1C001C1C001FFC001FFC001FFC001C1C001C1C001C00001C00E01C00E01C00E01C00E01C 00E07FFFE0FFFFE07FFFE013197F9816>69 DI<07FE07FF07FE00380038003800380038 003800380038003800380038003800380038003800386038F038F0707FF07FE01F8010197D9816 >74 D<7F0FE0FF8FF07F0FE01C07801C0F001C0E001C1C001C3C001C78001CF0001CE0001DF000 1FF0001FF8001F38001E1C001C1C001C0E001C0E001C07001C07001C03807F07E0FF8FF07F07E0 1419809816>I77 D<7E1FC0FF3FE07F1FC01D07001D87001D87001D87001DC7001DC700 1CC7001CC7001CE7001CE7001CE7001C67001C67001C77001C77001C37001C37001C37001C1700 7F1F00FF9F007F0F0013197F9816>I<1FFC003FFE007FFF00780F00F00780E00380E00380E003 80E00380E00380E00380E00380E00380E00380E00380E00380E00380E00380E00380F00780F007 80780F007FFF003FFE001FFC0011197E9816>I<7FF800FFFE007FFF001C0F801C03801C03C01C 01C01C01C01C01C01C03C01C03801C0F801FFF001FFE001FF8001C00001C00001C00001C00001C 00001C00001C00007F0000FF80007F000012197F9816>I<1FFC003FFE007FFF00780F00F00780 E00380E00380E00380E00380E00380E00380E00380E00380E00380E00380E00380E00380E00380 E0E380E1E380F0F780787F007FFF003FFE001FFC00001C00001E00000E00000F00000700000700 111F7E9816>I<7FE000FFF8007FFC001C1E001C0F001C07001C07001C07001C07001C0F001C1E 001FFC001FF8001FFC001C1C001C0E001C0E001C0E001C0E001C0E201C0E701C0E707F07E0FF87 E07F03C014197F9816>I<07E3001FFF003FFF00781F00F00700E00700E00700E00000F0000078 00003F80001FF00007FC0000FE00000F00000700000380000380600380E00380E00700F80F00FF FE00FFFC00C7F00011197E9816>I<7FFFE0FFFFE0FFFFE0E0E0E0E0E0E0E0E0E0E0E0E000E000 00E00000E00000E00000E00000E00000E00000E00000E00000E00000E00000E00000E00000E000 00E00007FC000FFE0007FC0013197F9816>I<7FFF80FFFF80FFFF80E00700E00F00E01E00E01C 00003C0000780000700000F00001E00001C00003C0000780000700000F00001E03801C03803C03 80780380700380FFFF80FFFF80FFFF8011197E9816>90 D<1FE0003FF0007FF800783C00300E00 000E00000E0003FE001FFE003E0E00700E00E00E00E00E00E00E00783E007FFFE03FE7E00F83E0 13127E9116>97 D<7E0000FE00007E00000E00000E00000E00000E00000E3E000EFF000FFF800F 83C00F00E00E00E00E00700E00700E00700E00700E00700E00700E00E00F01E00F83C00FFF800E FF00063C001419809816>I<03F80FFC1FFE3C1E780C7000E000E000E000E000E000F000700778 073E0E1FFC0FF803F010127D9116>I<003F00007F00003F0000070000070000070000070003C7 000FF7001FFF003C1F00780F00700700E00700E00700E00700E00700E00700E00700700F00700F 003C1F001FFFE00FE7F007C7E014197F9816>I<03E00FF81FFC3C1E780E7007E007FFFFFFFFFF FFE000E000700778073C0F1FFE0FFC03F010127D9116>I<001F00007F8000FF8001E78001C300 01C00001C0007FFF00FFFF00FFFF0001C00001C00001C00001C00001C00001C00001C00001C000 01C00001C00001C00001C0003FFE007FFF003FFE0011197F9816>I<03E3C007F7E00FFFE01C1C C0380E00380E00380E00380E00380E001C1C000FF8001FF0001BE0003800001800001FFC001FFF 003FFF807803C0E000E0E000E0E000E0E000E07001C07C07C03FFF800FFE0003F800131C7F9116 >I<7E0000FE00007E00000E00000E00000E00000E00000E3C000EFE000FFF000F87800F03800E 03800E03800E03800E03800E03800E03800E03800E03800E03800E03807FC7F0FFE7F87FC7F015 19809816>I<018003C003C0018000000000000000007FC07FC07FC001C001C001C001C001C001 C001C001C001C001C001C001C07FFFFFFF7FFF101A7D9916>I<7E0000FE00007E00000E00000E 00000E00000E00000E7FE00E7FE00E7FE00E0F000E1E000E3C000E78000EF0000FF0000FF8000F BC000F1E000E0E000E07000E07807F87F0FFCFF07F87F01419809816>107 DII<7E3C00FEFE007FFF000F8780 0F03800E03800E03800E03800E03800E03800E03800E03800E03800E03800E03807FC7F0FFE7F8 7FC7F01512809116>I<03E0000FF8001FFC003C1E00780F00700700E00380E00380E00380E003 80E00380F00780700700780F003C1E001FFC000FF80003E00011127E9116>I<7E3E00FEFF007F FF800F83C00F00E00E00E00E00700E00700E00700E00700E00700E00700E00E00F01E00F83C00F FF800EFF000E3C000E00000E00000E00000E00000E00000E00007FC000FFE0007FC000141B8091 16>I<07C7000FE7001FF7003C1F00700F00700F00E00700E00700E00700E00700E00700E00700 700F00700F003C3F003FF7001FE70007C700000700000700000700000700000700000700003FE0 007FF0003FE0141B7E9116>II<0FEC3FFC 7FFCF03CE01CE01C70007F801FF007F8003C600EE00EF00EF81EFFFCFFF8C7E00F127D9116>I< 0300000700000700000700000700007FFF00FFFF00FFFF00070000070000070000070000070000 07000007000007010007038007038007038007870003FE0001FC0000F80011177F9616>I<7E1F 80FE3F807E1F800E03800E03800E03800E03800E03800E03800E03800E03800E03800E03800E03 800E0F800FFFF007FBF803E3F01512809116>I119 D<7F1FC07F3FC07F1FC00F1C00073C0003B80003F00001F00000E00001E00001F00003 B800073C00071C000E0E007F1FC0FF3FE07F1FC013127F9116>I E /Fg 9 58 df<0C001C00EC000C000C000C000C000C000C000C000C000C000C000C000C000C000C000C 00FFC00A137D9211>49 D<1F0060C06060F070F030603000700070006000C001C0018002000400 0810101020207FE0FFE00C137E9211>I<0FC030707038703870380038003000E00FC000700038 0018001C601CF01CF018E03860701FC00E137F9211>I<006000E000E00160026006600C600860 106020606060C060FFFC0060006000600060006003FC0E137F9211>I<60607FC07F8044004000 400040004F0070C040E0006000700070E070E070E06040E021C01F000C137E9211>I<07C00C20 1070207060006000C000CF00D0C0E060C020C030C030C03040306020206010C00F000C137E9211 >I<40007FFC7FF8401080108020004000800100010003000200060006000E000E000E000E000E 0004000E147E9311>I<0FC0107020186018601870183C303F600F800FE031F06078C01CC00CC0 0CC00C601830300FC00E137F9211>I<0F00308060404060C020C030C030C0304030607030B00F 30003000200060E040E08041003E000C137E9211>I E /Fh 1 4 df<0C000C008C40EDC07F800C 007F80EDC08C400C000C000A0B7D8B10>3 D E /Fi 4 121 df<400020C000606000C030018018 03000C0600060C0003180001B00000E00000E00001B000031800060C000C060018030030018060 00C0C0006040002013147A9320>2 D<000001800000078000001E00000078000001E000000780 00001E00000078000001E00000078000001E00000078000000E0000000780000001E0000000780 000001E0000000780000001E0000000780000001E0000000780000001E00000007800000018000 0000000000000000000000000000000000000000000000000000007FFFFF00FFFFFF8019227D99 20>20 D<07C000201FE000203FF80020783C0060E01F00E0C00783C08003FF808000FF0080007C 000000000007C000201FE000203FF80020783C0060E01F00E0C00783C08003FF808000FF008000 7C001B137E9320>25 D<1F00308070406060E0E0E0E0E040E00060007000300018001C00330071 8061C0E0C0E0E0E0E0E0E060E070C031C0198007000300018001C000C000E040E0E0E0E0E0C0C0 41C021801F000B257D9C12>120 D E /Fj 42 122 df<0001FC000703000C03001C07001C0300 180000380000380000380000380000700007FFFC00701C00701C00701C00E03800E03800E03800 E03800E07001C07001C07001C07001C0E201C0E201C0E20380E403806403803803800003000007 0000060000C60000E40000CC00007000001825819C17>12 D<3078F06005047C830D>46 D<00020006000C001C007C039C0038003800380038007000700070007000E000E000E000E001C0 01C001C001C003800380038003800780FFF00F1C7C9B15>49 D<003C0000C30001018002018002 01C00441C00441C00841C00841C00841C01083801083801107000E0600000C0000180000300000 C0000100000600000800001001001002002002004006007E0C00C7F80083F80080E000121D7C9B 15>I<003E0000C1800101800200C00400C00440C00841C00841C00841C0088380070380000700 000E0001F800003800000C00000C00000E00000E00000E00000E00700E00E01C00801C00803800 80300040600021C0001F0000121D7C9B15>I<0001800001C00003800003800003800003000007 00000700000600000E00000C00001C0000180000180000300000300000600000400000C600018E 00010E00020E00061C000C1C00181C003F1C0040F800803F000038000038000070000070000070 0000700000E00000600012247E9B15>I<00C06000FFC001FF8001FE0001000001000002000002 0000020000020000047800058C00060600040600080600000700000700000600000E00000E0070 0E00700C00E01C0080180080380040300040600021C0001F0000131D7C9B15>I<000F00003080 00C0800183800383800300000600000E00000C00001C00001CF0003B18003C0C00380C00780C00 700E00700E00700E00601C00E01C00E01C00E01C00E03800E03800E0700060600060C000218000 1E0000111D7B9B15>I<09C04017E0801FE0803C6100302700601A00400600400400800C008008 0000180000100000300000600000600000600000C00000C00001C0000180000380000380000300 000700000700000700000E00000E00000C0000121D799B15>I<060F0F06000000000000000000 003078F06008127C910D>58 D<0000180000001800000038000000380000007800000078000000 B8000001B800000138000002380000023C0000041C0000041C0000081C0000181C0000101C0000 201C0000201C00007FFC0000401C0000801C0001801C0001001C0002001C0002001C0004000E00 0C000E001C001E00FF00FFC01A1D7E9C1F>65 D<0003F020001E0C60003002E000E003C001C001 C0038001C0070000C00E0000801E0000801C0000803C0000803C00000078000000780000007800 0000F0000000F0000000F0000000F0000000F0000400F0000400F0000400F00008007000080070 00100038002000180040000C0180000706000001F800001B1E7A9C1E>67 D<01FFFFE0003C00E0003800600038004000380040003800400070004000700040007020400070 200000E0400000E0400000E0C00000FFC00001C0800001C0800001C0800001C080000381010003 8001000380020003800200070004000700040007000C00070018000E007800FFFFF0001B1C7D9B 1C>69 D<01FFFFC0003C01C0003800C00038008000380080003800800070008000700080007020 800070200000E0400000E0400000E0C00000FFC00001C0800001C0800001C0800001C080000381 0000038000000380000003800000070000000700000007000000070000000F000000FFF000001A 1C7D9B1B>I<01FFCFFE003C01E0003801C0003801C0003801C0003801C0007003800070038000 7003800070038000E0070000E0070000E0070000FFFF0001C00E0001C00E0001C00E0001C00E00 03801C0003801C0003801C0003801C00070038000700380007003800070038000F007800FFE7FF 001F1C7D9B1F>72 D<01FFE0003C00003800003800003800003800007000007000007000007000 00E00000E00000E00000E00001C00001C00001C00001C000038008038008038008038010070010 0700300700600700E00E03C0FFFFC0151C7D9B1A>76 D<0007F000001C1C0000700E0000E00700 01C0038003800380070003800E0003C01E0003C01C0003C03C0003C03C0003C0780003C0780003 C0780003C0F0000780F0000780F0000780F0000F00F0000F00F0000E00F0001E00F0003C007000 3800700070007800E0003801C0001C0380000E0E000003F800001A1E7A9C20>79 D<01FFFC00003C070000380380003801C0003801C0003801C0007003C0007003C0007003C00070 038000E0078000E0070000E00E0000E0380001FFE00001C0000001C0000001C000000380000003 8000000380000003800000070000000700000007000000070000000F000000FFE000001A1C7D9B 1C>I<1FFFFFC01C0701C0300E00C0200E0080600E0080400E0080401C0080801C0080801C0080 001C0000003800000038000000380000003800000070000000700000007000000070000000E000 0000E0000000E0000000E0000001C0000001C0000001C0000001C0000003C000007FFE00001A1C 799B1E>84 D87 D<03CC063C0C3C181C3838303870387038E070E070E070E070E0E2C0E2C0E261E462643C38 0F127B9115>97 D<3F00070007000E000E000E000E001C001C001C001C0039C03E603830383070 38703870387038E070E070E070E060E0E0C0C0C1C0618063003C000D1D7B9C13>I<01F007080C 08181C3838300070007000E000E000E000E000E000E008E010602030C01F000E127B9113>I<00 1F80000380000380000700000700000700000700000E00000E00000E00000E0003DC00063C000C 3C00181C00383800303800703800703800E07000E07000E07000E07000E0E200C0E200C0E20061 E4006264003C3800111D7B9C15>I<01E007100C1018083810701070607F80E000E000E000E000 E000E0086010602030C01F000D127B9113>I<0003C0000670000C70001C60001C00001C000038 0000380000380000380000380003FF8000700000700000700000700000700000E00000E00000E0 0000E00000E00001C00001C00001C00001C00001C0000380000380000380000300000300000700 00C60000E60000CC00007800001425819C0D>I<00F3018F030F06070E0E0C0E1C0E1C0E381C38 1C381C381C383830383038187818F00F700070007000E000E0C0C0E1C0C3007E00101A7D9113> I<0FC00001C00001C0000380000380000380000380000700000700000700000700000E78000E8C 000F0E000E0E001C0E001C0E001C0E001C0E00381C00381C00381C003838007038807038807070 80707100E03200601C00111D7D9C15>I<01800380010000000000000000000000000000001C00 2600470047008E008E000E001C001C001C0038003800710071007100720072003C00091C7C9B0D >I<0FC00001C00001C0000380000380000380000380000700000700000700000700000E0F000E 11000E23800E43801C83001C80001D00001E00003F800039C00038E00038E00070E20070E20070 E20070E400E06400603800111D7D9C13>107 D<1F800380038007000700070007000E000E000E 000E001C001C001C001C0038003800380038007000700070007000E400E400E400E40068003800 091D7C9C0B>I<3C1E0780266318C04683A0E04703C0E08E0380E08E0380E00E0380E00E0380E0 1C0701C01C0701C01C0701C01C070380380E0388380E0388380E0708380E0710701C0320300C01 C01D127C9122>I<3C3C002646004687004707008E07008E07000E07000E07001C0E001C0E001C 0E001C1C00381C40381C40383840383880701900300E0012127C9117>I<01E007180C0C180C38 0C300E700E700EE01CE01CE01CE018E038E030E06060C031801E000F127B9115>I<07870004D9 8008E0C008E0C011C0E011C0E001C0E001C0E00381C00381C00381C00381800703800703000707 000706000E8C000E70000E00000E00001C00001C00001C00001C00003C0000FF8000131A7F9115 >I<3C3C26C2468747078E068E000E000E001C001C001C001C0038003800380038007000300010 127C9112>114 D<01F006080C080C1C18181C001F001FC00FF007F0007800386030E030C03080 6060C01F000E127D9111>I<00C001C001C001C00380038003800380FFE00700070007000E000E 000E000E001C001C001C001C00384038403840388019000E000B1A7D990E>I<1E030027070047 0700470700870E00870E000E0E000E0E001C1C001C1C001C1C001C1C0038388038388018388018 39001C5900078E0011127C9116>I<1E06270E470E4706870287020E020E021C041C041C041C08 18083808181018200C4007800F127C9113>I<1E01832703874703874703838707018707010E07 010E07011C0E021C0E021C0E021C0E04180C04181C04181C081C1C100C263007C3C018127C911C >I<1E03270747074707870E870E0E0E0E0E1C1C1C1C1C1C1C1C38383838183818381C7007F000 70007000E0E0C0E1C0818047003C00101A7C9114>121 D E /Fk 85 124 df<007E1F0001C1B1800303E3C00703C3C00E03C1800E01C0000E01C0000E01C0000E01C0000E 01C0000E01C000FFFFFC000E01C0000E01C0000E01C0000E01C0000E01C0000E01C0000E01C000 0E01C0000E01C0000E01C0000E01C0000E01C0000E01C0000E01C0000E01C0000E01C0007F87FC 001A1D809C18>11 D<007E0001C1800301800703C00E03C00E01800E00000E00000E00000E0000 0E0000FFFFC00E01C00E01C00E01C00E01C00E01C00E01C00E01C00E01C00E01C00E01C00E01C0 0E01C00E01C00E01C00E01C00E01C07F87F8151D809C17>I<007FC001C1C00303C00703C00E01 C00E01C00E01C00E01C00E01C00E01C00E01C0FFFFC00E01C00E01C00E01C00E01C00E01C00E01 C00E01C00E01C00E01C00E01C00E01C00E01C00E01C00E01C00E01C00E01C07FCFF8151D809C17 >I<003F07E00001C09C18000380F018000701F03C000E01E03C000E00E018000E00E000000E00 E000000E00E000000E00E000000E00E00000FFFFFFFC000E00E01C000E00E01C000E00E01C000E 00E01C000E00E01C000E00E01C000E00E01C000E00E01C000E00E01C000E00E01C000E00E01C00 0E00E01C000E00E01C000E00E01C000E00E01C000E00E01C007FC7FCFF80211D809C23>I<60F0 F0F0F0F0F0F060606060606060606060606060000000000060F0F060041E7C9D0C>33 D<6060F0F0F8F86868080808080808101010102020404080800D0C7F9C15>I<00030180000301 80000301800006030000060300000603000006030000060300000C0600000C0600000C0600000C 060000180C007FFFFFF8FFFFFFFC00301800003018000030180000301800006030000060300000 60300000603000FFFFFFFC7FFFFFF800C060000180C0000180C0000180C0000180C00003018000 0301800003018000030180000603000006030000060300001E257E9C23>I<0F0000C0188000C0 30600380703807006027FB00E0100600E0100C00E0100C00E0101800E0101800E0103000E01060 00602060007020C00030418000188180000F0303C00006062000060C10000C1C08001818080018 380400303804006038040060380400C0380400C03804018038040300180803001C0806000C100C 000620040003C01E217E9E23>37 D<60F0F8680808081010204080050C7C9C0C>39 D<004000800100020006000C000C0018001800300030007000600060006000E000E000E000E000 E000E000E000E000E000E000E000E000600060006000700030003000180018000C000C00060002 000100008000400A2A7D9E10>I<800040002000100018000C000C000600060003000300038001 800180018001C001C001C001C001C001C001C001C001C001C001C001C001800180018003800300 0300060006000C000C00180010002000400080000A2A7E9E10>I<60F0F0701010101020204080 040C7C830C>44 DI<60F0F06004047C830C>I<00010003000600060006 000C000C000C0018001800180030003000300060006000C000C000C00180018001800300030003 00060006000C000C000C00180018001800300030003000600060006000C000C00010297E9E15> I<03C00C301818300C300C700E60066006E007E007E007E007E007E007E007E007E007E007E007 E007E00760066006700E300C300C18180C3007E0101D7E9B15>I<030007003F00C70007000700 070007000700070007000700070007000700070007000700070007000700070007000700070007 000F80FFF80D1C7C9B15>I<07C01830201C400C400EF00FF80FF807F8077007000F000E000E00 1C001C00380070006000C00180030006010C01180110023FFE7FFEFFFE101C7E9B15>I<07E018 30201C201C781E780E781E381E001C001C00180030006007E00030001C001C000E000F000F700F F80FF80FF80FF00E401C201C183007E0101D7E9B15>I<000C00000C00001C00003C00003C0000 5C0000DC00009C00011C00031C00021C00041C000C1C00081C00101C00301C00201C00401C00C0 1C00FFFFC0001C00001C00001C00001C00001C00001C00001C0001FFC0121C7F9B15>I<300C3F F83FF03FC020002000200020002000200023E024302818301C200E000E000F000F000F600FF00F F00FF00F800E401E401C2038187007C0101D7E9B15>I<00F0030C06040C0E181E301E300C7000 70006000E3E0E430E818F00CF00EE006E007E007E007E007E007600760077006300E300C18180C 3003E0101D7E9B15>I<4000007FFF807FFF007FFF004002008004008004008008000010000010 0000200000600000400000C00000C00001C0000180000180000380000380000380000380000780 00078000078000078000078000078000030000111D7E9B15>I<03E00C301008200C2006600660 0660067006780C3E083FB01FE007F007F818FC307E601E600FC007C003C003C003C00360026004 300C1C1007E0101D7E9B15>I<03C00C301818300C700C600EE006E006E007E007E007E007E007 6007700F300F18170C2707C700060006000E300C780C78187010203030C00F80101D7E9B15>I< 60F0F0600000000000000000000060F0F06004127C910C>I<60F0F06000000000000000000000 60F0F0701010101020204080041A7C910C>I<7FFFFFC0FFFFFFE0000000000000000000000000 0000000000000000000000000000000000000000FFFFFFE07FFFFFC01B0C7E8F20>61 D<0FE03038401CE00EF00EF00EF00E000C001C0030006000C00080018001000100010001000100 01000000000000000000000003000780078003000F1D7E9C14>63 D<0006000000060000000600 00000F0000000F0000000F00000017800000178000001780000023C0000023C0000023C0000041 E0000041E0000041E0000080F0000080F0000180F8000100780001FFF80003007C0002003C0002 003C0006003E0004001E0004001E000C001F001E001F00FF80FFF01C1D7F9C1F>65 DI<001F808000E0618001801980070007800E0003801C0003801C 00018038000180780000807800008070000080F0000000F0000000F0000000F0000000F0000000 F0000000F0000000F0000000700000807800008078000080380000801C0001001C0001000E0002 00070004000180080000E03000001FC000191E7E9C1E>III< FFFFF80F00780F00180F00080F00080F000C0F00040F00040F02040F02000F02000F02000F0600 0FFE000F06000F02000F02000F02000F02000F00000F00000F00000F00000F00000F00000F0000 0F8000FFF800161C7E9B1B>I<001F808000E0618001801980070007800E0003801C0003801C00 018038000180780000807800008070000080F0000000F0000000F0000000F0000000F0000000F0 000000F000FFF0F0000F80700007807800078078000780380007801C0007801C0007800E000780 07000B800180118000E06080001F80001C1E7E9C21>III<1FFF00F800780078007800780078007800780078007800780078007800 780078007800780078007800787078F878F878F878F0F040E021C01F00101D7F9B15>IIIII<003F800000E0E0000380380007001C000E000E001C0007003C000780380003807800 03C0780003C0700001C0F00001E0F00001E0F00001E0F00001E0F00001E0F00001E0F00001E0F0 0001E0700001C0780003C0780003C0380003803C0007801C0007000E000E0007001C0003803800 00E0E000003F80001B1E7E9C20>II<003F800000E0E000038038 0007001C000E000E001C0007003C00078038000380780003C0780003C0700001C0F00001E0F000 01E0F00001E0F00001E0F00001E0F00001E0F00001E0F00001E0700001C0780003C0780003C038 0003803C0E07801C1107000E208E000720DC0003A0F80000F0E020003FE0200000602000007060 000078E000003FC000003FC000001F8000000F001B257E9C20>II<07E0801C1980 300580700380600180E00180E00080E00080E00080F00000F800007C00007FC0003FF8001FFE00 07FF0000FF80000F800007C00003C00001C08001C08001C08001C0C00180C00180E00300D00200 CC0C0083F800121E7E9C17>I<7FFFFFC0700F01C0600F00C0400F0040400F0040C00F0020800F 0020800F0020800F0020000F0000000F0000000F0000000F0000000F0000000F0000000F000000 0F0000000F0000000F0000000F0000000F0000000F0000000F0000000F0000000F0000000F0000 001F800003FFFC001B1C7F9B1E>IIII<7FF0FFC00FC03E000780180003C01800 03E0100001E0200001F0600000F0400000788000007D8000003D0000001E0000001F0000000F00 00000F8000000F80000013C0000023E0000021E0000041F00000C0F8000080780001007C000300 3C0002001E0006001F001F003F80FFC0FFF01C1C7F9B1F>II<7FFFF07C01F07001E06003C0 6003C0400780400F80400F00401E00001E00003C00007C0000780000F00000F00001E00003E000 03C0100780100780100F00101F00301E00203C00203C00607800E0F803E0FFFFE0141C7E9B19> II<08081010202040404040808080808080B0B0F8F8787830300D0C7A9C15> II<1FC000307000783800781C00301C00001C00001C0001FC000F1C00381C 00701C00601C00E01C40E01C40E01C40603C40304E801F870012127E9115>97 DI<07E00C301878307870306000E000E000E000E000E000 E00060007004300418080C3007C00E127E9112>I<003F00000700000700000700000700000700 00070000070000070000070000070003E7000C1700180F00300700700700600700E00700E00700 E00700E00700E00700E00700600700700700300700180F000C370007C7E0131D7E9C17>I<03E0 0C301818300C700E6006E006FFFEE000E000E000E00060007002300218040C1803E00F127F9112 >I<00F8018C071E061E0E0C0E000E000E000E000E000E00FFE00E000E000E000E000E000E000E 000E000E000E000E000E000E000E000E000E007FE00F1D809C0D>I<00038003C4C00C38C01C38 80181800381C00381C00381C00381C001818001C38000C300013C0001000003000001800001FF8 001FFF001FFF803003806001C0C000C0C000C0C000C06001803003001C0E0007F800121C7F9215 >II<18003C003C00180000000000000000000000000000 00FC001C001C001C001C001C001C001C001C001C001C001C001C001C001C001C001C00FF80091D 7F9C0C>I<00C001E001E000C000000000000000000000000000000FE000E000E000E000E000E0 00E000E000E000E000E000E000E000E000E000E000E000E000E000E000E060E0F0C0F1C061803E 000B25839C0D>IIIII<03F0000E1C00180600300300700380600180E001C0E001C0E001 C0E001C0E001C0E001C06001807003803003001806000E1C0003F00012127F9115>II<03C1000C3300180B00300F00700700700700E00700E00700E00700E00700E00700E00700 600700700700300F00180F000C370007C700000700000700000700000700000700000700000700 003FE0131A7E9116>II<1F9030704030C010C010E010F8007F803FE00FF000F8803880 18C018C018E010D0608FC00D127F9110>I<04000400040004000C000C001C003C00FFE01C001C 001C001C001C001C001C001C001C001C101C101C101C101C100C100E2003C00C1A7F9910>IIII<7F8FF00F03800F030007020003840001C80001D80000F00000700000780000F80000 9C00010E00020E000607000403801E07C0FF0FF81512809116>II<7FFC703860 38407040F040E041C003C0038007000F040E041C043C0C380870087038FFF80E127F9112>II E /Fl 31 121 df<60F0F0701010102020204080040C7B830D>44 D<018003801F80E380038003800380038003800380038003800380038003800380038003800380 038003800380038003800380038007C07FFC0E1C7C9B17>49 D<07E000183800200C00400E0040 0700F00780F80780F80380F80380700380000780000700000700000E00000C00001C0000380000 700000C0000180000300000200800400800800801001003FFF007FFF00FFFF00111C7D9B17>I< 07E000083800300C00200E00780F00780700780F00380F00000E00000E00001C00001800007000 07E000003800000C00000E00000700000780000780700780F80780F80780F80780F00700400E00 200C0018380007E000111D7D9B17>I<000C00000C00001C00003C00003C00005C0000DC00009C 00011C00031C00021C00041C000C1C00081C00101C00301C00201C00401C00C01C00FFFFE0001C 00001C00001C00001C00001C00001C00001C0001FFC0131C7E9B17>I<1806001FFC001FF8001F E00010000010000010000010000010000010000011E000161800180C00100E0010070000070000 0780000780000780600780F00780F00780F00700800700400F00400E00201C0018380007E00011 1D7D9B17>I<0003000000030000000300000007800000078000000FC000000BC000000BC00000 11E0000011E0000011E0000020F0000020F0000040F800004078000040780000803C0000803C00 00803C0001FFFE0001001E0002001F0002000F0002000F0004000780040007800C0007801E0007 C0FF803FFC1E1D7E9C22>65 D69 D 73 D82 D<7FFFFFC0700F01C0600F00C0400F0040400F0040C00F0020800F002080 0F0020800F0020000F0000000F0000000F0000000F0000000F0000000F0000000F0000000F0000 000F0000000F0000000F0000000F0000000F0000000F0000000F0000000F0000000F0000001F80 0003FFFC001B1C7D9B21>84 D<00200000700000700000700000B80000B80000B800011C00011C 00011C00020E00020E0004070004070007FF000803800803800803801801C03803C0FE0FF81515 7F9419>97 D<00FC200782600E01E01C00E0380060780020700020F00020F00000F00000F00000 F00000F00000F000207000207800203800401C00400E008007830000FC0013157E9419>99 DIII<00FC200782600E01E01C00E0380060780020700020F000 20F00000F00000F00000F00FF8F000E0F000E07000E07800E03800E01C00E00E00E007836000FC 2015157E941B>II< FF801C001C001C001C001C001C001C001C001C001C001C001C001C001C001C001C001C001C001C 00FF8009157F940D>I107 DII I<01F800070E000C03001C03803801C07801E07000E0F000F0F000F0F000F0F000F0F000F0F000 F0F000F07000E07801E03801C01C03801E0780070E0001F80014157E941A>II114 D<1F1030F06030C030C010C010C000E0007E003FC01F E003F0007800380018801880188010C030F0608FC00D157E9413>I<7FFFF06070304070104070 108070088070088070080070000070000070000070000070000070000070000070000070000070 0000700000700000700007FF0015157F9419>II119 DI E /Fm 30 121 df<70F8F8F8700505798414>46 D<0006000E000E001C001C003800380070007000E000E001C001C0038003800380070007000E00 0E001C001C003800380070007000E000E000C0000F1D7E9914>I<07C00FE01C7038383018701C 701CE00EE00EE00EE00EE00EE00EE00EE00EE00E701C701C383838381C700FE007C00F177E9614 >I<00780000F80001B80001B8000338000338000638000E38000C38001C380038380030380070 3800E03800FFFF80FFFF8000380000380000380000380000380001FF0001FF0011177F9614>52 D<01E007F00E38181C38FC71FC739E739EE70EE70EE70EE70EE70EE70EE70E739C739C71F838F0 18060E1E07F801F00F177E9614>64 D<03C60FFE1C3E181E381E700E700E600EE000E000E000E0 00E000E000E000600E700E700E380C181C1C380FF003C00F177E9614>67 D69 D<03C60FFE1C3E181E381E700E700E600EE000E000E000E000E07FE07FE00E600E700E700E381E 181E1C3E0FFE03CE10177F9614>71 D<07FC07FC00700070007000700070007000700070007000 70007000700070007000700070E070E070F0E07FC01F000E177D9614>74 D77 DI<1F F07FFC783C701CE00EE00EE00EE00EE00EE00EE00EE00EE00EE00EE00EE00EE00EE00EE00E701C 783C7FFC1FF00F177E9614>I<7FFF80FFFF80E1C380E1C380E1C380E1C38001C00001C00001C0 0001C00001C00001C00001C00001C00001C00001C00001C00001C00001C00001C00001C0000FF8 000FF80011177F9614>84 D<7FFEFFFEE01CE01CE038E038007000E000E001C001C00380070007 000E000E001C00380E380E700E700EFFFEFFFE0F177E9614>90 D<1FC0007FF000707800201800 001C00001C0007FC001FFC003C1C00701C00E01C00E01C00E01C00707C003FFF800F8F8011107E 8F14>97 DI<03F80FFC1C1C380870006000E000E000E000E00060007000380E1C1E0FFC03F00F107E8F 14>I<007E00007E00000E00000E00000E00000E00000E0007CE000FFE001C3E00301E00700E00 E00E00E00E00E00E00E00E00E00E00E00E00700E00301E00383E001FEFC007CFC012177F9614> I<07E00FF01C38301C700CE00EE00EFFFEFFFEE00060007000380E1C1E0FFC03F00F107E8F14> I<007C00FE01CE03840380038003807FFEFFFE0380038003800380038003800380038003800380 038003807FFC7FFC0F177F9614>I104 D108 D110 D112 D114 D<0FD83FF86038C038C038F0007F803FF007F8001C6006E006F006F81CFFF8CFE00F107E8F14> I<030007000700070007007FFCFFFC07000700070007000700070007000700070E070E070E070C 03FC00F00F157F9414>II119 D<7E3F007E3F001E38000E780007700007E00003E00001C00003C00003E000077000 0E78000E38001C1C00FE3F80FE3F8011107F8F14>I E /Fn 2 54 df<07801860303030306018 6018E01CE01CE01CE01CE01CE01CE01CE01CE01CE01CE01CE01C6018601870383030186007800E 187E9713>48 D<30183FF03FE03FC02000200020002000200027C03860203000380018001C001C 401CE01CE01C80184038403030E00F800E187E9713>53 D E /Fo 1 26 df<0F8000803FE000807FF00080F07C0180C01F0780800FFF008003FE008000F8000000000000 0000000F8000803FE000807FF00080F07C0180C01F0780800FFF008003FE008000F80019127E91 1E>25 D E /Fp 51 123 df<007F8001E0C00780E00F01F00F01F00F01F00F00E00F00000F0000 FFFFF0FFFFF00F00F00F00F00F00F00F00F00F00F00F00F00F00F00F00F00F00F00F00F00F00F0 0F00F00F00F07FC3FE7FC3FE171A809919>12 D<0F80003018C00070387001F0706C07E0F033FB C0F0300380F0300700F0300F00F0301E00F0301C00F0303800706078003860F00018C1E0000F81 C000000380F80007818C000F0386000E0706001C0F03003C0F0300780F0300F00F0300E00F0301 C00F0303C00F0307800706070003860E00018C060000F8201E7E9B25>37 D<78FCFEFEFE7A02040404081060070D7D990C>39 D<004000800300020006000C001C00180038 0038007000700070007000F000F000F000F000F000F000F000F000F00070007000700070003800 380018001C000C00060002000300008000400A257C9B11>I<800040003000100018000C000E00 060007000700038003800380038003C003C003C003C003C003C003C003C003C003800380038003 800700070006000E000C00180010003000400080000A257E9B11>I<70F8FCFCFC7C0404080810 2040060D7D850C>44 DI<78FCFCFCFC7806067D850C>I<07F0001E 3C003C1E00380E00780F00780F00780F00F80F80F80F80F80F80F80F80F80F80F80F80F80F80F8 0F80F80F80F80F80F80F80780F00780F00380E003C1E001E3C0007F00011187E9716>48 D<00C003C0FFC0FFC003C003C003C003C003C003C003C003C003C003C003C003C003C003C003C0 03C003C003C07FFE7FFE0F187D9716>I<000600000E00001E00003E00007E0000DE00019E0001 1E00031E00061E000C1E00181E00301E00601E00C01E00FFFFE0FFFFE0001E00001E00001E0000 1E00001E0001FFE001FFE013187F9716>52 D<3006003FFC003FFC003FF0003FE0003F80003000 0030000030000037F000381C00301E00000F00000F00000F80700F80F80F80F80F80F80F80F80F 00601F00383E001FF80007E00011187E9716>I<00F80007FE000F06001E0F003C1F003C1F0078 0E00780000F80000F9F000FA1C00FC0E00FC0F00F80F80F80F80F80F80F80F80780F80780F8078 0F003C0F001E1E000FFC0003F00011187E9716>I<6000007FFFC07FFFC07FFF807FFF00E00600 C00600C00C00C0180000300000600000600000E00001E00001C00003C00003C00003C00007C000 07C00007C00007C00007C00007C00003800012197E9816>I<78FCFCFCFC78000000000078FCFC FCFC7806117D900C>58 D<00030000000780000007800000078000000FC000000FC000001BE000 001BE000001BE0000031F0000031F0000060F8000060F80000E0FC0000C07C0000C07C0001803E 0001FFFE0003FFFF0003001F0003001F0006000F8006000F800E000FC0FFC07FFCFFC07FFC1E1A 7F9921>65 D<001FE02000FFFCE003F80FE007C003E01F8001E01F0000E03E0000E07E0000607C 000060FC000000FC000000FC000000FC000000FC000000FC000000FC000000FC0000007C000060 7E0000603E0000601F0000C01F8000C007C0038003F80F0000FFFC00001FF0001B1A7E9920>67 D69 DI72 DI77 D80 D82 D<07F0401FFDC03C0FC07803C07001C0F001C0F000C0F000C0F80000FF00007FF8003FFF001FFF 800FFFC001FFE0000FE00003F00001F0C000F0C000F0C000F0E000E0F001E0FC03C0EFFF8083FE 00141A7E9919>I<7FFFFF807FFFFF80781F0780701F0380601F0180E01F01C0C01F00C0C01F00 C0C01F00C0001F0000001F0000001F0000001F0000001F0000001F0000001F0000001F0000001F 0000001F0000001F0000001F0000001F0000001F0000001F000007FFFC0007FFFC001A1A7E991F >II87 D<0FF0001C3C003E1E003E0E003E0F001C0F00000F0000FF000FCF003E0F007C0F00F80F 00F80F00F80F00F817007C27E01FC3E013117F9015>97 DI<03FC000F0E001C1F 003C1F00781F00780E00F80000F80000F80000F80000F800007800007800003C01801C03000F06 0003FC0011117F9014>I<000FE0000FE00001E00001E00001E00001E00001E00001E00001E003 F9E00F07E01C03E03C01E07801E07801E0F801E0F801E0F801E0F801E0F801E07801E07801E03C 01E01C03E00F0DFC03F9FC161A7F9919>I<03F0000E1C001C0E003C0700780700780780F80780 F80780FFFF80F80000F800007800007800003C01801C03000E060003FC0011117F9014>I<00FE 0003C700078F800F0F800F0F800F07000F00000F00000F0000FFF000FFF0000F00000F00000F00 000F00000F00000F00000F00000F00000F00000F00000F00000F00000F00007FE0007FE000111A 80990E>I<07E3C01C3CE0381CE0781EC0781E00781E00781E00781E00381C001C380027E00020 00002000003000003FFE001FFF801FFFC07003C0E000E0E000E0E000E0E000E07001C03C078007 FC0013197F9016>II<1C003E003E003E003E001C0000000000000000007E007E 001E001E001E001E001E001E001E001E001E001E001E001E001E00FF80FF80091B7F9A0D>I107 DIII<03F8000E0E003C07803803807803C07803 C0F803E0F803E0F803E0F803E0F803E0F803E07803C07C07C03C07800E0E0003F80013117F9016 >II114 D<1FB020704030C030C030F000FF807FE03FF807F8003CC00CC00CE00CE008F830 CFE00E117F9011>I<06000600060006000E000E001E003FF0FFF01E001E001E001E001E001E00 1E001E001E181E181E181E181E180F3003E00D187F9711>IIII121 D<7FFF781E703E603C607860F001F001 E003C007800F830F031E033C067C06781EFFFE10117F9014>I E /Fq 8 125 df<0000200000600000600000E00001E00001E00002700002700004700008700008700010 7000107000207000207000407000807000FFF00100380100380200380400380400380C00381C00 38FF01FF181A7E991D>65 D<03CC0E2E181C381C301C701CE038E038E038E038C072C072C07260 F261341E180F107C8F14>97 D<7E000E000E000E001C001C001C001C00380038003BC03C307830 701870187018E038E038E038E038C070C060C0E060C063801E000D1A7C9912>I<01F006080C18 1838301070006000E000E000E000E000E008E010602030C01F000D107C8F12>I<30F059189E38 9C189C009C0038003800380038007000700070007000E00060000D107C8F10>114 D<03E004300830187018601C001F801FC00FE000E00060E060E06080C041803E000C107D8F10> I<06000E000E000E000E001C001C00FFC01C0038003800380038007000700070007000E100E100 E100E200640038000A177C960D>I124 D E /Fr 16 120 df<3078FCFC7830060676851A>46 D<003E0001FF8003FFC007C1E00F00E01E0F703C3F F0387FF07070F870E07870E078E1C038E1C038E1C038E1C038E1C038E1C038E1C038E1C03870E0 7070E0707070E0387FE03C3FC01E0F000F003807C0F803FFF001FFE0003F00151E7E9D1A>64 D<007C3801FF3807FFF80F83F81E00F81C0078380078380038700038700038700000E00000E000 00E00000E00000E00000E00000E00000E000007000007000387000383800383800381C00701E00 F00F83E007FFC001FF80007C00151E7E9D1A>67 D 69 D<01FFC003FFC001FFC0000E00000E00000E00000E00000E00000E00000E00000E00000E00 000E00000E00000E00000E00000E00000E00000E00000E00000E00000E00000E00600E00F00E00 F01E00F03C007FF8003FF0000FC000121E7C9D1A>74 D<7E003F00FF007F807F007F001D80DC00 1D80DC001D80DC001DC1DC001DC1DC001CC19C001CC19C001CE39C001CE39C001C631C001C771C 001C771C001C361C001C361C001C3E1C001C1C1C001C1C1C001C001C001C001C001C001C001C00 1C001C001C001C001C001C001C007F007F00FF80FF807F007F00191E809D1A>77 DI<0FFE003FFF807FFFC07C07C07001C0F001E0E0 00E0E000E0E000E0E000E0E000E0E000E0E000E0E000E0E000E0E000E0E000E0E000E0E000E0E0 00E0E000E0E000E0E000E0F001E0F001E07001C07C07C07FFFC03FFF800FFE00131E7D9D1A>I< 1FF0003FFC007FFE00780F00300700000380000380007F8007FF801FFF803F8380780380700380 E00380E00380E00380700780780F803FFFFC1FFDFC07F0FC16157D941A>97 D<00FF8003FFC00FFFE01F01E03C00C0780000700000700000E00000E00000E00000E00000E000 007000007000007800703C00701F01F00FFFE003FFC000FE0014157D941A>99 D<001FC0001FC0001FC00001C00001C00001C00001C00001C00001C001F1C007FDC00FFFC01E0F C03C07C07803C07001C0E001C0E001C0E001C0E001C0E001C0E001C0E001C07003C07003C03807 C03E0FC01FFFFC07FDFC01F1FC161E7E9D1A>I<01F80007FF000FFF801E07C03C01C07800E070 00E0E00070E00070FFFFF0FFFFF0FFFFF0E000007000007000007800703C00701F01F00FFFE003 FFC000FE0014157D941A>I104 D<7F83F0FF8FF87FBFFC03FC3C03F01803E00003C00003C0000380000380000380000380000380 000380000380000380000380000380007FFF00FFFF007FFF0016157E941A>114 D<07FB801FFF807FFF80780780E00380E00380E003807800007FC0003FFC0007FE00003F800007 806001C0E001C0E001C0F003C0FC0780FFFF00EFFE00E3F80012157C941A>I119 D E /Fs 1 4 df<020002000200C218F2783AE00F800F803AE0F278C2180200020002000D0E7E8E12>3 D E /Ft 21 119 df<70F8F8F87005057C840E>46 D<008003800F80F380038003800380038003 800380038003800380038003800380038003800380038003800380038003800380038003800380 03800380038007C0FFFE0F217CA018>49 D<03F8000C1E001007002007804007C07807C07803C0 7807C03807C0000780000780000700000F00000E0000380003F000001C00000F00000780000780 0003C00003C00003E02003E07003E0F803E0F803E0F003C04003C0400780200780100F000C1C00 03F00013227EA018>51 D<01F000060C000C0600180700380380700380700380F001C0F001C0F0 01C0F001E0F001E0F001E0F001E0F001E07001E07003E03803E01805E00C05E00619E003E1E000 01C00001C00001C0000380000380300300780700780600700C002018001030000FC00013227EA0 18>57 D68 D<03FFF0001F00000F00000F00000F00000F00000F00000F00000F00000F00000F00000F00000F 00000F00000F00000F00000F00000F00000F00000F00000F00000F00000F00000F00000F00000F 00700F00F80F00F80F00F80E00F01E00401C0020380018700007C00014237EA119>74 DII<03F0200C0C601802603001E07000E0600060E00060E00060E00020E00020 E00020F00000F000007800007F00003FF0001FFE000FFF0003FF80003FC00007E00001E00000F0 0000F0000070800070800070800070800070C00060C00060E000C0F000C0C80180C6070081FC00 14247DA21B>83 D87 D<0FE0001838003C0C003C0E0018070000070000070000070000FF0007C7001E07003C07007807 00700700F00708F00708F00708F00F087817083C23900FC1E015157E9418>97 D<01FC000707000C03801C01C03801C07801E07000E0F000E0FFFFE0F00000F00000F00000F000 00F000007000007800203800201C00400E008007030000FC0013157F9416>101 D<00007001F198071E180E0E181C07001C07003C07803C07803C07803C07801C07001C07000E0E 000F1C0019F0001000001000001800001800001FFE000FFFC00FFFE03800F0600030400018C000 18C00018C000186000306000303800E00E038003FE0015217F9518>103 D<0E0000FE00001E00000E00000E00000E00000E00000E00000E00000E00000E00000E00000E00 000E00000E1F800E60C00E80E00F00700F00700E00700E00700E00700E00700E00700E00700E00 700E00700E00700E00700E00700E00700E00700E00700E0070FFE7FF18237FA21B>I<1C001E00 3E001E001C00000000000000000000000000000000000E00FE001E000E000E000E000E000E000E 000E000E000E000E000E000E000E000E000E000E000E00FFC00A227FA10E>I<0E1FC07F00FE60 E183801E807201C00F003C00E00F003C00E00E003800E00E003800E00E003800E00E003800E00E 003800E00E003800E00E003800E00E003800E00E003800E00E003800E00E003800E00E003800E0 0E003800E00E003800E00E003800E0FFE3FF8FFE27157F942A>109 D<0E1F80FE60C01E80E00F 00700F00700E00700E00700E00700E00700E00700E00700E00700E00700E00700E00700E00700E 00700E00700E00700E0070FFE7FF18157F941B>I<0E3CFE461E8F0F0F0F060F000E000E000E00 0E000E000E000E000E000E000E000E000E000E000F00FFF010157F9413>114 D<02000200020002000600060006000E001E003E00FFF80E000E000E000E000E000E000E000E00 0E000E000E000E040E040E040E040E040E040708030801F00E1F7F9E13>116 D<0E0070FE07F01E00F00E00700E00700E00700E00700E00700E00700E00700E00700E00700E00 700E00700E00700E00700E00F00E00F006017003827800FC7F18157F941B>II E /Fu 17 118 df<00000000780000000000000000780000000000000000780000000000000000FC0000000000 000000FC0000000000000000FC0000000000000001FE0000000000000001FE0000000000000003 FF0000000000000003FF0000000000000003FF0000000000000007FF8000000000000007FF8000 000000000007FF800000000000000FFFC00000000000000E7FC00000000000000E7FC000000000 00001E7FE00000000000001C3FE00000000000001C3FE00000000000003C3FF000000000000038 1FF0000000000000381FF0000000000000781FF8000000000000700FF8000000000000700FF800 0000000000E00FFC000000000000E007FC000000000000E007FC000000000001C007FE00000000 0001C003FE000000000001C003FE0000000000038001FF0000000000038001FF00000000000380 01FF0000000000070000FF8000000000070000FF8000000000070000FF80000000000E00007FC0 000000000E00007FC0000000000E00007FC0000000001C00003FE0000000001C00003FE0000000 003C00003FF0000000003800001FF0000000003800001FF0000000007800001FF8000000007FFF FFFFF8000000007FFFFFFFF800000000FFFFFFFFFC00000000E0000007FC00000000E0000007FC 00000001E0000007FE00000001C0000003FE00000001C0000003FE00000003C0000003FF000000 0380000001FF0000000380000001FF0000000780000001FF8000000700000000FF800000070000 0000FF8000000E00000000FFC000000E000000007FC000000E000000007FC000001E000000003F E000001E000000003FE000003E000000003FE000007F000000003FF00001FF800000003FF80007 FFE0000001FFFC00FFFFFC00003FFFFFFCFFFFFC00003FFFFFFCFFFFFC00003FFFFFFC46497DC8 4D>65 D<00000003FF00000C0000003FFFF0001C000001FFFFFC001C000007FF007F003C00001F F0000F807C00007FC00003C0FC0000FF000000F0FC0003FC00000079FC0007F80000003FFC000F F00000001FFC001FE00000000FFC003FC000000007FC007F8000000003FC00FF8000000003FC01 FF0000000001FC01FE0000000001FC03FE0000000000FC07FC0000000000FC07FC00000000007C 0FFC00000000007C0FF800000000007C1FF800000000003C1FF800000000003C3FF00000000000 3C3FF000000000003C3FF000000000001C7FF000000000001C7FF000000000001C7FE000000000 001C7FE0000000000000FFE0000000000000FFE0000000000000FFE0000000000000FFE0000000 000000FFE0000000000000FFE0000000000000FFE0000000000000FFE0000000000000FFE00000 00000000FFE0000000000000FFE0000000000000FFE0000000000000FFE00000000000007FE000 00000000007FE00000000000007FF000000000001C7FF000000000001C3FF000000000001C3FF0 00000000001C3FF000000000001C1FF800000000001C1FF80000000000380FF80000000000380F FC00000000003807FC00000000003807FC00000000007003FE00000000007001FE0000000000E0 01FF0000000000E000FF8000000001C0007F8000000001C0003FC00000000380001FE000000007 00000FF00000000E000007F80000001C000003FC00000038000000FF000000700000007FC00001 E00000001FF00007C000000007FF007F0000000001FFFFFE00000000003FFFF0000000000003FF 8000003E497AC74B>67 D 80 D<0001FF000180000FFFE00380003FFFF80380007E00FE078001F8001F0F8003E000078F80 07C00001DF800F800000FF800F0000007F801F0000007F803E0000003F803E0000001F807C0000 001F807C0000000F807C0000000F80FC0000000F80FC0000000780FC0000000780FC0000000780 FC0000000380FE0000000380FE0000000380FF0000000380FF00000003807F80000000007FC000 0000007FE0000000003FF8000000003FFF000000001FFFF00000000FFFFF0000000FFFFFF00000 07FFFFFE000003FFFFFF800001FFFFFFE000007FFFFFF000003FFFFFF800000FFFFFFC000001FF FFFE0000001FFFFF00000000FFFF800000000FFF8000000001FFC000000000FFC0000000003FE0 000000001FE0000000001FE0000000000FF0000000000FF06000000007F0E000000007F0E00000 0007F0E000000003F0E000000003F0E000000003F0F000000003F0F000000003F0F000000003E0 F000000003E0F800000003E0F800000007C0FC00000007C0FE0000000780FE0000000F80FF0000 001F00FFC000001E00FDE000003C00F8F800007800F87E0001F000F01FE00FE000E007FFFFC000 E001FFFF0000C0001FF800002C497AC739>83 D<3FFFFFFFFFFFFFFF003FFFFFFFFFFFFFFF003F FFFFFFFFFFFFFF003FF8000FFE0007FF003FC00007FC0000FF003F000007FC00003F007E000007 FC00001F807C000007FC00000F807C000007FC00000F8078000007FC0000078078000007FC0000 078078000007FC0000078070000007FC0000038070000007FC0000038070000007FC0000038070 000007FC0000038070000007FC00000380F0000007FC000003C0E0000007FC000001C0E0000007 FC000001C0E0000007FC000001C0E0000007FC000001C0E0000007FC000001C000000007FC0000 000000000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000 000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000000007 FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000 000000000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000 000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000000007 FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000 000000000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000 000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000000007 FC0000000000000007FC0000000000000007FC0000000000000007FC0000000000000007FC0000 000000000007FC0000000000000007FC000000000000000FFE000000000000003FFF8000000000 03FFFFFFFFF800000003FFFFFFFFF800000003FFFFFFFFF8000042467CC54B>I<0003FE000000 001FFFC00000007E03F0000000F000FC000001C0007E00000380003F000007C0001F800007F000 1FC0000FF0000FC0000FF8000FE0000FF8000FE0000FF80007F00007F00007F00007F00007F000 01C00007F00000000007F00000000007F00000000007F00000000007F000000001FFF00000007F FFF0000003FF87F000001FF007F000007F8007F00001FE0007F00003F80007F00007F00007F000 0FE00007F0001FC00007F0003FC00007F0003F800007F0007F800007F01C7F800007F01CFF0000 07F01CFF000007F01CFF000007F01CFF00000FF01CFF00000FF01CFF00000FF01C7F80001BF01C 7F800033F01C3FC00031F8381FC00061F8380FF001C0FC7003FC0780FFE000FFFE003FC0001FF8 001F802E2F7CAD34>97 D<00007F80000003FFF000000FC0FC00003F003F00007C001F8000F800 0FC001F80007E003F00007E007E00003F00FE00003F80FE00003F81FC00001FC1FC00001FC3FC0 0001FC3FC00001FC7F800001FE7F800000FE7F800000FEFF800000FEFF800000FEFFFFFFFFFEFF FFFFFFFEFF80000000FF80000000FF80000000FF80000000FF80000000FF800000007F80000000 7F800000007F800000007FC00000003FC00000003FC000000E1FC000000E1FE000000E0FE00000 1C07E000001C07F000003803F000007001F800007000FC0000E0003E0003C0001F8007000007E0 3E000001FFF80000003FC000272F7DAD2E>101 D<000007F00000003FFC0000007C0E000001F8 1F000003F03F800007E07FC0000FC07FC0000FC07FC0001F807FC0003F803F80003F801F00003F 000E00007F000000007F000000007F000000007F000000007F000000007F000000007F00000000 7F000000007F000000007F000000007F000000007F000000007F000000007F000000007F000000 007F000000007F000000FFFFFFE000FFFFFFE000FFFFFFE000007F000000007F000000007F0000 00007F000000007F000000007F000000007F000000007F000000007F000000007F000000007F00 0000007F000000007F000000007F000000007F000000007F000000007F000000007F000000007F 000000007F000000007F000000007F000000007F000000007F000000007F000000007F00000000 7F000000007F000000007F000000007F000000007F000000007F000000007F000000007F000000 007F000000007F000000007F80000001FFC000007FFFFFC0007FFFFFC0007FFFFFC00022497DC8 20>I<0001FF0003F0000FFFE01FFC001F83F07C3E007E00FDE07E00F8003F807E01F8003F003C 03F0001F801807F0001FC00007F0001FC0000FE0000FE0000FE0000FE0001FE0000FF0001FE000 0FF0001FE0000FF0001FE0000FF0001FE0000FF0001FE0000FF0001FE0000FF0000FE0000FE000 0FE0000FE00007F0001FC00007F0001FC00003F0001F800001F8003F000000F8003E000001FE00 FC0000019F83F00000030FFFE000000301FF000000070000000000070000000000070000000000 07000000000007000000000007000000000007800000000007C00000000007E00000000003FFFF FE000003FFFFFFE00001FFFFFFF80000FFFFFFFE00007FFFFFFF0001FFFFFFFF8003E00001FFC0 0F8000003FE01F0000000FE03E00000003F03C00000001F07C00000001F87800000000F8F80000 0000F8F800000000F8F800000000F8F800000000F8F800000000F87C00000001F07C00000001F0 3E00000003E01E00000003C00F000000078007C000001F0003E000003E0000FC0001F800003F80 0FE000000FFFFF80000000FFF800002F437DAC34>I<01FE0000000000FFFE0000000000FFFE00 00000000FFFE000000000003FE000000000001FE000000000000FE000000000000FE0000000000 00FE000000000000FE000000000000FE000000000000FE000000000000FE000000000000FE0000 00000000FE000000000000FE000000000000FE000000000000FE000000000000FE000000000000 FE000000000000FE000000000000FE000000000000FE000000000000FE000000000000FE000000 000000FE000000000000FE000000000000FE007F80000000FE03FFF0000000FE0781F8000000FE 0C007C000000FE18007E000000FE30003F000000FE60003F800000FEC0001F800000FF80001F80 0000FF80001FC00000FF00001FC00000FF00001FC00000FF00001FC00000FE00001FC00000FE00 001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC000 00FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE0000 1FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000 FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001F C00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00003FF80007FF000FFFF FE1FFFFFC0FFFFFE1FFFFFC0FFFFFE1FFFFFC032487CC739>I<00F00001F80003FC0007FE0007 FE000FFE0007FE0007FE0003FC0001F80000F00000000000000000000000000000000000000000 000000000000000000000000000000000000000000000000FE00FFFE00FFFE00FFFE0003FE0001 FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000 FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000 FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0000FE0003FF00FFFFFCFFFFFCFF FFFC16467DC51C>I<01FC007FC00007FC0000FFFC01FFF8001FFF8000FFFC0780FC00780FC000 FFFC0E003E00E003E00003FC18003F018003F00001FC30001F830001F80000FC60001FC60001FC 0000FCC0001FCC0001FC0000FD80000FD80000FC0000FD80000FF80000FE0000FF00000FF00000 FE0000FF00000FF00000FE0000FF00000FF00000FE0000FE00000FE00000FE0000FE00000FE000 00FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00000FE0 0000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00000F E00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE0000 0FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00 000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE 00000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0000 FE00000FE00000FE0000FE00000FE00000FE0000FE00000FE00000FE0003FF80003FF80003FF80 FFFFFE0FFFFFE0FFFFFEFFFFFE0FFFFFE0FFFFFEFFFFFE0FFFFFE0FFFFFE4F2D7CAC56>109 D<00003FE000000001FFFC00000007E03F0000001F800FC000007E0003F00000FC0001F80001F8 0000FC0003F000007E0007F000007F0007E000003F000FE000003F801FC000001FC01FC000001F C03FC000001FE03FC000001FE03F8000000FE07F8000000FF07F8000000FF07F8000000FF0FF80 00000FF8FF8000000FF8FF8000000FF8FF8000000FF8FF8000000FF8FF8000000FF8FF8000000F F8FF8000000FF8FF8000000FF8FF8000000FF87F8000000FF07F8000000FF07F8000000FF03FC0 00001FE03FC000001FE03FC000001FE01FC000001FC00FE000003F800FE000003F8007F000007F 0003F000007E0001F80000FC0000FC0001F800007E0003F000001F800FC000000FE03F80000003 FFFE000000003FE000002D2F7DAD34>111 D<01FC01F800FFFC07FE00FFFC1E1F00FFFC383F80 03FC607FC001FC607FC000FCC07FC000FCC07FC000FD803F8000FD801F0000FF000E0000FF0000 0000FF00000000FF00000000FE00000000FE00000000FE00000000FE00000000FE00000000FE00 000000FE00000000FE00000000FE00000000FE00000000FE00000000FE00000000FE00000000FE 00000000FE00000000FE00000000FE00000000FE00000000FE00000000FE00000000FE00000000 FE00000000FE00000000FE00000000FE00000000FE00000000FF00000003FF800000FFFFFF8000 FFFFFF8000FFFFFF8000222D7DAC28>114 D<001FF8060000FFFF0E0003F0079E00078001FE00 0E00007E001C00003E003C00003E007800001E007800001E00F800001E00F800000E00F800000E 00FC00000E00FC00000E00FE00000E00FF000000007FC00000007FF80000003FFFE000001FFFFE 00000FFFFF800007FFFFE00003FFFFF00000FFFFFC00001FFFFE000001FFFE0000000FFF000000 01FF800000007F806000001FC0E000001FC0E000000FC0F000000FC0F0000007C0F0000007C0F0 000007C0F8000007C0F800000780FC00000780FC00000F00FE00000F00FF00001E00FF80003C00 F9E0007800F0F803E000E03FFFC000C007FC0000222F7DAD29>I<000700000007000000070000 000700000007000000070000000F0000000F0000000F0000000F0000000F0000001F0000001F00 00003F0000003F0000007F0000007F000000FF000001FF000007FF00001FFFFFFCFFFFFFFCFFFF FFFC007F0000007F0000007F0000007F0000007F0000007F0000007F0000007F0000007F000000 7F0000007F0000007F0000007F0000007F0000007F0000007F0000007F0000007F0000007F0000 007F0000007F0000007F0000007F000E007F000E007F000E007F000E007F000E007F000E007F00 0E007F000E007F000E007F000E007F000E003F000C003F801C001F801C001F8018000FC0380007 C0300003F0E00001FFC000003F801F417EBF28>I<01FE00003FC000FFFE001FFFC000FFFE001F FFC000FFFE001FFFC00003FE00007FC00001FE00003FC00000FE00001FC00000FE00001FC00000 FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001F C00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE 00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC0 0000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00001FC00000FE00 001FC00000FE00001FC00000FE00001FC00000FE00003FC00000FE00003FC00000FE00003FC000 00FE00007FC000007E00007FC000007E00007FC000003F0000DFC000003F00019FE000001F0003 1FF000000F80061FFFC00007F01C1FFFC00001FFF81FFFC000003FE01FE000322E7CAC39>I E /Fv 66 124 df<00FC000782000E07001C07001C02001C00001C00001C00001C0000FFFF001C 07001C07001C07001C07001C07001C07001C07001C07001C07001C07001C07001C0700FF1FE013 17809614>12 D<60C0F1E0F1E070E01020102020402040408040800B0A7F9612>34 D<60F0F070101020204040040A7D960A>39 D<0102040C1818303070606060E0E0E0E0E0E0E0E0 E0E060606070303018180C04020108227D980E>I<8040203018180C0C0E060606070707070707 070707070606060E0C0C18183020408008227E980E>I<60F0F070101020204040040A7D830A> 44 DI<60F0F06004047D830A>I<07C018303018701C600C600CE00EE0 0EE00EE00EE00EE00EE00EE00EE00E600C600C701C30181C7007C00F157F9412>48 D<03000700FF000700070007000700070007000700070007000700070007000700070007000700 07007FF00C157E9412>I<0F8030E040708030C038E0384038003800700070006000C001800300 06000C08080810183FF07FF0FFF00D157E9412>I<0FE030306018701C701C001C001800380060 07E000300018000C000E000EE00EE00EC00C401830300FE00F157F9412>I<00300030007000F0 01F001700270047008701870107020704070C070FFFE0070007000700070007003FE0F157F9412 >I<20303FE03FC0240020002000200020002F8030E020700030003800384038E038E038803040 6020C01F000D157E9412>I<01F00608080C181C301C70006000E000E3E0EC30F018F00CE00EE0 0EE00E600E600E300C3018183007C00F157F9412>I<40007FFE7FFC7FF8C00880108020004000 8000800100010003000200060006000E000E000E000E000E0004000F167E9512>I<07E0183020 18600C600C700C78183E101F600FC00FF018F8607C601EC00EC006C006C004600C38300FE00F15 7F9412>I<07C0183030186018E00CE00CE00EE00EE00E601E301E186E0F8E000E000C001C7018 7018603020C01F800F157F9412>I<60F0F06000000000000060F0F060040E7D8D0A>I<60F0F060 00000000000060F0F07010102020404004147D8D0A>I<001000003800003800003800005C0000 5C00005C00008E00008E00008E0001070001070003078002038002038007FFC00401C00401C008 00E00800E01800E03800F0FE03FE17177F961A>65 DI<00FC100383300E00B01C007038003030003070 0010600010E00010E00000E00000E00000E00000E00000E000106000107000103000203800201C 00400E008003830000FC0014177E9619>IIII<007E080381980600580C0038180018300018700008700008E00008 E00000E00000E00000E00000E003FEE000387000387000383000381800380C00380600380380D8 007F0817177E961C>I73 D<0FFC00E000E000E000E000E000E0 00E000E000E000E000E000E000E000E000E000E000E0E0E0E0E0C1C061801F000E177E9612>I< FFC0001C00001C00001C00001C00001C00001C00001C00001C00001C00001C00001C00001C0000 1C00001C00201C00201C00201C00601C00601C00401C00C01C03C0FFFFC013177F9616>76 DII<00FC000303000E01C01C00E038007030003070 0038600018E0001CE0001CE0001CE0001CE0001CE0001CE0001C7000387000383000303800701C 00E00E01C003030000FC0016177E961B>II82 D<0FC4302C601C400CC004C004C004E00070007F003FE00FF8 01FC001C000E0006800680068006C004E008D81087E00F177E9614>I<7FFFF860381840380840 380880380480380480380400380000380000380000380000380000380000380000380000380000 380000380000380000380000380000380007FFC016177F9619>I87 D91 D<204020404080408081008100E1C0F1E0F1E060C00B0A7B9612>II<1FC0386038301038 003803F81E3830387038E039E039E07970FF1F1E100E7F8D12>97 DI<07F01838303870106000E000E0 00E000E000600070083008183007C00D0E7F8D10>I<007E00000E00000E00000E00000E00000E 00000E00000E00000E0007CE001C3E00300E00700E00600E00E00E00E00E00E00E00E00E00600E 00700E00301E00182E0007CFC012177F9614>I<0FC0186030307038E018FFF8E000E000E00060 0070083010183007C00D0E7F8D10>I<03E006700E701C201C001C001C001C001C00FF801C001C 001C001C001C001C001C001C001C001C001C001C00FF800C1780960B>I<0F9E18E33060707070 707070306018C02F80200060003FE03FF83FFC600EC006C006C006600C38380FE010157F8D12> II<18 3C3C1800000000007C1C1C1C1C1C1C1C1C1C1C1C1CFF081780960A>I107 DIII<07 C018303018600C600CE00EE00EE00EE00EE00E701C3018183007C00F0E7F8D12>II<07C2001C2600381E00700E00600E00E0 0E00E00E00E00E00E00E00600E00700E00301E001C2E0007CE00000E00000E00000E00000E0000 0E00007FC012147F8D13>II<1F4060C0C040C040E000FF007F801FC001E080608060C060E0C09F000B0E7F 8D0E>I<080008000800180018003800FF80380038003800380038003800380038403840384038 401C800F000A147F930E>IIIIII123 D E end %%EndProlog %%BeginSetup %%Feature: *Resolution 300 TeXDict begin %%EndSetup %%Page: 1 1 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)302 133 y Fu(A)35 b(T)-9 b(est)34 b(Suite)i(for)e(Chess)g(Programs)534 281 y Ft(Kevin)16 b(Lang)281 b(W)l(arren)16 b(D.)g(Smith)1447 263 y Fs(\003)968 339 y Fr(wds@researc)o(h.)o(NJ.)o(NEC)o(.C)o(OM)939 437 y Ft(June)g(1993)62 592 y Fq(A)o(bstr)n(act)g(|)37 b Fp(W)l(e)19 b(describ)q(e)g(a)h(suite)g(of)f Fo(\031)e Fn(5500)j Fp(test)h(p)q(ositions)d (for)i(testing)f(c)o(hess)h(pla)o(ying)e(programs.)35 b(They)19 b(are)0 641 y(a)o(v)n(ailable)9 b(as)j Fm(pub/wds/Ch)o(es)o(sTe)o(st.)o(ta)o (r.Z)7 b Fp(b)o(y)j(anon)o(ymous)h Fm(ftp)e Fp(to)i Fm(external.N)o(J.N)o(EC) o(.CO)o(M)p Fp(.)d(Almost)j(all)f(of)g(these)h(p)q(ositions)f(are)0 691 y(unoriginal)g(and)h(w)o(ere)i(obtained)e(b)o(y)h(scanning)f(in)g (diagrams)i(from)f(c)o(hessb)q(o)q(oks)h(with)e(an)h(optical)f(scanner.)20 b Fm(Gnuchess)c(4.0)p Fp(,)0 741 y(at)e(one)g(min)o(ute)e(p)q(er)i(mo)o(v)o (e)f(on)h(a)g(50)f(MHz)g(MIPS)g(R4000,)i(scores)f(16-71\045)g(on)f(our)h (test\014les.)20 b(W)l(e)14 b(describ)q(e)f(the)g(soft)o(w)o(are)0 791 y(w)o(e)d(wrote)h(to)g(accomplish)d(the)i(scanning)f(task.)20 b(If)9 b(y)o(ou)h(tak)o(e)h(the)g(test,)h(please)f(send)f(us)g(\(Email:)17 b Fm(wds@resea)o(rch)o(.N)o(J.N)o(EC.)o(CO)o(M)p Fp(\))0 841 y(the)e(results,)g(the)g(testee's)i(name)e(and)f(estimated)i(USCF)e(rating,)h (and)f(notify)g(us)g(of)h(an)o(y)g(corrections)f(in)g(the)g(test)i(set.)871 955 y Fl(1)45 b(Intr)o(oduction)0 1046 y Fk(The)12 b(computer)f(c)o(hess)h (comm)o(unit)o(y)c(has)j(long)g(had)g(a)g(need)h(for)f(a)g(comprehensiv)o(e)g (test)h(suite)g(of)e(c)o(hess)j(p)q(ositions)e(for)g(the)h(purp)q(oses)0 1096 y(of)h(debugging)f(and)h(ev)n(aluating)f(c)o(hess)j(pla)o(ying)c (programs.)17 b(Suc)o(h)c(a)g(suite)h(can)f(also)g(b)q(e)h(useful)f(\(if)g (it)f(is)h(comprehensiv)o(e)h(enough\))0 1146 y(for)i(\014nding)g(out)g(what) g(areas)h(of)f(pla)o(y)f(one's)i(program)e(is)h(w)o(eak)g(in,)g(so)h(that)f (one)h(ma)o(y)d(then)j(impro)o(v)o(e)e(the)i(program)d(in)i(those)0 1196 y(areas.)i(A)12 b(third)f(use)i(of)e(test)i(suites)f(w)o(as)g(apparen)o (tly)f(in)o(v)o(en)o(ted)h(b)o(y)f(the)i(authors)f(\(D.)f(Dailey)f(and)i(L.)f (Kau\013man\))f(of)h(the)i(program)0 1246 y(\\So)q(crates)g(I)q(I")f(whic)o (h)g(recen)o(tly)h(w)o(on)f(the)g(23rd)g(A)o(CM)g(computer)g(c)o(hess)i(c)o (hampionship.)h(This)d(is)g(to)g(tak)o(e)g(a)g(set)h(of)e(test)i(p)q (ositions)0 1295 y(whic)o(h)e(y)o(ou)g(kno)o(w)g(y)o(our)g(program)e(is)i (capable)h(of)e(solving)g(\(a)i(subset)g(of)f(our)g(set)h(migh)o(t)d(b)q(e)j (used\))g(and)g(to)f(then)h(p)q(ostulate)f(that)g(the)0 1345 y(strength,)k(in)e(rating)g(p)q(oin)o(ts,)h(of)f(y)o(our)g(program)g(is)g(a)h (monotonic)e(function)h(of)h(the)g(run)o(time)f(it)g(requires)i(to)f(solv)o (e)g(the)g(problems)0 1395 y(in)f(this)h(set.)19 b(One)c(then)g(tunes)f(the)h (program's)d(selectiv)o(e)j(searc)o(h)g(heuristics)g(to)f(reduce)h(this)f (run)o(time.)0 1505 y Fj(1.1)43 b(Pr)n(evious)14 b(test)h(suites)0 1582 y Fk(There)f(ha)o(v)o(e)e(b)q(een)i(some)e(previous)h(e\013orts)g(to)g (devise)g(c)o(hess)h(test)g(suites.)k(The)13 b(300)f(p)q(ositions)h(from)d (Reinfeld's)i(\\Win)g(at)g(Chess")0 1632 y([31)o(])k(ha)o(v)o(e)g(b)q(een)i (used)f(b)o(y)g(sev)o(eral)g(authors)g(\(for)f(example,)f(see)j([4)o(]\),)f (and)f(are)h(go)q(o)q(d)f(for)g(testing)h(sharp)g(tactical)g(pla)o(y)e (\(whic)o(h)0 1682 y(computers)g(excel)h(at\),)e(but)h(little)f(else.)22 b(Deep)16 b(Though)o(t)e(with)h(singular)f(extensions)i([4)o(])e(scored)i (297)f(out)f(of)h(a)f(p)q(ossible)h(299)f(on)0 1731 y(this)g(set,)g(leading)f (to)h(claims)e(that)i(the)h(b)q(est)g(computers)f(ha)o(v)o(e)f(\\outgro)o (wn")g(it.)62 1782 y(I.)20 b(Bratk)o(o)h(and)g(D.)f(Kop)q(ec)i([9)o(])e (devised)i(the)f(24-p)q(osition)e(\\Bratk)o(o-Kop)q(ec)j(test")f(some)f(of)g (whose)i(p)q(ositions)e(also)g(test)0 1831 y(\\p)q(ositional")12 b(pla)o(y)m(.)17 b(But)d(24)f(p)q(ositions)h(is)g(to)q(o)f(few.)62 1882 y(Berliner,)21 b(Kop)q(ec)e(and)g(Northam)e([8)o(])h(started)i(a)f (large)f(e\013ort)h(to)g(pro)q(duce)h(a)e Fi(\031)i Fk(500-p)q(osition)d (test)i(set,)i(and)d(as)h(part)g(of)0 1931 y(their)f(e\013ort)f(pro)q(duced)i (an)e(am)o(bitious)e(\\taxonom)o(y)m(,)o(")g(or)i(sub)r(ject)h (classi\014cation)f(sc)o(heme,)h(classifying)e(all)g(c)o(hess)j(themes)e(in)o (to)0 1981 y(roughly)g(82)g(categories.)30 b(Unfortunately)18 b(\(according)g(to)f(a)h(priv)n(ate)f(comm)o(unication)d(from)i(Berliner\),)j (this)f(e\013ort)g(seems)g(to)0 2031 y(ha)o(v)o(e)13 b(pro)q(duced)h(only)e (ab)q(out)g(20)h(actual)f(c)o(hess)j(p)q(ositions)d(b)q(efore)i(its)e (authors)i(quit)e(w)o(orking)g(on)h(it.)k(The)c(reason)h(for)e(this)h (failure)0 2081 y(app)q(ears)i(to)e(ha)o(v)o(e)h(b)q(een)h(the)g(v)o(ery)f (high)f(standards)i(of)e(qualit)o(y)g(and)g(accuracy)i(that)f(they)h(set)f (for)g(themselv)o(es.)62 2131 y(W)m(e)g(ha)o(v)o(e)f(included)i(all)d(the)j (p)q(ositions)e(from)f(the)j(ab)q(o)o(v)o(e)e(three)j(tests)f(in)e(our)h (test)h(suite.)62 2181 y(Sev)o(eral)h(authors)g(ha)o(v)o(e)g(used)g(the)g(en) o(tire)h(set)f(of)f(p)q(ositions)h(from)d(grandmaster)i(games)g(as)h(a)f (test)i(suite,)f(where)h(the)f(\\righ)o(t)0 2231 y(mo)o(v)o(e")g(is)i (assumed)g(to)g(b)q(e)g(whatev)o(er)h(w)o(as)f(actually)f(pla)o(y)o(ed.)30 b(But)19 b(this)f(approac)o(h)g(has)g(ob)o(vious)f(w)o(eaknesses,)k(namely)16 b(that)0 2281 y(\(presumably\))c(it)f(is)h(incapable)g(of)g(testing)h(pla)o (y)o(ers)f(who)g(are)g(stronger)i(than)e(the)h(grandmasters)f(who)g(pla)o(y)o (ed)f(those)i(games,)e(and)0 2331 y(also,)i(there)i(are)f(plen)o(t)o(y)g(of)f (p)q(ositions)h(in)f(grandmaster)h(games)e(in)i(whic)o(h)g(there)h(is)e(more) g(than)h(one)g(\\correct")h(mo)o(v)o(e.)62 2381 y(Finally)m(,)9 b(Nielsen)j([27)o(])e(describ)q(es)j(a)e(test)h(set)g(he)f(has)g(devised.)18 b(The)11 b(description)h(w)o(as)f(rather)g(v)n(ague)g(\(for)g(example,)e(he)j (do)q(esn't)0 2431 y(sa)o(y)i(ho)o(w)g(man)o(y)f(p)q(ositions)h(are)h(in)f (it,)f(nor)i(where)g(they)g(came)f(from\).)k(An)o(yw)o(a)o(y)m(,)12 b(Nielsen)j(assigned)g(p)q(oin)o(ts)f(to)h(eac)o(h)g(problem)e(in)0 2480 y(some)g(unkno)o(wn)h(manner)f(in)h(an)g(attempt)f(to)h(mak)o(e)f(y)o (our)h(total)f(p)q(oin)o(t)h(score)h(on)f(the)h(\(timed\))e(test,)i(b)q(e)g (a)e(close)i(appro)o(ximation)0 2530 y(to)f(y)o(our)g(\(Sw)o(edish\))h(c)o (hess)h(rating.)j(Nielsen)c(also)f(giv)o(es)g(y)o(ou)g(up)h(to)f(40)g(extra)h (p)q(oin)o(ts,)f Fj(r)n(e)n(gar)n(d)r(less)f Fk(of)h(y)o(our)g(p)q (erformance)g(on)h(the)0 2580 y(test)i(questions,)f(just)f(for)g(ha)o(ving)g (a)g(large)g(op)q(ening)g(b)q(o)q(ok,)g(and)h(up)f(to)g(10\045)g(extra)h (score)h(for)e(kno)o(wing)f(ab)q(out)h(transp)q(ositions.)0 2630 y(According)d(to)f(data)g(he)h(supplies)g(comparing)e(scores)j(on)e(his) g(test)i(for)e(46)g(computers)h(with)f(their)h(Sw)o(edish)f(ratings,)h(the)g (standard)0 2680 y(deviation)g(in)h(his)h(prediction)f(is)g(ab)q(out)h(80)e (p)q(oin)o(ts,)h(but)h(in)f(the)h(outlier)f(case)h(of)f(Deep)h(Though)o(t,)e (Nielsen's)i(prediction)g(w)o(as)f(379)0 2729 y(p)q(oin)o(ts)j(to)q(o)g(lo)o (w,)g(leading)f(to)h(the)h(suspicion)f(that)g(his)h(p)q(oin)o(t)e(system)h (only)g(w)o(orks)g(w)o(ell)g(\(as)g(a)g(Sw)o(edish)g(rating)g(predictor\))h (for)p 0 2768 837 2 v 46 2794 a Fh(\003)64 2806 y Fv(NEC)12 b(Researc)o(h)e(Institute,)f(4)i(Indep)q(endenc)o(e)e(W)m(a)o(y)m(,)i (Princeton,)e(NJ)j(08540.)i(This)e(is)f(an)g(unpublished)d(tec)o(hnical)h (memorandum)o(.)14 2881 y(Do)q(cNum)891 b Fk(1)873 b Fv(.)16 b(1.)f(1.)g(0)p eop %%Page: 2 2 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)601 b(t)o(yp)q(eset)7 b(754)i(Jun)h(29,)f(1993)660 b(Chess)12 b(T)m(est)0 -75 y Fk(testees)18 b(whose)f(ratings)f(lie)g(in)f(a)h(narro)o(w)g(range.)25 b(W)m(e)15 b(ha)o(v)o(e)h(nev)o(er)h(seen)h(Nielsen's)e(set,)h(but)f(it)g(certainly)g (sounds)h(in)o(teresting,)0 -25 y(and)e(the)g(fact)g(that)g(he)g(has)g (administered)f(it)g(to)h(a)f(large)h(n)o(um)o(b)q(er)f(of)g(computers)h(mak) o(es)e(it)i(plausible)f(that)h(the)g(qualit)o(y)e(of)h(the)0 25 y(test)h(questions)f(is)g(high.)0 134 y Fj(1.2)43 b(What)15 b(one)h(wants)e(in)h(a)g(chess)h(test)e(suite)0 211 y Fk(What)e(one)h(really) f(w)o(an)o(ts)h(in)f(a)h(c)o(hess)h(test)g(is)e(not)h(only)f(a)g(p)q (osition,)g(but)h(also)f(to)h(kno)o(w)f(what)h(the)g(b)q(est)h(mo)o(v)o(e)d (is)i(in)f(that)h(p)q(osition)0 261 y(\(so)j(y)o(ou)g(can)g(see)i(if)d(y)o (our)h(program)f(w)o(ould)g(\014nd)h(it\))g({)g(p)q(ositions)g(with)g(unique) g(b)q(est)h(mo)o(v)o(es)e(are)i(naturally)e(preferred)j(for)e(the)0 311 y(presen)o(t)d(purp)q(oses)g({)f(and)f(also)g(to)h(ha)o(v)o(e)f(an)h (explanation)e(of)h Fj(why)h Fk(that)f(is)h(the)g(b)q(est)h(mo)o(v)o(e,)d(so) i(that)f(the)i(reason)f(that)f(the)i(program)0 361 y(failed)h(to)h(\014nd)g (it)g(\(or)g(the)h(reason)g(that)f(that)g(test)h(question)g(w)o(as)f(b)q (ogus!\))22 b(ma)o(y)13 b(b)q(e)j(determined.)21 b(The)16 b(p)q(osition)e (and)h(the)h(b)q(est)0 410 y(mo)o(v)o(e)f(need)i(to)f(b)q(e)h(a)o(v)n (ailable)d(in)i(electronic)h(form,)e(but)h(the)h(explanation)f(need)h(only)e (b)q(e)i(a)o(v)n(ailable)d(in)i(h)o(uman-readable)f(form)0 460 y(and)f(indeed)g(need)h(only)e(consist)i(of)e(a)h(page)f(n)o(um)o(b)q(er) h(reference)i(in)d(a)h(widely)f(a)o(v)n(ailable)f(c)o(hess)j(b)q(o)q(ok.)1631 445 y Fg(1)62 510 y Fk(Another)g(idea)f(is)g(to)g(ha)o(v)o(e)g(p)q(ositions)g (in)g(whic)o(h)g(there)h(is)f(some)g(plausible-lo)q(oking,)d(but)j (incorrect,)i(mo)o(v)o(e.)h(Do)q(es)d(the)h(testee)0 560 y(understand)f(that) f(it)g(should)f Fj(not)h Fk(mak)o(e)f(this)h(mo)o(v)o(e?)j(F)m(or)c(this)h (reason)h(w)o(e)f(ha)o(v)o(e)g(included)g(p)q(ositions)f(in)h(our)f(test)i (suite)g(in)e(whic)o(h)0 610 y(mistak)o(es)k(are)h(giv)o(en;)g(y)o(ou)f(pass) i(the)f(test)h(if)e(y)o(ou)g(prop)q(ose)i(an)o(y)e(mo)o(v)o(e)f(at)i(all,)e (so)i(long)f(as)h(it)f(isn't)h(listed)f(in)h(the)g(answ)o(er)h(as)e(a)0 660 y(\\mistak)o(e.")62 710 y(Ho)o(w)f(big)f(should)g(the)i(test)g(b)q(e?)21 b(W)m(e)14 b(b)q(eliev)o(e)i(it)e(should)h(b)q(e)g(big,)f(comprehensiv)o(e,)g (and)h(div)o(erse.)22 b(Our)15 b(test)h(set)g(is)e(curren)o(tly)0 760 y(5551)i(p)q(ositions)h(from)e(ab)q(out)i(25)f(sources.)30 b(This)17 b(test)h(w)o(ould)e(tak)o(e)h(90)g(hours,)g(ev)o(en)h(for)f(a)g (testee)i(who)d(is)h(exp)q(ected)i(to)e(solv)o(e)0 810 y(questions)i(at)f (the)h(\(fast\))f(rate)h(of)e(one)i(question)f(p)q(er)h(min)o(ute.)30 b(The)19 b(p)q(oin)o(t)e(is)h(that)h(b)o(y)f(including)f(so)h(man)o(y)e (questions,)k(one)0 859 y(b)q(ecomes)14 b(free)h(to)f(fo)q(cus)g(on)g (certain)g(sub)r(ject)h(areas)g(or)f(di\016cult)o(y)f(lev)o(els)h(b)o(y)f (devising)h(appropriate)g(subsets)h(of)f(the)g(questions.)62 909 y(Man)o(y)h(great)h(c)o(hess)g(authors)g(ha)o(v)o(e)f(b)q(een)h(w)o (orking)f(for)f(y)o(ears)i(to)f(create,)i(or)e(\014nd)g(in)g(tournamen)o(t)f (games,)g(p)q(ositions)h(whic)o(h)0 959 y(are)e(of)f(particular)g(p)q (edagogical)f(in)o(terest,)i(or)g(of)e(particular)i(in)o(terest)g(for)f (testing)h(purp)q(oses.)19 b(They'v)o(e)12 b(also)g(pro)q(duced)i(their)f(o)o (wn)0 1009 y(taxonomies)i(of)g(c)o(hess)j(themes)e(\([8])f(w)o(ere)j(not)e (the)h(\014rst)g(to)f(think)g(of)f(this!\))26 b(and)16 b(some)f(sources)j(ha) o(v)o(e)e(attempted)g(to)g(pro)o(vide)0 1059 y(complete)f(co)o(v)o(erage)g (of)g(their)g(taxonom)o(y)m(.)k(Therefore,)d(w)o(e)g(do)f(not)g(need)h(to)f (create)h(test)g(p)q(ositions)f(ourselv)o(es)h(\(a)f(v)o(ery)h(di\016cult)0 1109 y(task)d(to)h(do)f(without)g(errors\),)h(nor)g(do)f(w)o(e)g(need)i(to)e (mak)o(e)f(taxonomies,)f(nor)i(do)g(w)o(e)h(need)g(to)f(striv)o(e)h(for)f (complete)g(co)o(v)o(erage)h(of)e(a)0 1158 y(taxonom)o(y)m(.)j(This)d(has)g (already)f(b)q(een)j(done)e(for)g(us)g(b)o(y)g(all)f(the)h(c)o(hess)i (writers)f(and)f(analysts)f(of)h(the)g(w)o(orld,)g(with)f(b)q(etter)j (accuracy)0 1208 y(and)i(insigh)o(t,)f(and)g(sp)q(ending)i(more)e(thinking)f (time)h(on)g(the)i(task,)f(than)g(the)g(presen)o(t)i(authors)e(\(who)f(are)i (p)q(o)q(or)f(c)o(hess)h(pla)o(y)o(ers\))0 1258 y(will)12 b(ev)o(er)j(ha)o(v) o(e.)i(This)d(is)g(not)f(to)h(sa)o(y)f(that)h(p)q(ositions)f(in)g(c)o(hess)j (b)q(o)q(oks)d(are)i(error-free)g({)e(they)h(are)g(not.)k(W)m(e)c(just)f (think)h(that)g(the)0 1308 y(task)f(of)f(pro)q(ducing)h(a)f(test)i(set,)f (whic)o(h)g Fj(is)f Fk(error)i(free,)f(but)g(whic)o(h)g(is)f(also)g (di\016cult)g(enough)h(to)g(presen)o(t)h(a)e(c)o(hallenge)h(for)f(ev)o(en)i (the)0 1358 y(b)q(est)i(c)o(hesspla)o(y)o(ers)g(in)e(the)h(w)o(orld)f(and)g (at)g(the)h(same)f(time)f(large)h(enough)h(to)f(co)o(v)o(er)h(most)f(imp)q (ortan)o(t)e(asp)q(ects)17 b(of)c(c)o(hess)j(pla)o(y)m(,)d(is)0 1408 y(to)q(o)h(di\016cult)f(a)g(task.)62 1458 y(In)k(practice,)i(therefore,) g(one)e(m)o(ust)f(b)q(e)i(satis\014ed)g(with)f(the)g(lev)o(el)g(of)g (di\016cult)o(y)m(,)f(accuracy)i(and)f(sub)r(ject)i(co)o(v)o(erage)e(that)g (is)0 1507 y(a)o(v)n(ailable)e(in)i(c)o(hess)i(b)q(o)q(oks,)f Fj(plus)f Fk(a)g(certain)h(amoun)o(t)d(of)i(extra)h(accuracy)g(can)g(b)q(e)g (obtained)f(as)g(follo)o(ws:)23 b(as)18 b(more)e(and)h(more)0 1557 y(computer)12 b(programs)g(tak)o(e)g(the)h(test,)h(rep)q(orting)f(their) g(results)g(bac)o(k)g(to)f(a)h(cen)o(tral)g(lo)q(cation)e(\(that)i(is:)k(us!) h(By)13 b(electronic)h(mail!)o(\),)0 1607 y(it)g(should)f(gradually)g(b)q (ecome)g(clear)i(whic)o(h)e(test)i(questions)g(ha)o(v)o(e)f(errors.)62 1657 y(All)f(w)o(e)h(really)g(need)h(to)e(do,)g(then,)i(is)e(to)h(en)o(ter)h (c)o(hessb)q(o)q(oks)h(in)o(to)d(the)h(computer.)0 1766 y Fj(1.3)43 b(What)15 b(we)g(did)0 1843 y Fk(F)m(or)i(this)g(purp)q(ose,)h(one)g(of)e(us) i(\(KL\))f(wrote)h(a)f(program)e(whic)o(h)i(uses)i(an)d(optical)h(scanner)h (to)f(read)h(in)e(c)o(hess)j(p)q(ositions)e(from)0 1893 y(diagrams)e(in)i(c)o (hess)h(b)q(o)q(oks.)28 b(W)m(e)16 b(are)i(not)f(willing/able)d(to)j(giv)o(e) g(a)o(w)o(a)o(y)f(this)h(program,)f(since)h(it)g(dep)q(ends)i(on)e(ha)o(ving) f(certain)0 1943 y(hardw)o(are)i(and)g(soft)o(w)o(are)f(unique)h(to)g(our)f (lab,)h(and)f(also)g(since)i(it)e(needs)i(to)f(b)q(e)g(retrained)h(on)e(eac)o (h)i(new)f(c)o(hessb)q(o)q(ok,)h(whic)o(h)0 1993 y(at)c(presen)o(t)i(is)e(a)g (relativ)o(ely)g(quic)o(k,)f(but)i(not)f(fully)f(automated,)g(pro)q(cess.)24 b(W)m(e)15 b(will,)e(ho)o(w)o(ev)o(er,)j(tell)f(something)f(ab)q(out)h(ho)o (w)f(the)0 2043 y(program)e(w)o(orks,)i(see)h Fi(x)p Fk(3.)62 2093 y(The)c(other)g(of)f(us)h(\(WDS\))f(acquired)g(and)g(scanned)i(in)e(the) h(b)q(o)q(oks)f(and)g(th)o(us)h(created)h(the)f(test)h(suite)e(of)g(c)o(hess) i(p)q(ositions)e(w)o(e)h(will)0 2143 y(describ)q(e)g(in)e Fi(x)q Fk(2.)16 b(This)10 b(test)g(suite)g(is)g(a)o(v)n(ailable)d(b)o(y)i(anon)o (ymous)f(FTP)i(o)o(v)o(er)f(the)i(in)o(ternet)f(as)g(\014le)f(\\)p Ff(ChessTest.tar.Z)p Fk(")d(in)j(directory)0 2192 y Ff(pub/wds)f Fk(at)h(site)h Ff(external.NJ.NEC.)o(COM)p Fk(.)5 b(It)10 b(con)o(tains)f (sev)o(eral)h(thousand)f(c)o(hess)i(p)q(ositions.)16 b(Notify)9 b Ff(wds@research.NJ.)o(NEC.C)o(OM)0 2242 y Fk(of)k(an)o(y)h(corrections.)857 2356 y Fl(2)46 b(The)16 b(test)f(suite)0 2447 y Fj(2.1)43 b(F)m(ormat)0 2524 y Fk(Our)13 b(test)g(p)q(ositions)f(o)q(ccur)h(in)e(sev)o(eral)i(ASCI)q (I)f(\014les,)h(eac)o(h)f(of)g(whic)o(h)g(uses)h(a)f(\\F)m(orsythe")g (format.)k(In)c(this)g(format,)e(eac)o(h)j(p)q(osition)0 2574 y(o)q(ccupies)i(a)f Fj(single)g(line)g Fk(of)f(an)h(ASCI)q(I)g(\014le.)k(A)c (t)o(ypical)f(en)o(try)i(migh)o(t)c(b)q(e)p 0 2610 837 2 v 46 2637 a Fe(1)64 2648 y Fv(Another)g(idea,)h(whic)o(h)g(w)o(e)i(ha)o(v)o(e)d (not)h(used:)17 b(One)c(migh)o(t)e(w)o(an)o(t)i(the)f(testee,)g(instead)f(of) h(sa)o(ying)g(what)g(the)g(\\b)q(est)g(mo)o(v)o(e")f(is,)i(merely)e(to)i(ev)n (aluate)0 2688 y(the)g(p)q(osition:)18 b(e.g.)j(\\this)13 b(p)q(osition)f(is) i(a)f(win)h(for)g(white.")21 b(But,)14 b(h)o(yp)q(othetic)o(all)o(y)m(,)e(it) h(w)o(ould)g(b)q(e)h(p)q(ossible)e(to)h(mak)o(e)g(a)g(v)o(ery)g(\014ne)g(c)o (hesspla)o(y)o(er)e(whic)o(h)0 2727 y(could)g(not)g(answ)o(er)g(suc)o(h)g (questions.)j(W)m(e)e(do)g(not)f(think)g(suc)o(h)g(p)q(ositions)f(are)h (useful)f(as)i Fd(tests)g Fv(of)f(computer)e(c)o(hess)i(pla)o(y)o(ers)g({)h (they)e(are)i(p)q(erhaps)e(more)0 2767 y(naturally)f(useful)g(as)j(training)d (data.)14 b(T)m(o)d(k)o(eep)f(things)g(simple,)g(test)g(p)q(ositions)f (should)h(require)f(the)i(computer)d(to)j(mak)o(e)f(an)g(actual)g(action)g (\(pla)o(ying)f(a)0 2806 y(mo)o(v)o(e\))h(so)h(that)g(y)o(ou)f(can)h(easily)f (grade)g(the)h(test.)14 2881 y(Do)q(cNum)891 b Fk(2)885 b Fv(.)12 b(2.)f(1.)g(0)p eop %%Page: 3 3 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)0 -75 y Ff (2rr3k/pp3pp1/1nnq)o(bN1p/)o(3pN3/)o(2pP4/)o(2P3Q1)o(/PPB4)o(P/R4)o(RK1/w)18 b(Qg3g6)j(Reinfeld.300.1)0 661 y Fk(whic)o(h)9 b(indicates)h(the)g(follo)o (wing)c(p)q(osition:)p 2742 -7 673 5 v 2742 657 5 665 v 2747 76 a Fc(0Zrs0Z0j)2747 159 y(opZ0Zpo0)2747 242 y(0mnlbM0o)2747 325 y(Z0ZpM0Z0)2747 408 y(0ZpO0Z0Z)2747 491 y(Z0O0Z0L0)2747 574 y(POBZ0Z0O)2747 657 y(S0Z0ZRJ0)p 3411 657 V 2742 661 673 5 v 354 711 a Fk(White)14 b(to)g(mo)o(v)o(e)e(Qg3g6.)17 b(#1/300)12 b(test)j(p)q(ositions)f(from)e(Reinfeld's)h Fj(Win)j(at)e(Chess)p Fk(.)62 763 y(Eac)o(h)f(line)f(has)h(three)h(\014elds,)e(separated)i(b)o(y)e (a)g(\\space")h(c)o(haracter.)19 b(The)13 b(\014rst)h(\014eld)e(is)g(the)i(p) q(osition)d(in)h(\\F)m(orsythe")h(notation)0 813 y(\(ending)g(\\)p Ff(/w)p Fk(")e(when)i(white)g(is)f(to)h(mo)o(v)o(e,)d Ff(/b)j Fk(when)g(blac)o(k)f(is)g(to)h(mo)o(v)o(e\).)j(The)d(second)g(\014eld)g(is)f (the)h(recommended)f(mo)o(v)o(e)f(in)h(long-)0 863 y(form)h(double)h (algebraic)g(\(some)g(other)i(mo)o(v)o(es)d(p)q(ossible,)h(though)h(not)f(go) q(o)q(d,)g(in)g(this)h(p)q(osition)f(are)h Ff(Ne5xNc6)e Fk(and)i Ff(Ne5xPf7+)p Fk(;)d(a)0 912 y(promotion)e(with)i(capture)h(of)f(a)g(knigh)o (t)f(and)h(giving)f(c)o(hec)o(k)i(migh)o(t)d(b)q(e)j(indicated)f(b)o(y)g Ff(Pe7xNd8=Q+)p Fk(;)e(a)i(castling)f(mo)o(v)o(e)g(b)o(y)h Ff(Ke1g1C)p Fk(;)0 962 y(en-passan)o(t)18 b(captures)h(similarly)14 b(ha)o(v)o(e)k(a)f(con)o(v)o(enien)o(t)h Ff(E)f Fk(su\016x\).)28 b(The)18 b(third)g(\014eld)f(\(whic)o(h)h(ma)o(y)d(include)j(spaces\))h(is)e (the)h(rest)0 1012 y(of)c(the)i(line,)f(and)f(should)h(indicate)g(either)h (directly)g(or)f(b)o(y)f(citation,)h Fj(why)g Fk(this)g(is)g(the)g(correct)i (mo)o(v)o(e,)c(plus)i(it)g(can)g(include)h(an)o(y)0 1062 y(commen)o(ts,)c (analysis,)g(or)i(extra)g(information)d(at)j(all.)62 1114 y(The)h Fj(absenc)n(e)f Fk(of)f(an)h(indicated)g(solution)f(\(rarely)h(happ)q(ens\))h (is)f(indicated)g(b)o(y)f Ff(*)h Fk(in)g(the)g(second)h(\014eld)f(in)f(place) h(of)g(a)f(mo)o(v)o(e.)62 1166 y(There)18 b(ma)o(y)d(also)g(b)q(e)j(lines)e (in)g(the)h(\014le,)g(not)f(of)g(this)h(form.)24 b(The)17 b(testee)i(ma)o(y) 14 b(assume)i(that)h(ev)o(ery)g(line)f(in)h(the)g(\014le)f(whic)o(h)0 1216 y(con)o(tains)e(exactly)g(8)f(\\)p Ff(/)p Fk(")h(c)o(haracters)h(is)f(a) g(test)g(p)q(osition,)f(and)h(that)g(all)e(other)j(lines)f(in)f(the)i(\014le) f(are)g(commen)o(ts.)62 1268 y(As)e(for)f(castling)g(and)g(en)h(passan)o(t.) 18 b(Normally)m(,)8 b(if)j(a)g(king)f(or)i(a)f(ro)q(ok)g(are)h(on)f(their)h (original)d(squares,)k(then)f(one)f(should)h(assume)0 1317 y(that)k(they)f(ha)o(v)o(e)h(nev)o(er)g(previously)f(mo)o(v)o(ed.)22 b(Also,)15 b(one)g(should)h(assume)f(that)g(there)i(is)e(no)h(en)f(passan)o (t)h(opp)q(ortunit)o(y)m(.)22 b(99\045)15 b(of)0 1367 y(the)h(time,)d(these)j (assumptions)e(will)g(b)q(e)h(correct,)i(but)e(w)o(e)g(pro)o(vide)g(for)f (the)i(exceptional)f(case)g(when)h(they)f(are)h(not,)e(as)h(follo)o(ws.)0 1417 y(A)f(\\)p Ff(s)p Fk(")g(represen)o(ts)j(a)d(blac)o(k)g(ro)q(ok)g(whic)o (h,)f(despite)j(the)f(fact)f(that)g(it)g(is)g(on)g(its)h(original)d(square,)j (and)f(despite)h(the)g(fact)f(that)h(the)0 1467 y(blac)o(k)f(king)g(ma)o(y)f (b)q(e)i(on)f(its)h(original)e(square,)i(has)f(forfeited)h(its)g(castling)f (privileges.)20 b(A)14 b(\\)p Ff(o)p Fk(")g(represen)o(ts)k(a)c(blac)o(k)g (pa)o(wn)g(whic)o(h)0 1517 y(is)h(capturable)h(next)g(mo)o(v)o(e)e(b)o(y)i (en)g(passan)o(t.)23 b(These)17 b(mnemonics)c(are)j(easily)f(remem)o(b)q (ered)g(since)i Ff(o)e Fk(is)g(adjacen)o(t)h(to)f Ff(p)h Fk(and)f Ff(s)g Fk(is)0 1566 y(adjacen)o(t)f(to)g Ff(r)f Fk(alphab)q(etically)m(.)k (\(Similarly)10 b Ff(S,O)k Fk(are)g Fj(white)p Fk(.\))62 1618 y(If)j(sev)o(eral)h(mo)o(v)o(es)e(are)h(listed)g(in)g(the)h(second)g (\014eld,)g(separated)g(b)o(y)f(commas,)e(then)j(if)e(the)i(testee)h (suggests)f(an)o(y)f(of)f(them,)0 1668 y(he/she/it)e(gets)h(full)d(p)q(oin)o (ts.)18 b(If)13 b(sev)o(eral)i(mo)o(v)o(es)d(are)i(listed,)f(separated)i(b)o (y)f(commas,)d(but)j(one)f(of)h(them)e(has)i(an)g(\\)p Ff(!)p Fk(")k(app)q(ended,)0 1718 y(then)13 b(this)f(means)g(that)g(although)g(all)f (the)i(mo)o(v)o(es)e(listed)h(are)h(game)e(theoretically)h(optimal,)d(the)k (one)g(with)f(the)h Ff(!)18 b Fk(is)12 b(the)h(quic)o(k)o(est)0 1768 y(and)i(clearest.)21 b(If)15 b(the)g(listed)g(mo)o(v)o(e)e(has)h(\\)p Ff(?)p Fk(")21 b(app)q(ended,)15 b(then)g(this)g(mo)o(v)o(e)e(is)i(a)f (mistak)o(e,)f(and)i(the)g(testee)i(receiv)o(es)f(a)e(p)q(oin)o(t)g(for)0 1818 y(prop)q(osing)g Fj(any)h Fk(mo)o(v)o(e)e Fj(other)i Fk(than)f(this)h (one.)20 b(Note:)g(mo)o(v)o(es)13 b(with)h(\\?!")19 b(or)14 b(\\!?")19 b(\(in)c(suc)o(h)g(cases,)g(w)o(e)g(copied)g(the)g(punctuation)0 1867 y(from)d(the)j(b)q(o)q(ok\))e(are)i Fj(not)f Fk(mistak)o(es.)0 1987 y Fj(2.2)43 b(A)n(c)n(cur)n(acy)0 2067 y Fk(W)m(e)13 b(p)q(erformed)h (the)h(follo)o(wing)c(\\sanit)o(y)i(c)o(hec)o(ks")i(on)f(our)g(data.)51 2157 y(1.)20 b(W)m(e)13 b(c)o(hec)o(k)o(ed)i(that)f(all)f(pa)o(wns)h(w)o(ere) h(on)e(the)i(2-7)e(ranks)h(\(not)g(1,8\).)51 2248 y(2.)20 b(W)m(e)13 b(c)o(hec)o(k)o(ed)i(that)f(exactly)g(one)h(king)e(of)g(eac)o(h)h(color)g (existed.)51 2340 y(3.)20 b(No)14 b(more)e(than)i(8)g(pa)o(wns)g(of)f(eac)o (h)h(color)g(exist,)g(etc.)51 2432 y(4.)20 b(P)o(ositions)c(with)h(3)g(knigh) o(ts,)g(3)f(ro)q(oks,)i(2)f(queens,)h(or)f(2)g(bishops)g(of)f(the)i(same)e (color)h(on)g(the)g(same)f(color)h(squares)h(w)o(ere)104 2482 y(\015agged)13 b(as)h(\\suspicious")g(and)g(h)o(uman-v)o(eri\014ed.)51 2573 y(5.)20 b(The)14 b(\\righ)o(t)f(mo)o(v)o(e")f(is)i(alw)o(a)o(ys)f(a)g (legal)g(mo)o(v)o(e.)51 2665 y(6.)20 b(The)14 b(side)g(not-on-mo)o(v)o(e)e (is)i(not)g(in)f(c)o(hec)o(k.)51 2756 y(7.)20 b(In)12 b(some)g(cases)i (redundan)o(t)f(side-to-mo)o(v)o(e)e(information)e(w)o(as)k(pro)o(vided)f(in) g(the)h(b)q(o)q(ok,)f(whic)o(h)g(w)o(as)h(used)g(to)g(help)f(eliminate)104 2806 y(errors)j(in)e(deciding)h(whose)h(mo)o(v)o(e)d(it)h(w)o(as.)14 2881 y Fv(Do)q(cNum)891 b Fk(3)873 b Fv(.)16 b(2.)f(2.)g(0)p eop %%Page: 4 4 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)62 -75 y Fk(Also,)h(the)i(c)o(hessman)f(recognition)f(pro)q(cess)j(whic)o(h)d(created) j(the)e(data)g(in)f(the)i(\014rst)f(place,)g(w)o(as)f(semi-automated,)e(that) j(is,)f(a)0 -25 y(sup)q(ervising)h(h)o(uman)f(w)o(as)g(required)i(to)f(v)o (erify/correct)h(eac)o(h)f(piece)h(classi\014cation.)62 28 y(These)h(steps)g(su\016ced)g(to)f(eliminate)d(most)i(of)g(the)h(egregious)g (clerical)g(errors,)h(but)f(w)o(e)g(ha)o(v)o(e)f(no)h(doubt)f(that)h(some)f (remain.)0 78 y(Also,)i(prin)o(ting)g(errors)h(in)f(the)h(original)d(c)o (hessb)q(o)q(oks)k(certainly)f(exist)f({)g(w)o(e)h(sp)q(otted)g(6)f(\(more)f (precise)j(details)e(ma)o(y)f(b)q(e)i(found)0 127 y(in)d(the)i(test)g(set)g (\014les\),)f(whic)o(h)g(suggests)h(the)f(error)h(rate)f(due)h(to)e (incorrect)j(p)q(ositions)d(is)h Fb(>)e Fk(0)p Fb(:)p Fk(1\045.)20 b(Ev)o(en)15 b(in)g(the)g(ev)o(en)o(t)h(all)d(suc)o(h)0 177 y(clerical)j(errors)h(w)o(ere)g(eliminated,)d(this)i(is)f(hardly)h(an)o(y)f (guaran)o(tee)i(that)f(the)g(c)o(hess)i(problems)c(and)i(their)g(answ)o(ers)h (are)g(in)e(fact)0 227 y(v)n(alid.)h(Generally)m(,)d(w)o(e)h(are)g(not)g (able,)f(and)h(ha)o(v)o(e)g(not)f(tried)i(to,)e(pro)o(vide)h(suc)o(h)g(a)g (guaran)o(tee.)62 280 y(Ho)o(w)o(ev)o(er,)k(the)f(sets)h(\(Reinfeld,)e(Bratk) o(o-Kop)q(ec\))i(whic)o(h)f(ha)o(v)o(e)f(b)q(een)i(administered)e(to)h(man)o (y)e(computers)h(previously)m(,)h(are)0 330 y(naturally)g(exp)q(ected)i(to)f (b)q(e)g(highly)e(reliable.)29 b(This)18 b(testing)g(pro)q(cess)h(has,)f(o)o (v)o(er)g(the)g(y)o(ears,)h(unco)o(v)o(ered)f(24)g(co)q(oks)1901 315 y Fg(2)1937 330 y Fk(\(most)f(of)0 379 y(whic)o(h)12 b(w)o(ere)h(not)f (serious\))h(and)f(one)h(wrong)f(answ)o(er,)h(that)f(w)o(e)g(kno)o(w)g(ab)q (out,)g(in)g(the)g(300)g(p)q(osition)f(win-at-c)o(hess)i(set,)g(and)f(1)g(co) q(ok)0 429 y(in)j(the)i(Bratk)o(o-Kop)q(ec)g(24)e(p)q(osition)h(set.)25 b(This)16 b(leads)g(to)f(an)h(estimated)g(error)g(rate)h(due)f(to)g(wrong)g (analysis)f(of)g Fb(>)h Fk(0)p Fb(:)p Fk(3\045,)e(and)0 479 y(due)i(to)f(co)q(oks,)h(of)e(ab)q(out)i(5\045,)e(and)h(the)h(co)q(ok)g(rate) g(is)f(presumably)f(ev)o(en)i(higher)g(in)e(certain)i(of)f(our)h(\014les)f (whose)h(sources)h(w)o(ere)0 529 y(not)d(going)e(to)i(an)o(y)g(great)g (e\013ort)g(to)g(eliminate)e(co)q(oks.)62 582 y(See)j(also)e Fi(x)q Fk(3.4)g(where)i(an)e(estimate)h(that)g(1\045)f(of)g(the)i(answ)o(ers) f(w)o(ere)h(mist)o(yp)q(ed,)e(is)g(giv)o(en.)62 634 y(Bottom)g(line:)k(our)d (guess)h(is)f(that)g(2-3\045)f(of)g(our)h(questions)g(are)h(buggy)m(,)d (where)j(nonserious)g(co)q(oks)f(don't)f(coun)o(t)h(as)g(\\bugs.")62 687 y(So)g(long)f(as)h(our)g(tests)i(are)e(hard)g(enough)h(that)f(no)f (testee)j(is)e(capable)g(of)g(scoring)g(80\045,)f(these)i(error)g(rates)g (are)f(not)g(going)f(to)0 737 y(matter)f(m)o(uc)o(h,)f(since)i(the)g(v)n(ast) g(ma)r(jorit)o(y)d(of)i(the)h(wrong)f(answ)o(ers)i(are)f(going)e(to)i(b)q(e)g (due)g(to)f(the)h(testee's)i(incomp)q(etence)e(and)f(not)0 787 y(to)i(the)h(tester's.)21 b(By)15 b(the)g(time)e(c)o(hess)j(computers)e (start)h(getting)f(go)q(o)q(d)g(enough)h(to)f(break)h(80\045,)e(the)i(error)g (rate)g(in)f(our)g(set)i(will)0 836 y(hop)q(efully)d(ha)o(v)o(e)h(shrunk.)0 960 y Fj(2.3)43 b(T)m(actics)0 1042 y Fk(T)m(o)14 b(create)h(a)f(tactics)i (test)f(suite,)f(w)o(e)h(scanned)h(in)d(the)i(1001)f(p)q(ositions)g(from)e (Reinfeld's)i(b)q(o)q(ok)g([30)o(].)19 b(The)c(answ)o(ers)g(at)f(the)h(bac)o (k)0 1091 y(of)e(the)h(b)q(o)q(ok)f(w)o(ere)i(t)o(yp)q(ed)f(in)f(b)o(y)g (hand)h(\(their)g(\014rst)g(mo)o(v)o(e)e(only\).)18 b(The)c(300)e(p)q (ositions)i(from)d(Reinfeld's)i(other)h(b)q(o)q(ok)g([31)o(],)e(along)0 1141 y(with)17 b(their)h(answ)o(ers)g(as)f(c)o(hec)o(k)o(ed)i(b)o(y)e(Hans)g (Berliner)h(and)f(HITECH,)g(w)o(ere)i(obtained)e(from)e(Berliner.)29 b(Reinfeld's)16 b(p)q(ositions)0 1191 y(w)o(ere)e(mostly)d(culled)i(from)e (master)h(games.)17 b(W)m(e)c(also)f(scanned)i(the)f(100)g(p)q(ositions)f (from)f(c)o(hapter)j(1)f(\(\\Find)f(the)i(com)o(bination"\))0 1241 y(of)h([23)o(],)g(with)g(the)h(\014rst)g(mo)o(v)o(es)e(of)h(their)h (answ)o(ers,)g(along)e(with)h(the)h Fi(\031)e Fk(100)h(tactics)h(p)q (ositions)f(from)f([15)o(].)22 b(F)m(or)15 b(some)g(purp)q(oses)0 1291 y(these)g(com)o(binations)d(ma)o(y)h(not)g(b)q(e)i(di\016cult)f(enough.) k(Hence)e(w)o(e)e(also)f(scanned)j(the)e(879)g(p)q(ositions)f(in)h(the)h (second)g(\(hard\))f(half)0 1341 y(of)h(the)h(\\encyclop)q(edia)g(of)f(c)o (hess)i(middlegam)o(es")c([1])i(and)g(50)g(p)q(ositions)h(from)d([12)o(])i (whic)o(h)h(\(Fine)g(seems)f(to)h(think\))f(are)h(among)0 1390 y(the)e(most)f(di\016cult)g(com)o(binations)f(ev)o(er)j(pla)o(y)o(ed)e(o)o(v) o(er)h(the)h(b)q(oard)1062 1375 y Fg(3)1080 1390 y Fk(.)62 1443 y(So)f(in)g(total)f(w)o(e'v)o(e)h(got)g Fi(\031)e Fk(2530)i(p)q (ositions)f(to)h(test)i(\\tactics,")e(that)g(is,)f(p)q(ositions)h(in)g(whic)o (h,)g(for)f(the)i(most)e(part,)h(there)h(is)f(a)0 1493 y(unique)g(b)q(est)i (mo)o(v)o(e,)c(whic)o(h)j(forces)g(the)g(win)f(of)f(a)i(usually)e(decisiv)o (e)i(amoun)o(t)e(of)g(material,)f(or)j(c)o(hec)o(kmate,)f(or)g(forces)h(a)f (dra)o(w)h(in)0 1543 y(an)g(otherwise)h(lost)f(p)q(osition,)f(and)h(all)f (these)i(things)f(happ)q(en)h(fairly)e(quic)o(kly)g(\(the)i(deep)q(est)h (solutions)e(are)g(ab)q(out)g(27)g(ply)g(long,)0 1593 y(the)f(shallo)o(w)o (est,)g(ab)q(out)f(5)h(ply\).)62 1645 y(Strength)i(v)o(ersus)g(results:)22 b(Larsen)16 b([23)o(])e(claims)f(that,)i(in)g(his)g(100)f(p)q(ositions,)h(he) g(imagines)e(a)i([h)o(uman])d(master)j(w)o(ould)f(\014nd)0 1695 y(the)e(righ)o(t)f(answ)o(er)h(in)f(30)g(seconds,)i(95\045)d(of)h(the)h (time,)e(if)h(the)h(master)f(w)o(ere)h(forearmed)f(with)g(the)h(kno)o(wledge) f(that)g(a)h(com)o(bination)0 1745 y(w)o(as)i(there.)22 b(\(Actually)m(,)13 b(the)i(masters)f(I'v)o(e)g(tried)h(it)f(on)h(seem)f(to)g(tak)o(e)h(ab)q(out) f(150)g(seconds,)i(not)e(30.\))19 b(Reinfeld's)14 b(and)g(Larsen's)0 1795 y(tactics)g(collections)f(\(recall,)f(Deep)i(Though)o(t)f(solv)o(ed)f (297/299\))g(are)h(easier)h(than)f(the)g(hard)g(ECM)h(p)q(ositions,)e(whic)o (h)h(in)f(turn)i(are)0 1844 y(easier)h(than)f(the)g(Fine)g(p)q(ositions.)0 1968 y Fj(2.4)43 b(Positional)14 b(play)0 2050 y Fk(F)m(ar)i(harder)g(to)g (create)i(\(and)e(to)f(b)q(e)i(certain)g(of)e(accuracy\))i(is)f(a)g(set)g(of) g(p)q(ositions)g(testing)g(\\p)q(ositional)e(pla)o(y)m(,")h(lo)q(osely)g (de\014ned)0 2100 y(as)j(p)q(ositions)f(in)g(whic)o(h)g(the)h(b)q(est)h(mo)o (v)o(e)d(forces)i(some)e(p)q(ositional)h(adv)n(an)o(tage)f(whic)o(h)h(w)o (ould)g(not)g(b)q(e)i(recognized)f(b)o(y)f(a)h(naiv)o(e)0 2149 y(ev)n(aluation)e(that)i(only)e(kno)o(ws)i(ab)q(out)f(material)e(and)j(c)o (hec)o(kmate.)29 b(The)17 b(issue)i(is)e(blurred.)29 b(By)18 b(searc)o(hing)g(su\016cien)o(tly)g(deep,)0 2199 y(ev)o(en)d(these)g(p)q (ositions)f(should)g(b)q(e)h(soluble,)e(ev)o(en)i(with)f(a)g(naiv)o(e)f(ev)n (aluator.)18 b(Also,)c(one)g(certainly)g(cannot)g(ignore)g(material)e(and)0 2249 y(c)o(hec)o(kmate)g(when)h(solving)e(these)i(p)q(ositions,)f(and)g (indeed)h(a)f(small)e(n)o(um)o(b)q(er)h(of)h(our)g(\\p)q(ositional")e(p)q (ositions)i(are)g(purely)h(tactical,)0 2299 y(since)j(sometimes)d(c)o(hess)k (authors)e(lik)o(e)g(to)g(insert)g(a)g(tactical)g(tric)o(k)g(or)g(t)o(w)o(o)g (in)o(to)f(their)i(discussions)g(of)e(p)q(ositional)g(strategy)i(just)0 2349 y(to)e(k)o(eep)g(y)o(ou)g(on)f(y)o(our)h(to)q(es.)62 2401 y(W)m(e)j(scanned)h(in)e(the)i(495)e(p)q(ositions)h(from)e([13)o(],)i(of)f (whic)o(h)h Fi(\031)g Fk(300)f(\(allegedly\))g(ha)o(v)o(e)h(a)f(unique)h(b)q (est)h(mo)o(v)o(e)e(and)g(th)o(us)i(are)0 2451 y(suitable)d(for)f(test)i (purp)q(oses.)23 b(The)15 b(48)f(p)q(ositions)h(from)e(c)o(hapter)j(2)e (\(\\Find)h(the)g(plan"\))f(of)h([23)o(])f(and)h(the)g(33)g(p)q(ositions)f (from)f([7])0 2501 y(are)k(nearly)f(all)f(usable,)i(as)f(are)h(the)g(24)e(p)q (ositions)h(of)g(the)h(\\Bratk)o(o-Kop)q(ec)g(test")g(\(apparen)o(tly)f (mostly)f(culled,)h(in)g(turn,)h(from)0 2551 y([16)o(]\))d(and)h(the)g Fi(\031)e Fk(25)h(\\planning")e(and)j(\\analysis")e(p)q(ositions)h(from)f ([15)o(].)19 b(W)m(e)c(also)e(got)i(26)f(p)q(ositions)g(from)f([20)o(],)g(25) h(from)f([28)o(],)0 2601 y(18)g(from)f([12],)g(10)i(from)e([8)o(],)h(ab)q (out)h(50)f(from)f([19)o(],)h(ab)q(out)h(110)f(from)f([22)o(],)h(and)h(ab)q (out)g(130)f(from)f(miscellaneous)h(sources.)p 0 2649 837 2 v 46 2676 a Fe(2)64 2688 y Fv(F)m(or)f(the)f(purp)q(oses)f(of)i(this)g(pap)q (er,)f(a)h(\\co)q(ok")e(means)h(an)h(alternate)e(solution)g(with)i(the)g (same)f(game-theo)o(reti)o(c)f(v)n(alue.)16 b(In)c(cases,)f(where)h(mo)o(v)o (e)f(A)0 2727 y(leads)f(to)h(a)h(win)f(of)h(a)f(knigh)o(t)f(for)h(a)g(pa)o (wn)g(while)g(mo)o(v)o(e)f(B)i(leads)f(to)g(a)g(quic)o(k)f(c)o(hec)o(kmate,)e (mo)o(v)o(e)j(A)h(is)f(probably)e(a)j(co)q(ok,)e(according)e(to)k(our)e (de\014nition,)0 2767 y(but)h(it)g(is)g(hard)g(to)g(tak)o(e)f(it)i(seriously) m(.)46 2794 y Fe(3)64 2806 y Fv(A)g(b)q(o)q(ok)e(that)g(w)o(as)i(recommende)o (d)d(to)i(us,)g(but)g(whic)o(h)g(w)o(e)h(ha)o(v)o(e)e(not)h(scanned,)e(is)i (Mark)g(Dv)o(oretsky's)e Fd(The)k(art)g(of)g(analysis)f Fv(\(in)f(Russian\).) 14 2881 y(Do)q(cNum)891 b Fk(4)873 b Fv(.)16 b(2.)f(4.)g(0)p eop %%Page: 5 5 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)62 -75 y Fk(All)18 b(of)f(these)j(sources)f(pro)o(vide)f(fairly)f(long)g(textual)h (explanations)g(\(in)f(almost)g(all)f(cases,)k(an)o(yw)o(a)o(y\))d (justifying)g(the)i(b)q(est)0 -25 y(mo)o(v)o(e,)12 b(but)i(w)o(e)g(only)f(t)o (yp)q(ed)i(in)e(the)h(mo)o(v)o(e)f(itself,)g(along)f(with)i(a)g(reference)i (to)e(where)h(in)e(what)h(b)q(o)q(ok)g(w)o(e)g(got)f(it)h(from.)62 32 y(Th)o(us)g(w)o(e)h(ha)o(v)o(e)e(ab)q(out)h(800)f(p)q(ositions)h(testing)g (\\p)q(ositional")e(pla)o(y)m(.)62 89 y(Strength)21 b(vs)f(results.)37 b(Bellin)19 b(and)h(P)o(onzetto)g([7])f(claim)e(that,)k(\\based)g(on)e(man)o (y)f(practical)i(tests)h(with)e(pla)o(y)o(ers)h(of)f(all)0 139 y(categories,")f(if)e(y)o(ou)h(ac)o(hiev)o(e)g(a)g(p)q(erfect)h(score)g (on)f(their)h(test)g(y)o(ou)e(w)o(ould)g(ha)o(v)o(e)h(a)g(2760)f(FIDE)h (rating)f({)h(comparable)f(to)g(the)0 188 y(w)o(orld)10 b(c)o(hampion)f({)i (but)g(with)f(a)h(50\045)f(score)i(y)o(ou)e(w)o(ould)g(b)q(e)i(ab)q(out)e (FIDE)h(1550,)f(with)h(roughly)f(linear)g(in)o(terp)q(olation)g(in)g(b)q(et)o (w)o(een.)0 238 y(This)16 b(is)f(with)h(thinking)f(30)g(min)o(utes)g(p)q(er)h (p)q(osition)f(and)h(a)f(lot)g(of)h(hin)o(ts.)23 b(The)17 b(Gelfer)e(p)q (ositions)h(are)g(sligh)o(tly)e(easier)j(than)f(the)0 288 y(Bellin)c(p)q (ositions.)18 b(Larsen)13 b(sa)o(ys)g(his)g(\\\014nd)g(the)g(plan")f(p)q (ositions)h(are)g(harder)h(than)f(his)g(\\\014nd)f(the)i(com)o(bination")c(p) q(ositions,)i(and)0 338 y(advises)g(10)f(min)o(utes)g(of)g(though)o(t)g(on)h (eac)o(h)g(one;)g(but)g(they)g(are)g(somewhat)f(easier)h(than)g(the)g(Gelfer) g(p)q(ositions.)17 b(Our)12 b(\\p)q(ositional")0 388 y(collection)h(is)h(in)g (turn)g(easier)h(than)f(the)g(Larsen)h(planning)d(p)q(ositions.)0 533 y Fj(2.5)43 b(Endgames)0 622 y Fk(It)14 b(is)g(univ)o(ersally)f(agreed)h (that)g(endgame)f(pla)o(y)g(is)h(qualitativ)o(ely)e(di\013eren)o(t)j(from)d (middlegam)o(e)f(and)j(op)q(ening)g(pla)o(y)m(.)62 679 y(Endgames)20 b(also)g(can)g(in)o(v)o(olv)o(e)f(themes)i(of)e(stalemate,)i(p)q(erp)q(etual) g(c)o(hec)o(ks)h(and)e(p)q(erp)q(etual)i(attac)o(ks,)f(insu\016cien)o(t)g(v)o (ersus)0 729 y(su\016cien)o(t)11 b(mating)d(material,)g(recognition)i(of)g (kno)o(wn)g(wins)g(and)g(dra)o(ws,)h(underpromotions,)f(and)g(the)h (construction)g(of)f(\\in)o(v)n(asion-)0 779 y(pro)q(of)17 b(fortresses,")j(all)c(of)h(whic)o(h)g(are)h(notoriously)e(hard)i(for)f (computers)g(to)g(understand,)i(or)f(else)g(are)g(notorious)f(sources)i(of)0 828 y(program)12 b(bugs,)i(and)f(th)o(us)h(are)h(go)q(o)q(d)e(testset)j (material)c(on)h(general)h(grounds.)k(Also,)13 b(w)o(e)h(ha)o(v)o(e)g (included)g(some)f(extremely)g(deep)0 878 y(wins)h(whic)o(h)g(a)f(computer)h (could)f(surely)i(only)e(solv)o(e)h(with)f(the)i(aid)e(of)g(\\transp)q (osition)h(tables,")f(if)g(then.)62 935 y(W)m(e)g(scanned)h(in)f(essen)o (tially)g(all)f(suitable)h(p)q(ositions)g(from)e([34)o(],)i([35)o(],)f([18)o (],)g([5],)g([33)o(],)g(and)h(the)h(63)f(problems)f(from)f(c)o(hapter)j(3)0 985 y(\(\\practical)g(endgames"\))f(of)g([23)o(].)62 1042 y(W)m(e)d(also)g (created)h(some)f(easy)g(p)q(ositions)g(designed)h(to)f(mak)o(e)f(sure)i(the) g(testee)i(kno)o(ws)d(ab)q(out)g(all)f(the)i(kinds)f(of)f(underpromotion)0 1092 y(and)16 b(certain)i(standard)f(wins)f(and)g(dra)o(ws.)27 b(By)17 b(and)f(large)g(w)o(e)h(ha)o(v)o(e)f(tried)h(to)g(sta)o(y)f(a)o(w)o (a)o(y)g(from)f(p)q(ositions)h(with)g Fi(\024)g Fk(6)h(men)e(on)0 1141 y(the)h(b)q(oard,)e(total,)g(since)i(the)g(next)f(generation)g(of)g(c)o (hess)h(computers)f(ma)o(y)e(b)q(e)j(able)f(to)g(solv)o(e)f(all)g(suc)o(h)i (p)q(ositions)f(with)f(the)i(aid)0 1191 y(of)e(enormous)g(databases.)21 b(Those)15 b(ro)q(oting)f(for)g(computers)h(will)e(b)q(e)i(grati\014ed)g(to)f (kno)o(w)g(that)h(ab)q(out)g(88\045)e(of)h(\\b)q(o)q(ok")g(endgame)0 1241 y(p)q(ositions)19 b(memorized)e(b)o(y)i(grandmasters,)h(i.e.)34 b(those)20 b(in)f([14)o(],)h(are)f(of)g(this)g(\\p)q(oten)o(tially)f (database)i(solv)n(able")e(t)o(yp)q(e.)35 b(The)0 1291 y(p)q(ositions)15 b(w)o(e)h(ha)o(v)o(e)g(scanned)h(in)e(are)h(for)f(the)i(most)d(part)i(not)g (of)f(this)h(t)o(yp)q(e,)g(and)f(are)h(not)g(the)g(sort)h(of)e(things)g(a)h (grandmaster)0 1341 y(w)o(ould)d(in)o(ten)o(tionally)f(memorize;)g(he)i(w)o (ould)f(instead)h(seek)h(to)f(understand)h(the)g(general)f(metho)q(ds)f(and)h (ideas)g(b)q(ehind)g(them.)62 1397 y(The)f(result)g(is)f(a)g(set)h(of)f(ab)q (out)g(300)g(endgame)f(problems)g(of)h(greatly)g(v)n(arying)f(di\016cult)o(y) m(.)16 b(Certainly)c(the)h(hardest)g(ones)g(w)o(ould)0 1447 y(b)q(e)k(di\016cult)e(to)h(solv)o(e)f(o)o(v)o(er)h(the)h(b)q(oard,)f(ev)o (en)h(for)e(a)h(w)o(orld)f(c)o(hampion.)22 b(The)17 b(easiest)g(ones)f(ma)o (y)e(b)q(e)j(solv)o(ed)f(in)f(seconds)j(b)o(y)d(an)0 1497 y(a)o(v)o(erage)f (pla)o(y)o(er.)62 1554 y(W)m(e)k(ha)o(v)o(e)h(also)f(scanned)i(in)e(the)h (1745)f(p)q(ositions)g(from)f([1)o(],)i(v)o(olume)d(3)1245 1539 y Fg(4)1264 1554 y Fk(.)32 b(These)20 b(expanded)f(to)g(1797)e(p)q (ositions,)i(due)g(to)0 1604 y(\\t)o(w)o(o-in-one")12 b(p)q(ositions.)0 1749 y Fj(2.6)43 b(Op)n(enings)0 1838 y Fk(Unfortunately)m(,)18 b(w)o(e)h(are)g(una)o(w)o(are)f(of)g(an)o(y)g(c)o(hess)i(b)q(o)q(ok)e (analogous)f(to)h(\\1001)f(com)o(bination)f(problems")h(but)i(whic)o(h)f (instead)0 1888 y(concerns)e(the)e(righ)o(t)f(mo)o(v)o(es)f(to)i(mak)o(e)e (in)h(c)o(hess)j(op)q(enings.)i(Ov)o(er)c(and)g(o)o(v)o(er)f(one)h(reads)h (in)e(c)o(hessb)q(o)q(oks)i(that)f(w)o(e)g(m)o(ust)f(learn)g(the)0 1938 y(principles)i(of)f(op)q(ening)h(pla)o(y)f(so)h(that)g(w)o(e)g(ma)o(y)e (reason)j(for)e(ourselv)o(es)i(instead)g(of)e(just)h(memorizing)d(b)q(o)q(ok) i(lines)h({)g(but)g(despite)0 1988 y(this,)e(few)h(exercises)j(are)d(a)o(v)n (ailable)d(to)j(help)g(us.)62 2044 y(As)h(a)f(result,)h(w)o(e)f(had)g(to)g (create)i(our)f(o)o(wn)e(op)q(enings)i(test.)20 b(W)m(e)14 b(com)o(bined)f(52)h(p)q(ositions)g(from)e(Alekhine's)j(greatest)g(games)0 2094 y([2)o(],)j(27)f(from)e(Karp)q(o)o(v's)j(games)e([3)o(])h(and)h(some)e (w)o(ell-kno)o(wn)g(p)q(ositions)i(from)d(op)q(enings)j(man)o(uals,)e(in)h (particular)g(Keene)i(and)0 2144 y(Levy's)d([21)o(])g(and)g(Znosk)o(o-Boro)o (vsky's)g([36)o(],)g(for)g(a)g(total)f(of)h(110.)24 b(This)16 b(test)h(should)f(b)q(e)h(tak)o(en)f(with)g(the)h(program's)d(op)q(ening)0 2194 y(b)q(o)q(ok)g(disabled.)62 2251 y(The)j(p)q(ositions)f(from)e(Alekhine) i(and)g(Karp)q(o)o(v)g(games)f(w)o(ere)i(c)o(hosen)g(since)g(\(1\))f (Alekhine/Karp)q(o)o(v,)g(analysing,)f(seemed)h(to)0 2301 y(think)e(there)h (w)o(as)f(a)f(unique)h(b)q(est)h(mo)o(v)o(e)e(and)g(\(2\))h(in)g(the)g (actual)g(game,)e(something)g(else)j(\(i.e.)j(a)c(mistak)o(e\))e(w)o(as)i (usually)f(pla)o(y)o(ed,)0 2350 y(whic)o(h)i(w)o(e)g(regard)g(as)g(evidence)h (that)f(the)h(righ)o(t)e(mo)o(v)o(e)g(w)o(as)g(hard)h(to)g(\014nd.)21 b(\(Some)14 b(more)g(op)q(ening)h(p)q(ositions)f(will)g(b)q(e)h(found)g(in)0 2400 y(our)f(p)q(ositional)e(pla)o(y)h(sets)j(to)q(o.\))62 2457 y(The)g(p)q(ositions)f(from)e(op)q(ening)i(man)o(uals)e(w)o(ere)j(c)o (hosen)h(b)q(ecause)g(getting)e(the)g(righ)o(t)g(answ)o(er,)h(w)o(ould)e (\(for)h(a)g(h)o(uman)f(testee,)0 2507 y(an)o(yw)o(a)o(y\))f(demonstrate)h (understanding)g(of)g(some)f(imp)q(ortan)o(t)f(strategic)i(or)g(tactical)g (fact)g(ab)q(out)f(that)h(op)q(ening.)62 2564 y(This)h(ma)o(y)d(b)q(e)k(a)e (p)q(o)q(or)h(test;)g(it)g(is)f(v)o(ery)h(unclear)g(ho)o(w)f(di\016cult)g(it) h(is,)f(and)g(ho)o(w)h(m)o(uc)o(h)e(v)n(ariabilit)o(y)f(there)k(is)e(in)h (the)g(question)0 2613 y(di\016culties.)i(W)m(e)10 b(tried)h(to)f(b)q(e)h (div)o(erse,)h(pic)o(king)d(p)q(ositions)i(from)d(all)i(sorts)h(of)f(op)q (enings)h(\(although)e(the)i(total)f(size)h(of)f(our)h(op)q(enings)0 2663 y(test)k(is,)e(unfortunately)m(,)g(small\),)e(but)j(w)o(e)h(ha)o(v)o(e)e (no)h(w)o(a)o(y)f(to)h(measure)g(\\div)o(ersit)o(y)m(...")p 0 2728 837 2 v 46 2755 a Fe(4)64 2767 y Fv(W)m(e)e(plan)g(to)g(scan)g(in)g (the)g(other)f(4)i(v)o(olumes)d(of)i(these)g(FIDE)g(Encyclop)q(edia)e(of)i (Chess)g(Endings,)f(if)i(and)f(when)g(w)o(e)h(can)f(obtain)f(them.)17 b(Another)0 2806 y(b)q(o)q(ok)10 b(that)h(w)o(as)h(recommen)o(ded)c(to)j(us,) g(but)g(whic)o(h)g(w)o(e)h(ha)o(v)o(e)e(not)h(scanned,)e(is)j([24)o(].)14 2881 y(Do)q(cNum)891 b Fk(5)873 b Fv(.)16 b(2.)f(7.)g(0)p eop %%Page: 6 6 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)0 -75 y Fj(2.7)43 b(How)14 b(to)h(take)g(and)h(gr)n(ade)e(the)h(test:)k(a)c(suggestion)0 3 y Fk(Supply)g(y)o(our)f(computer)h(with)f(a)h(\014xed)g(amoun)o(t)e(of)i (time)e(in)i(whic)o(h)g(it)f(is)h(to)g(solv)o(e)f(all)g(the)h(problems)f(in)h (an)f(en)o(tire)i(test)g(set.)22 b(It)0 52 y(is)17 b(allo)o(w)o(ed)f(to)h (divide)g(up)g(the)h(time)e(in)g(an)o(y)h(w)o(a)o(y)f(it)h(pleases)h(among)d (the)j(problems.)27 b(\(Ob)o(viously)m(,)17 b(using)f(a)h(simplistic)f(time-) 0 102 y(allo)q(cation)d(strategy)i(is)f(going)f(to)h(cost)i(y)o(ou.\))j (Record)c(ho)o(w)e(man)o(y)g(it)h(got)g(righ)o(t)g(and)g(what)g(w)o(as)h(the) g(total)e(time)g(used.)21 b(A)14 b(more)0 152 y(detailed)h(approac)o(h)g(w)o (ould)f(b)q(e)i(to)f(record)h(whic)o(h)f(answ)o(er)h(it)f(suggested)h(for)f (eac)o(h)g(problem,)f(along)g(with)h(its)g(prediction)g(of)g(the)0 202 y(next)f(few)g(mo)o(v)o(es,)e(and)i(its)g(ev)n(aluation.)j(This)d (information)c(is)k(helpful)f(in)h(debugging)f(the)i(test)g(set.)62 252 y(It)f(is)g(b)q(est)h(to)f(only)f(use)i(test)f(\014les)h(from)d(our)i (collection)f(if)g(y)o(ou)h(ha)o(v)o(e)f(a)h(cop)o(y)g(of)f(the)i(b)q(o)q(ok) e(they)i(w)o(ere)g(extracted)g(from.)549 367 y Fl(3)46 b(The)16 b(optical)g(scanner)g(and)h(rela)m(ted)f(softw)l(are)0 458 y Fj(3.1)43 b(L)n(o)n(c)n(ation)15 b(of)g(chessb)n(o)n(ar)n(ds)g(on)g(the)g (p)n(age)0 536 y Fk(W)m(e)c(scanned)i(in)f(the)g(c)o(hess)h(b)q(o)q(oks)f(at) g(a)f(resolution)h(of)f(300)g(dots)h(p)q(er)h(inc)o(h)f(using)f(a)h (Hewlett-P)o(ac)o(k)n(ard)g(\\Scan)g(Jet)g(Plus")g(scanner.)0 585 y(Although)g(the)i(c)o(hess)h(b)q(o)q(oks)e(w)o(ere)h(theoretically)e (prin)o(ted)i(in)e(pure)i(blac)o(k)f(and)f(white,)h(the)h(optical)e(comp)q (onen)o(ts)h(in)f(the)i(scanner)0 635 y(cause)19 b(apparen)o(t)f(grey)h(lev)o (els)f(b)q(et)o(w)o(een)h(closely)f(spaced)h(blac)o(k)f(marks)e(suc)o(h)j(as) f(the)h(cross)g(hatc)o(hings)f(on)g(dark)f(squares.)32 b(T)m(o)0 685 y(eliminate)14 b(this)h(phenomenon)g(\(as)h(w)o(ell)f(as)g(some)g(prin)o (ting)g(problems)f(suc)o(h)j(as)e(ink)g(drop)q(outs\))h(w)o(e)g(used)h(the)f (scanner)h(in)e(1-bit)0 735 y(p)q(er)i(pixel)f(mo)q(de,)f(with)h(a)g(blac)o (k/white)g(threshold)h(that)f(w)o(as)g(carefully)g(c)o(hosen)h(for)f(eac)o(h) h(b)q(o)q(ok)f(\(or)h(in)e(some)h(cases,)i(for)e(eac)o(h)0 785 y(page\).)62 835 y(The)d(b)q(o)q(oks)g(emplo)o(y)o(ed)e(a)i(v)n(ariet)o (y)f(of)g(page)h(formats,)e(some)h(with)g(c)o(hess)i(b)q(oards)f(and)g(text)g (freely)g(in)o(termixed.)k(T)m(o)12 b(lo)q(cate)h(the)0 885 y(c)o(hessb)q(oards,)f(w)o(e)e(computed)f(the)h(complete)f(con)o(v)o(olution) f(of)h(eac)o(h)h(page)g(image)d(with)j(the)g(image)e(of)h(an)g(empt)o(y)f(c)o (hessb)q(oard.)1974 870 y Fg(5)2011 885 y Fk(This)0 934 y(w)o(ould)14 b(b)q(e)i(prohibitiv)o(ely)e(exp)q(ensiv)o(e)j(using)e(the)g(naiv)o(e)g(con)o (v)o(olution)f(algorithm,)f(but)i(is)g(feasible)g(using)g(the)h(FFT)f(con)o (v)o(olution)0 984 y(metho)q(d.)62 1035 y(Putativ)o(e)f(c)o(hessb)q(oard)i (lo)q(cations)d(w)o(ere)i(then)f(found)g(b)o(y)f(the)i(follo)o(wing)c(metho)q (d:)51 1119 y(1.)20 b(Initialize)13 b(a)g(2D)g(arra)o(y)h(with)g(the)g (output)g(of)f(the)i(con)o(v)o(olution)e(men)o(tioned)f(ab)q(o)o(v)o(e.)51 1203 y(2.)20 b(Prop)q(ose)15 b(a)e(c)o(hessb)q(oard)j(at)d(the)i(lo)q(cation) e(of)g(the)i(largest)f(v)n(alue)f(in)g(the)i(arra)o(y)m(.)51 1288 y(3.)20 b(There)c(will)d(b)q(e)i(man)o(y)e(false)i(side)g(p)q(eaks)g (asso)q(ciated)h(with)e(this)h(p)q(eak)g(b)q(ecause)i(a)d(c)o(hessb)q(oard)j (that)d(has)h(b)q(een)h(shifted)f(b)o(y)104 1338 y(t)o(w)o(o)c(squares)i (still)e(matc)o(hes)h(itself)g(prett)o(y)g(w)o(ell.)17 b(Ho)o(w)o(ev)o(er,)12 b(no)g(other)h(c)o(hessb)q(oard)g(w)o(ould)e(ha)o(v)o(e)h(b)q(een)h(prin)o (ted)f(o)o(v)o(erlapping)104 1388 y(the)k(\014rst)g(one.)22 b(Th)o(us,)15 b(w)o(e)h(can)f(zero)h(out)f(all)f(v)n(alues)h(in)g(the)h(arra) o(y)f(that)g(lie)g(within)f(one)i(c)o(hessb)q(oard)g(width)f(of)g(the)h(p)q (eak)104 1437 y(iden)o(ti\014ed)e(in)f(step)i(2.)51 1522 y(4.)20 b(If)15 b(the)h(whole)f(arra)o(y)g(has)h(b)q(een)g(zero)q(ed)h(out,)e(stop.) 23 b(Otherwise,)17 b(go)e(bac)o(k)g(to)g(step)i(2)e(and)g(prop)q(ose)h(a)f(c) o(hessb)q(oard)i(at)f(the)104 1572 y(lo)q(cation)d(of)g(the)i(largest)f (remaining)d(v)n(alue)j(in)f(the)i(arra)o(y)m(.)0 1656 y(The)h(output)f(of)f (this)h(algorithm)e(is)i(a)g(sequence)i(of)d(c)o(hessb)q(oard)j(candidates,)e (listed)h(in)e(decreasing)i(order)g(of)f(qualit)o(y)m(.)20 b(Using)14 b(a)0 1706 y(graphical)f(in)o(terface)h(and)f(a)h(mouse)e(it)h(is) h(easy)g(to)f(examine)g(these)i(candidates)f(visually)e(and)h(discard)h(the)g (bad)g(ones)g(at)f(the)i(end)0 1756 y(of)e(eac)o(h)i(list.)62 1806 y(Once)20 b(eac)o(h)f(c)o(hessb)q(oard)h(had)e(b)q(een)h(lo)q(cated)g (and)f(its)h(image)d(had)i(b)q(een)i(extracted)g(from)c(the)j(page,)g(w)o(e)g (generated)h(sev-)0 1856 y(eral)d(rotated)g(v)o(ersions)g(of)f(the)h(image) 624 1841 y Fg(6)658 1856 y Fk(and)f(selected)j(the)e(v)o(ersion)g(whic)o(h)f (most)g(closely)g(matc)o(hed)g(our)h(idealized)g(image)d(of)i(a)0 1905 y(c)o(hessb)q(oard.)62 1956 y(F)m(rom)d(eac)o(h)i(c)o(hessb)q(oard)i (image)12 b(w)o(e)j(then)h(extracted)g(64)e(subimages)g(corresp)q(onding)h (to)g(its)f(squares.)22 b(Eac)o(h)15 b(subimage)e(w)o(as)0 2005 y(do)o(wnsampled)k(\(using)i(the)g(appropriate)f(\014ltering\))h(to)f (yield)g(a)h(standardized)g(14)f(b)o(y)h(14)f(pixel)g(image)f(of)h(a)g (square.)33 b(These)0 2055 y(do)o(wnsized)14 b(images)d(\(whic)o(h)i(con)o (tained)g(grey)h(v)n(alues)e(since)i(eac)o(h)g(pixel)e(represen)o(ted)k(man)o (y)c(pixels)g(in)h(the)h(original)d(image\))g(w)o(ere)0 2105 y(the)j(input)g(for)g(the)g(piece)h(recognition)f(system)f(describ)q(ed)j(in) d(the)i(next)f(section.)62 2155 y(This)g(con)o(v)o(olution)f(and)g(rotation)h (metho)q(d)f(w)o(ork)o(ed)h(b)q(etter)h(than)f(sev)o(eral)g(simpler)f(image)f (segmen)o(tation)h(metho)q(ds)g(that)h(w)o(e)0 2205 y(had)g(previously)f (tried,)h(but)g(it)g(w)o(as)g(so)g(slo)o(w)f(it)g(had)h(to)g(b)q(e)g(p)q (erformed)g(\\o\013)f(line")h(in)f(a)h(big)f(batc)o(h)h(job.)0 2315 y Fj(3.2)43 b(Pie)n(c)n(e)14 b(r)n(e)n(c)n(o)n(gnition)0 2392 y Fk(The)h(task)g(of)f(the)h(piece)h(recognition)e(system)h(is)f(to)h (lo)q(ok)e(at)i(the)g(image)e(of)h(a)g(square)i(and)e(decide)i(whic)o(h)e(of) g(13)h(di\013eren)o(t)g(kinds)0 2442 y(of)e(square)i(it)e(is:)18 b(an)c(empt)o(y)f(square,)h(or)g(a)f(square)i(con)o(taining)e(one)h(of)f(6)h (kinds)g(of)f(men)g(of)g(2)h(colors.)62 2493 y(Because)19 b(c)o(hess)f(b)q(o) q(oks)f(emplo)o(y)e(sligh)o(tly)g(di\013eren)o(t)j(fon)o(ts)f(and)f(are)h (prin)o(ted)g(on)g(di\013eren)o(t)h(prin)o(ting)e(presses,)j(the)e (classi\014er)0 2542 y(needs)e(to)e(b)q(e)h(retrained)g(on)f(eac)o(h)h(new)f (b)q(o)q(ok.)18 b(T)m(emplate)12 b(matc)o(hing)f(w)o(orks)j(quite)f(decen)o (tly)h(on)f(ligh)o(t)f(squares,)i(but)g(can)f(pro)o(vide)0 2592 y(terrible)g(p)q(erformance)f(for)f(men)h(on)f(dark)h(squares)i(where)f (the)f(dark)g(squares)i(are)e(halftones)g(or)g(hashmarks.)17 b(Therefore)c(w)o(e)f(used)0 2642 y(a)k(trainable)g(\\neural)f(net)o(w)o (ork")i(to)f(classify)f(the)i(images.)23 b(Our)17 b(stategy)g(w)o(as)f(to)g (train)f(a)h(net)o(w)o(ork)h(on)f(images)e(from)h(the)h(\014rst)0 2692 y(few)e(pages)h(of)e(a)h(b)q(o)q(ok)g(and)g(then)h(use)g(the)g (resulting)f(system)g(to)g(pro)q(cess)i(the)f(rest)h(of)d(the)i(b)q(o)q(ok.)k (Because)d(w)o(e)e(needed)i(to)e(learn)p 0 2728 837 2 v 46 2755 a Fe(5)64 2767 y Fv(The)d(latter)f(m)o(ust)h(b)q(e)g(constructed)d(anew) j(for)g(eac)o(h)f(c)o(hessb)q(o)q(ok,)f(but)i(this)g(is)g(easy)g(to)g(do)g (using)f(image)g(editing)g(to)q(ols.)46 2794 y Fe(6)64 2806 y Fv(the)g(rotation)g(angles)g(co)o(v)o(ered)f(a)i(range)g(of)g(ab)q(out)f(2) h(degrees)14 2881 y(Do)q(cNum)891 b Fk(6)873 b Fv(.)16 b(3.)f(2.)g(0)p eop %%Page: 7 7 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)0 -75 y Fk(an)j(e\013ectiv) o(e)h(classi\014cation)f(rule)g(from)e(a)h(small)f(n)o(um)o(b)q(er)h(of)g (training)g(examples,)g(w)o(e)h(w)o(ere)h(comp)q(elled)e(to)h(use)g(a)g(net)o (w)o(ork)g(that)0 -25 y(had)d(a)h(corresp)q(ondingly)g(small)d(n)o(um)o(b)q (er)i(of)g(free)i(parameters.)1007 -40 y Fg(7)1043 -25 y Fk(Th)o(us)f(w)o(e)g (emplo)o(y)o(ed)e(simple)g(h)o(yp)q(erplanes)j(\(or)e(\\p)q(erceptrons"\),)0 25 y(rather)g(than)g(m)o(ulti-la)n(y)o(er)d(neural)i(net)o(w)o(orks)h(that)g (w)o(ould)e(ha)o(v)o(e)h(ha)o(v)o(e)h(had)f(more)f(degrees)j(of)e(freedom,)g (and)g(w)o(e)g(radically)f(reduced)0 75 y(the)16 b(dimensionalit)o(y)d(of)j (our)f(input)h(patterns)h(b)o(y)f(do)o(wnsampling)d(them)i(to)g(a)h(14)f(b)o (y)h(14)f(pixel)g(format,)f(whic)o(h)i(w)o(as)g(ab)q(out)f(the)0 125 y(smallest)e(input)g(format)f(in)i(whic)o(h)g(the)g(pieces)h(w)o(ere)g (still)e(easily)g(recognizable.)62 175 y(Our)18 b(classi\014cation)f(system)h (con)o(tained)f(13)g(p)q(erceptrons,)j(eac)o(h)e(of)f(whic)o(h)g(computed)g (a)g(h)o(yp)q(erplane)h(that)g(separated)h(the)0 225 y(images)c(\(considered) k(as)d(p)q(oin)o(ts)h(in)f(a)h(196-dimensional)c(space\))18 b(of)f(a)f(particular)h(kind)f(of)g(square)i(from)d(the)i(images)e(of)h(ev)o (ery)0 275 y(other)h(kind)g(of)f(square.)386 260 y Fg(8)432 275 y Fk(After)h(eac)o(h)g(p)q(erceptron)i(had)d(b)q(een)i(trained)f(using)g (the)g(standard)g(p)q(erceptron)i(learning)d(algorithm)0 325 y([25)o(],)e(its)g(w)o(eigh)o(t)g(v)o(ector)i(w)o(as)e(rescaled)i(to)e(b)q(e) h(of)f(unit)h(length.)20 b(Then,)14 b(to)h(classify)f(a)g(new)h(pattern,)g (the)g(system)f(computed)g(the)0 374 y(dot)g(pro)q(duct)g(of)f(the)i(pattern) f(with)f(the)i(w)o(eigh)o(t)e(v)o(ector)i(of)e(ev)o(ery)h(class)g(and)g (assigned)g(the)g(pattern)h(to)e(the)h(class)h(for)e(whic)o(h)h(the)0 424 y(dot)g(pro)q(duct)h(w)o(as)e(largest.)62 475 y(The)h(error)f(rate)h(of)e (this)h(metho)q(d)f(w)o(as)h(around)g(1)f(p)q(ercen)o(t.)20 b(Later)13 b(exp)q(erimen)o(ts)g(sho)o(w)o(ed)h(that)f(m)o(ulti-la)n(y)o(er)e (neural)i(net)o(w)o(orks)0 525 y(could)g(ha)o(v)o(e)f(cut)i(the)g(error)f (rate)h(in)e(half,)g(but)h(these)h(net)o(w)o(orks)g(w)o(ould)e(ha)o(v)o(e)h (required)h(more)e(training)g(data,)g(and)h(a)f(system)h(that)0 574 y(needs)i(to)f(b)q(e)g(trained)h(on)e(a)h(whole)f(b)q(o)q(ok)h(is)g(of)f (little)g(use)i(in)e(pro)q(cessing)i(that)f(b)q(o)q(ok.)62 625 y(The)k(most)d(imp)q(ortan)o(t)g(comp)q(onen)o(t)h(of)h(our)f(system)h(w) o(as)g(a)f(graphical)g(in)o(terface)i(that)e(to)q(ok)h(batc)o(hes)h(of)e(sev) o(eral)h(h)o(undred)0 675 y(squares,)f(classi\014ed)g(them)f(using)g(the)h (automated)e(metho)q(d)g(describ)q(ed)j(ab)q(o)o(v)o(e,)e(and)g(then)h (displa)o(y)o(ed)f(them)g(in)g(ro)o(ws)g(according)0 725 y(to)h(their)h (putativ)o(e)f(lab)q(el.)25 b(Since)17 b(all)e(of)h(the)h(examples)e(of)h (eac)o(h)h(class)f(\()p Fj(e.g.)26 b Fk(all)15 b(the)i(kings,)f(all)f(the)i (knigh)o(ts\))f(w)o(ere)i(displa)o(y)o(ed)0 774 y(side)13 b(b)o(y)f(side,)g (and)h(since)g(most)e(of)h(the)h(examples)e(had)h(in)g(fact)h(b)q(een)g(lab)q (eled)g(correctly)m(,)f(erroneously)i(lab)q(eled)e(images)f(tended)i(to)0 824 y(\\p)q(op)h(out")f(visually)f(and)i(could)g(b)q(e)g(immediately)c (corrected)17 b(b)o(y)c(the)i(h)o(uman)d(op)q(erator)i(of)f(the)i(program)d (using)h(the)i(terminal's)0 874 y(mouse.)20 b(W)m(e)14 b(b)q(eliev)o(e)h (that)g(a)g(high)f(lev)o(el)g(of)g(accuracy)i(w)o(as)f(obtained)f(b)o(y)h (our)g(system)f(b)q(ecause)j(w)o(e)e(didn't)f(require)h(the)h(h)o(uman)0 924 y(sup)q(ervisor)h(to)e(activ)o(ely)g(think)g(ab)q(out)h(categories)g(and) f(lab)q(els,)h(but)f(instead)h(relied)g(on)f(a)h(hard-wired)f(visual)g (abilit)o(y)f(to)h(judge)0 974 y(the)f(similarit)o(y)d(of)j(adjacen)o(t)g(ob) r(jects.)0 1085 y Fj(3.3)43 b(A)o(nswers)14 b(and)h(\014nal)h(che)n(ck)0 1163 y Fk(The)i(answ)o(ers)g(at)f(the)h(bac)o(k)f(of)f(the)i(b)q(o)q(ok)f(w)o (ere)h(t)o(yp)q(ed)g(in)e(b)o(y)h(h)o(umans,)f(\014rst)i(mo)o(v)o(e)e(in)g (the)i(answ)o(er)g(only)m(.)27 b(These)18 b(w)o(ere)g(later)0 1213 y(con)o(v)o(erted)11 b(to)f(long)f(form)g(double)h(algebraic)f(notation) g(\(from)g(a)h(large)g(v)n(ariet)o(y)f(of)h(original)e(mo)o(v)o (e-notations\))g(using)i(an)f(automated)0 1263 y(parsing)15 b(program.)k(Suc)o(h)c(a)f(parser)i(can)f(b)q(e)h(devised)f(b)o(y)g (generating)g(all)f(legal)f(mo)o(v)o(es)h(in)g(that)h(p)q(osition)f(in)h(a)f (large)h(n)o(um)o(b)q(er)f(of)0 1313 y(notations,)h(then)h(seeing)g(whic)o (h,)f(if)f(an)o(y)m(,)h(of)f(these)j(\(t)o(ypically)d(1000\))h(strings)g (matc)o(h)f(the)i(input)f(string.)23 b(Rare)15 b(cases)i(where)f(no)0 1363 y(matc)o(h)e(o)q(ccurred)j(\(illegal)d(mo)o(v)o(e\),)g(or)h(where)i (more)d(than)h(one)h(o)q(ccurred)h(\(am)o(biguous)c(notation\),)i(w)o(ere)h (refereed)i(b)o(y)d(a)g(h)o(uman)0 1413 y(sup)q(ervisor.)k(During)13 b(this)h(notation-con)o(v)o(ersion)g(pro)q(cess,)h(w)o(e)f(p)q(erformed)f (the)i(automated)d(c)o(hec)o(ks)k(describ)q(ed)f(in)f Fi(x)p Fk(2.2.)0 1524 y Fj(3.4)43 b(Plagiarism)0 1602 y Fk(This)16 b(en)o(tire)i(e\013ort)f(w)o(as,)f(of)g(course,)i(essen)o(tially)f(automated) e(plagiarism.)23 b(Of)16 b(course,)i(w)o(e)f(ha)o(v)o(e)f(cited)h(our)g (sources.)27 b(And)17 b(of)0 1652 y(course,)12 b(almost)d(all)h(of)g(the)i(p) q(ositions)f(in)f(the)i(sources)g(w)o(ere)g(themselv)o(es)f(tak)o(en)g(from)e (grandmaster)i(games)f(or)h(published)g(studies,)0 1702 y(and)j(w)o(ere)h (not)e(due)i(to)e(the)i(authors)f(of)f(that)h(b)q(o)q(ok.)62 1753 y(W)m(e)d(w)o(ere)g(somewhat)f(discouraged)h(to)g(\014nd,)g(ho)o(w)o(ev) o(er,)g(that)g(w)o(e)g(w)o(ere)h(not)e(the)i(\014rst)f(plagiarizers!)17 b(Man)o(y)10 b(c)o(hessb)q(o)q(oks)j(con)o(tain)0 1802 y(the)h(same)f (diagrams)f(as)h(will)f(b)q(e)j(found)e(in)g(other)h(c)o(hessb)q(o)q(oks,)h (usually)e(with)g(no)g(attribution,)g(leading)g(to)g(ab)q(out)h(423)e(rep)q (eated)0 1852 y(p)q(ositions)h(\(corresp)q(onding)h(to)f(203)g(unique)g(p)q (ositions\))g(in)g(our)g(test)h(suite.)19 b(It)13 b(is)g(unclear)h(ho)o(w)f (man)o(y)e(of)i(these)h(w)o(ere)g(in)o(ten)o(tional)0 1902 y(plagiarism)c(and)j(ho)o(w)g(man)o(y)e(w)o(ere)j(coincidences.)19 b(Reinfeld)13 b(seems)g(to)g(ha)o(v)o(e)g(b)q(een)h(the)g(most)d(p)q(opular)i (b)q(o)q(ok)g(to)g(plagiarize)f(from)0 1952 y({)i(in)f(some)g(cases)i(he)g (ev)o(en)f(plagiarized)f(himself)f(in)i(later)g(b)q(o)q(oks.)62 2002 y(Examining)g(these)19 b(203)d(p)q(ositions,)g(w)o(e)h(found)g(that)f (in)h(4)f(of)g(them)g(the)i(answ)o(ers)f(di\013ered!)28 b(Of)17 b(these)h(4)e(disagreemen)o(ts,)h(2)0 2052 y(w)o(ere)f(due)f(to)f(kno)o(wn)h (\(and)f(not)h(v)o(ery)g(in)o(teresting\))g(co)q(oks)g(in)g(problems)e(from)g ([31)o(],)h(but)h(2)g(of)f(them)g(w)o(ere)h(serious,)h(and)e(turned)0 2102 y(out)g(to)g(ha)o(v)o(e)g(b)q(een)h(due)g(to)f(t)o(yping)f(errors)j(w)o (e)e(made)f(\(when)i(t)o(yping)e(in)h(the)h(answ)o(ers)g(from)d(the)j(b)q(o)q (ok\))f(that)g(passed)h(our)g(sanit)o(y)0 2152 y(tests.)21 b(W)m(e)14 b(ha)o(v)o(e)h(no)o(w)f(corrected)i(these)g(errors,)g(but)e(an)o (yw)o(a)o(y)g(this)g(giv)o(es)h(y)o(ou)f(some)f(idea)h(of)g(the)h(frequency)h (of)e(wrong)g(answ)o(ers)0 2202 y(in)f(our)h(test)h(set)g({)f(at)f(least)i (1\045.)62 2252 y(Since)j(our)f(format)e(is)i(one)h(p)q(osition)e(p)q(er)i (line,)f(an)o(yb)q(o)q(dy)g(who)g(wishes)h(to)f(eliminate)e(these)j(rep)q (eats)h(can)f(easily)e(do)h(so)g(b)o(y)0 2302 y(use)h(of)f(the)h(UNIX)f(to)q (ol)g(\\)p Ff(sort)j(-u)p Fk(.")28 b(W)m(e)17 b(pro)o(vide)g(a)g(\014le)g (called)g(\\plagiarism")d(con)o(taining)i(the)i(rep)q(eats,)h(but)f(w)o(e)f (ha)o(v)o(e)g(not)0 2352 y(eliminated)12 b(them.)660 2468 y Fl(4)45 b(Experience)17 b(with)d(the)i(test,)f(so)i(f)l(ar)0 2561 y Fk(W)m(e)e(ha)o(v)o(e)g(giv)o(en)g(the)h(test)h(to)e(the)h (public-domain)d(c)o(hess)k(progam)d Ff(gnuchess-4.0)19 b(pl62)p Fk(,)c(authored)g(b)o(y)h(Stuart)g(Cracraft)f(and)0 2610 y(others,)f(and)g (obtainable)f(b)o(y)h(anon)o(ymous)e Ff(FTP)h Fk(from)f Ff(prep.ai.mit.edu)p Fk(.)p 0 2649 837 2 v 46 2676 a Fe(7)64 2688 y Fv(Learning)c(theorists)g(ha)o (v)o(e)h(sho)o(wn)h(that)f(the)g(p)q(erformance)e(of)j(a)g(neural)e(net)o(w)o (ork)h(can)h(b)q(e)f(exp)q(ected)f(to)i(increase)e(as)i(the)g(ratio)f(of)h (training)e(patterns)0 2727 y(to)j(free)g(parameters)d(increases)i([6)o(].)46 2755 y Fe(8)64 2767 y Fv(T)m(o)f(mak)o(e)f(the)g(classi\014cation)e(task)i (easier,)g(w)o(e)h(actually)e(handled)g(the)h(dark)g(squares)f(and)i(the)f (ligh)o(t)g(squares)f(of)i(a)g(c)o(hessb)q(oard)d(using)i(t)o(w)o(o)h (separately)0 2806 y(trained)h(recognition)e(systems.)14 2881 y(Do)q(cNum)891 b Fk(7)873 b Fv(.)16 b(4.)f(0.)g(0)p eop %%Page: 8 8 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)62 -75 y Fk(Gn)o(uc)o(hess-4.0,)h(running)f(on)h(a)f(Sun)h(SP)m(AR)o(C)f(10,)g(has)h (pla)o(y)o(ed)f(o)o(v)o(er)h(7500)e(games)h(on)g(the)i(in)o(ternet)f(c)o (hess)h(serv)o(er,)g(ac)o(hieving)e(a)0 -25 y(rating)g(of)g(2261)g(at)h (\\blitz")e(c)o(hess)k(and)d(2032)g(at)g(\\standard")h(c)o(hess.)19 b(W)m(e)13 b(ran)f(it)h(on)f(Silicon)g(Graphics)g(IRIS)h(indigos)e(with)i (MIPS)0 25 y(R4000)h(50MHz)h(IP20)g(pro)q(cessors)i(and)e(o)o(v)o(er)g(30)g (megab)o(ytes)f(of)h(RAM,)f(and)h(allo)q(cated)g(1)g(min)o(ute)f(of)g(CPU)i (time)e(for)g(eac)o(h)i(test)0 75 y(question.)i(W)m(e)c(did)f Fj(not)i Fk(turn)f(o\013)g(gn)o(uc)o(hess's)h(op)q(ening)f(b)q(o)q(ok.)j(Due) d(to)g(bugs,)g(o)q(ccasionally)f(gn)o(uc)o(hess)i(w)o(ould)e(hang)g(and)h (simply)0 125 y(nev)o(er)j(answ)o(er)g(the)g(question,)g(in)e(whic)o(h)i (case)g(w)o(e)f(simply)e(killed)i(it)g(and)g(mark)o(ed)f(that)h(question)h (as)f(WR)o(ONG)1841 109 y Fg(9)1859 125 y Fk(.)f(The)i(results)0 174 y(follo)o(w.)p 62 180 2008 2 v 61 230 2 50 v 87 215 a(T)m(est)d(File)g (Name)p 390 230 V 49 w(#)f(RIGHT)49 b(#)14 b(WR)o(ONG)48 b(\(#)14 b(HUNG\))p 1150 230 V 50 w(TOT)m(AL)p 1346 230 V 50 w(\045)f(RIGHT)p 1583 230 V 49 w(Commen)o(t)p 2069 230 V 62 232 2008 2 v 61 281 2 50 v 87 267 a(b)q(ellin.\014n)p 390 281 V 337 w(6)224 b(27)235 b(1)p 1150 281 V 154 w(33)p 1346 281 V 50 w(18)p 1583 281 V 195 w(Hard)14 b(p)q(ositional)p 2069 281 V 61 331 V 87 316 a(ece3.\014n)p 390 331 V 321 w(803)203 b(994)215 b(27)p 1150 331 V 112 w(1797)p 1346 331 V 49 w(45)p 1583 331 V 195 w(R,N,B)13 b(endings)p 2069 331 V 61 381 V 87 366 a(\014necom)o(b.\014n)p 390 381 V 277 w(8)224 b(42)235 b(0)p 1150 381 V 154 w(50)p 1346 381 V 50 w(16)p 1583 381 V 195 w(V)m(ery)14 b(hard)g(com)o(binations)p 2069 381 V 61 431 V 87 416 a(gelfer.\014n)p 390 431 V 319 w(84)203 b(243)235 b(2)p 1150 431 V 134 w(327)p 1346 431 V 49 w(26)p 1583 431 V 195 w(Medium)13 b(hard)h(p)q(ositional)p 2069 431 V 61 481 V 87 466 a(hardmid.\014n)p 390 481 V 242 w(279)203 b(600)215 b(13)p 1150 481 V 133 w(879)p 1346 481 V 49 w(32)p 1583 481 V 195 w(T)m(ough)13 b(com)o(binations)p 2069 481 V 61 531 V 87 516 a(jenoban.\014n)p 390 531 V 254 w(108)224 b(94)235 b(3)p 1150 531 V 134 w(202)p 1346 531 V 49 w(53)p 1583 531 V 195 w(T)m(actical)13 b(endings)p 2069 531 V 61 580 V 87 565 a(k)o(cmdm.\014n)p 390 580 V 283 w(71)224 b(74)235 b(1)p 1150 580 V 134 w(145)p 1346 580 V 49 w(49)p 1583 580 V 195 w(Separable)14 b(mixture)p 2069 580 V 61 630 V 87 615 a(k)o(oto)o(v.\014n)p 390 630 V 317 w(41)224 b(74)235 b(1)p 1150 630 V 134 w(115)p 1346 630 V 49 w(36)p 1583 630 V 195 w(Mixture)p 2069 630 V 61 680 V 87 665 a(larsen1.\014n)p 390 680 V 290 w(68)224 b(32)235 b(4)p 1150 680 V 134 w(100)p 1346 680 V 49 w(68)p 1583 680 V 195 w(Find)14 b(the)g(com)o(bination)p 2069 680 V 61 730 V 87 715 a(larsen2.\014n)p 390 730 V 290 w(15)224 b(33)235 b(1)p 1150 730 V 154 w(48)p 1346 730 V 50 w(31)p 1583 730 V 195 w(Find)14 b(the)g(plan)p 2069 730 V 61 780 V 87 765 a(larsen3.\014n)p 390 780 V 290 w(27)224 b(36)235 b(3)p 1150 780 V 154 w(63)p 1346 780 V 50 w(43)p 1583 780 V 195 w(Practical)14 b(endings)p 2069 780 V 61 829 V 87 814 a(op)q(enings.\014n)p 390 829 V 259 w(31)224 b(79)235 b(1)p 1150 829 V 134 w(110)p 1346 829 V 49 w(28)p 1583 829 V 195 w(op)q(enings)14 b(understanding)p 2069 829 V 61 879 V 87 864 a(p)q(ositional.\014n)p 390 879 V 239 w(54)203 b(100)235 b(1)p 1150 879 V 134 w(154)p 1346 879 V 49 w(35)p 1583 879 V 195 w(P)o(ositional)13 b(mixture)p 2069 879 V 61 929 V 87 914 a(reinfeld.\014n)p 390 929 V 261 w(670)203 b(331)215 b(20)p 1150 929 V 112 w(1001)p 1346 929 V 49 w(67)p 1583 929 V 195 w(1001)13 b(com)o(binations)p 2069 929 V 61 979 V 87 964 a(sherev.\014n)p 390 979 V 304 w(15)224 b(45)235 b(0)p 1150 979 V 154 w(60)p 1346 979 V 50 w(25)p 1583 979 V 195 w(endgame)13 b(strategy)p 2069 979 V 61 1029 V 87 1014 a(sp)q(eelman.\014n)p 390 1029 V 249 w(63)203 b(104)235 b(3)p 1150 1029 V 134 w(167)p 1346 1029 V 49 w(38)p 1583 1029 V 195 w(endgames)p 2069 1029 V 61 1078 V 87 1064 a(winatc)o(hess.\014n)p 390 1078 V 204 w(212)224 b(88)235 b(4)p 1150 1078 V 134 w(300)p 1346 1078 V 49 w(71)p 1583 1078 V 195 w(300)13 b(com)o(binations)p 2069 1078 V 62 1080 2008 2 v 61 1130 2 50 v 87 1115 a(com)o(bined)p 390 1130 V 260 w(2555)183 b(2996)214 b(85)p 1150 1130 V 112 w(5551)p 1346 1130 V 49 w(46)p 1583 1130 V 62 1132 2008 2 v 2826 665 a Fa(Gn)o(uc)o(hess)13 b(\(1)i(min)o(ute\))e(results.)62 1165 y Fk(W)m(e)k(also)f(tried)h(running)g(gn)o(uc)o(hess)h(at)e(15)g(min)o (utes)g(p)q(er)i(problem)d(on)i(selected)i(test)e(\014les.)28 b(Not)16 b(suprisingly)m(,)g(it)h(got)f(more)0 1214 y(righ)o(t)d(answ)o (ers...)k(except)e(in)d(the)i(case)g(of)e(the)i(test\014le)g Ff(larsen2.fin)d Fk(where)j(it)f(got)f(one)i(few)o(er.)k(W)m(e)13 b(ascrib)q(e)h(that)f(to)g(it)f(hanging)0 1264 y(3)i(times)f(instead)h(of)f (1.)p 62 1270 2006 2 v 61 1320 2 50 v 87 1305 a(T)m(est)h(File)g(Name)p 390 1320 V 49 w(#)f(RIGHT)49 b(#)14 b(WR)o(ONG)48 b(\(#)14 b(HUNG\))p 1150 1320 V 50 w(TOT)m(AL)p 1346 1320 V 50 w(\045)f(RIGHT)p 1583 1320 V 49 w(Commen)o(t)p 2067 1320 V 62 1321 2006 2 v 61 1371 2 50 v 87 1356 a(b)q(ellin.\014n)p 390 1371 V 337 w(8)224 b(25)235 b(1)p 1150 1371 V 154 w(33)p 1346 1371 V 50 w(24)p 1583 1371 V 195 w(Hard)14 b(p)q(ositional)p 2067 1371 V 61 1421 V 87 1406 a(\014necom)o(b.\014n)p 390 1421 V 256 w(14)224 b(36)235 b(1)p 1150 1421 V 154 w(50)p 1346 1421 V 50 w(28)p 1583 1421 V 195 w(V)m(ery)14 b(hard)g(com)o(binations)p 2067 1421 V 61 1471 V 87 1456 a(larsen2.\014n)p 390 1471 V 290 w(14)224 b(34)235 b(3)p 1150 1471 V 154 w(48)p 1346 1471 V 50 w(29)p 1583 1471 V 195 w(Find)14 b(the)g(plan)p 2067 1471 V 61 1521 V 87 1506 a(larsen3.\014n)p 390 1521 V 290 w(31)224 b(32)235 b(4)p 1150 1521 V 154 w(63)p 1346 1521 V 50 w(49)p 1583 1521 V 195 w(Practical)14 b(endings)p 2067 1521 V 62 1522 2006 2 v 2811 1406 a Fa(Gn)o(uc)o(hess)g(\(15)h(min)o(ute\))d(results.)62 1555 y Fk(Our)k(c)o(hess)h(test)g(ma)o(y)c(b)q(e)j(able)f(to)g(shed)i(some)d (ligh)o(t)g(on)i(the)g(debate)g(concerning)g(ho)o(w)f(m)o(uc)o(h)f(more)h(sp) q(eed)i(is)e(necessary)i(to)0 1605 y(mak)o(e)f(a)h(computer)g(program)e(b)q (ecome)i(w)o(orld)g(c)o(hess)i(c)o(hampion.)26 b(Exp)q(erimen)o(ts)17 b(b)o(y)g(Condon)g(and)g(Thompson)e(with)i(BELLE)0 1655 y(running)11 b(at)g(di\013eren)o(t)i(sp)q(eeds)g([10)o(])e(had)g(sho)o(wn)h(that)f(eac)o (h)h(doubling)e(of)h(mac)o(hine)f(sp)q(eed)j(w)o(ould)e(t)o(ypically)f(yield) h(b)q(et)o(w)o(een)h(40)f(and)0 1705 y(100)f(extra)h(USCF)g(rating)f(p)q(oin) o(ts)h(in)f(the)i(rating)e(range)h(\(ratings:)16 b(1350-2520;)9 b(ply)i(deep:)17 b(4-11\))10 b(studied.)18 b(\(Stronger)11 b(pla)o(y)o(ers)g(gain)0 1755 y(less)j(rating)f(p)q(oin)o(ts)h(from)e(a)h(sp) q(eed)i(doubling.)i(The)d(40-p)q(oin)o(t)e(claims)g(at)i(plies)f(10)g(and)h (11)f(are)h(extrap)q(olations)f(b)o(y)g(M.)g(Newb)q(orn)0 1804 y([26)o(])g(based)h(on)f(observ)o(ed)h(mo)o(v)o(e)e(c)o(hange)i(frequencies)h (in)e(Belle's)g(tree)i(searc)o(h.\))k(Hans)13 b(Berliner)i(has)e(sp)q (eculated)i(that)e(the)h(brute)0 1854 y(force)f(approac)o(h)f(of)g(simply)e (increasing)i(mac)o(hine)f(sp)q(eed,)j(migh)o(t)c(run)i(in)o(to)g(a)g (roadblo)q(c)o(k.)17 b(Sp)q(eci\014cally)m(,)11 b(he)i(susp)q(ects)i(that)d (merely)0 1904 y(increasing)h(sp)q(eed)i(will)c(increase)j(rating)f(un)o(til) f(the)i(p)q(oin)o(t)e(where)i(the)g(c)o(hess)g(program)e(ac)o(hiev)o(es)h (\\tactical)g(su\016ciency)m(.")18 b(Bey)o(ond)0 1954 y(that)c(p)q(oin)o(t,)f (he)h(b)q(eliev)o(es)h(that)f(strength)h(increases)h(resulting)e(from)e (extra)i(sp)q(eed)i(will)c(b)q(e)j(small,)c(and)j(it)f(is)h(b)q(est)h(not)f (merely)f(to)0 2004 y(increase)i(one's)f(searc)o(h)h(depth,)f(but)g(instead)h (to)e(increase)j(one's)e(\\p)q(ositional)e(kno)o(wledge.")62 2054 y(An)o(yw)o(a)o(y)m(,)g(observ)o(e)i(that)f(a)f(15)p Fi(\002)h Fk(impro)o(v)o(emen)o(t)d(in)i(mac)o(hine)g(sp)q(eed)i(b)q(ough)o(t)f(gn)o (uc)o(hess)h(a)f(75\045)f(score)i(increase)g(on)f(the)g(tactics)0 2103 y(problems)k(in)g Ff(finecomb.fin)e Fk(but)j(only)f(a)g(3.5\045)f(impro) o(v)o(emen)o(t)f(on)j(the)g(p)q(ositional,)f(planning,)g(and)g(endgame)g (problems)g(in)0 2153 y Ff(bellin.fin)p Fk(,)11 b Ff(larsen2.fin)p Fk(,)g(and)j Ff(larsen3.fin)p Fk(.)805 2265 y Fl(5)46 b(A)o(ckno)o (wledgements)0 2356 y Fk(W)m(e)13 b(w)o(ould)f(lik)o(e)g(to)h(thank)g(Hans)g (Berliner)h(for)f(giving)e(us)j(the)f(Hort-Jansa)h(and)f(the)g(Reinfeld)g Fj(Win)h(at)g(Chess)f Fk(sets,)h(and)f(also)f(for)0 2406 y(v)n(arious)h (discussions.)19 b(W)m(e)14 b(w)o(ould)f(also)g(lik)o(e)g(to)h(thank)g(Sue)g (Bredho\013)h(for)f(t)o(yping)f(in)g(c)o(hessmo)o(v)o(es.)925 2518 y Fl(References)21 2609 y Fk([1])19 b(A.)11 b(Adorjan)g(\(GM\))g(et)h (al.)h(Encyclop)q(edia)f(of)f(c)o(hess)i(endings,)h(FIDE,)d(Beograd)h(Y)m (ugosla)o(via,)d(1986)k(ISBN)f(=)g(86-7297-005-5.)21 2692 y([2])19 b(A.)14 b(Alekhine)g(\(Wc)o(h\).)32 b(My)14 b(greatest)h(games)e(of)g(c)o (hess)i(1908-1937,)h(Do)o(v)o(er)e(reprin)o(t,)g(2)f(v)o(ols)h(in)f(1,)g (1985.)p 0 2728 837 2 v 46 2755 a Fe(9)64 2767 y Fv(This)h(bug)f(ma)o(y)g (only)f(app)q(ear)h(when)g(gn)o(uc)o(hess)f(is)i(run)f(on)h(SGI)f(mac)o (hines;)g(Cracraft)f(sp)q(eculates)g(that)h(it)g(ma)o(y)g(ha)o(v)o(e)g(b)q (een)g(\014xed)g(in)g(the)h(latest)0 2806 y(v)o(ersion)c(of)h(gn)o(uc)o (hess.)14 2881 y(Do)q(cNum)891 b Fk(8)885 b Fv(.)12 b(5.)f(0.)g(0)p eop %%Page: 9 9 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)21 -75 y Fk([3])19 b(A.)14 b(Karp)q(o)o(v)g(\(Wc)o(h\).)k(Karp)q(o)o(v's)c(collected)g (games,)j(\(Da)o(vid)c(Levy)m(,)g(ed.\))h(Rob)q(ert)g(Hale)g(and)g(Co.)f (London)g(1975.)21 11 y([4])19 b(T.S.)12 b(Anan)o(tharaman,)f(M.S.)h(Campb)q (ell,)f(F-s)i(Hsu.)k(Singular)12 b(Extensions:)19 b(adding)12 b(selectivit)o(y)h(to)g(brute)h(force)f(searc)o(hing,)85 61 y(Arti\014cial)h(In)o(telligence)g(43,1)e(99-109.)17 b(also)c(in)h(ICCA)f(J)i (11,4)d(\(1988\))h(135-143.)21 147 y([5])19 b(Y.)14 b(Av)o(erbakh)g(\(GM\).)k (Chess)d(endings,)f(essen)o(tial)g(kno)o(wledge,)k(P)o(ergamon)12 b(1987.)17 b(ISBN)e(=)f(0-08-032045-7.)21 233 y([6])19 b(E.B.)e(Baum)e(and)i (D.)f(Haussler.)27 b(\\What)17 b(size)g(net)g(giv)o(es)g(v)n(alid)e (generalization?")37 b(Neural)16 b(Computation,)f(v)o(ol.1,)h(1989,)85 283 y(151-160.)21 368 y([7])j(Rob)q(ert)c(Bellin)e(\(IM\))h(and)g(Pietro)g(P) o(onzetto.)19 b(T)m(est)14 b(y)o(our)g(p)q(ositional)e(pla)o(y)m(,)17 b(Macmillan)11 b(1985.)17 b(ISBN)d(=)g(0-02-028090-4.)21 454 y([8])19 b(Hans)13 b(Berliner)h(\(W)o(CorrCh\),)e(D.)g(Kop)q(ec)i(\(IM\),)f (E.)f(Northam.)j(A)e(taxonom)o(y)d(of)i(concepts)i(for)f(ev)n(aluating)e(c)o (hess)j(strength,)85 504 y(pages)j(179-191)d(in)24 b(Adv)n(ances)17 b(in)f(computer)g(c)o(hess)h(6,)25 b(Ellis)15 b(Horw)o(o)q(o)q(d)h(1991.)23 b(ISBN)16 b(=)h(0-13-006537-4.)k(Also)16 b(in)f(IEEE)85 554 y(Sup)q(ercomputing)f('90,)e(IEEE)j(computer)e(science)j(press)f(No)o(v)o(em) o(b)q(er)e(1990.)21 640 y([9])19 b(D.Kop)q(ec)c(and)f(I.)g(Bratk)o(o.)19 b(A)14 b(comparison)f(of)g(h)o(uman)g(and)h(computer)g(p)q(erformance)g(in)g (c)o(hess,)20 b(page)14 b(57-72)f(in)19 b(Adv)n(ances)85 690 y(in)14 b(Computer)f(Chess)i(I)q(I)q(I,)j(edited)d(b)o(y)e(M.R.B.)g(Clark)o (e,)g(P)o(ergamon)f(1982.)0 776 y([10])19 b(J.H.)d(Condon)f(and)h(K.)f (Thompson.)23 b(BELLE,)i(page)15 b(201-210)g(in)23 b(Chess)18 b(skill)c(in)i(man)e(and)i(mac)o(hine,)23 b(edited)16 b(b)o(y)g(P)o(eter)85 825 y(F)m(rey)m(,)d(Springer)i(1983.)0 911 y([11])k(Max)14 b(Eu)o(w)o(e)g(\(W)o(Ch\).)k(Strategy)c(and)g(tactics)h(in)e(c)o(hess,)20 b(Da)o(vid)12 b(McKa)o(y)i(Co.,)f(New)h(Y)m(ork)g Fi(\031)p Fk(1950.)0 997 y([12])19 b(Reub)q(en)14 b(Fine)f(\(GM\).)k(The)c(w)o(orld's)f (great)h(c)o(hess)i(games,)h(Bonanza)d(Bo)q(oks,)g(Cro)o(wn)g(Publishers,)g (1951.)f(No)o(w)g(a)o(v)n(ailable)f(as)85 1047 y(a)j(Do)o(v)o(er)g(reprin)o (t.)0 1133 y([13])19 b(Israel)g(Gelfer)g(\(Coac)o(h)f(of)g(Israeli)g(nat'l)g (c)o(hess)i(team\):)67 b(P)o(ositional)17 b(Chess)j(Handb)q(o)q(ok,)32 b(Macmillan)16 b(1991.)31 b(ISBN)19 b(=)85 1183 y(0-02-028831-X.)0 1269 y([14])g(Da)o(vid)13 b(Ho)q(op)q(er.)19 b(A)14 b(p)q(o)q(c)o(k)o(et)g (guide)g(to)g(c)o(hess)h(endgames,)i(G.)c(Bell,)h(1970.)j(ISBN)d(=)g (0-7135-1761-1.)0 1355 y([15])19 b(D.)14 b(Kop)q(ec,)i(G.)e(Chandler,)g(C.)g (Morrison,)h(N.)f(Da)o(vies,)g(I.D.)g(Mullen.)20 b(Master)c(c)o(hess,)g(a)e (course)i(in)f(21)f(lessons,)21 b(P)o(ergamon)85 1404 y(Press)16 b(1985)h(ISBN)e(=)f(0-08-029725-0.)0 1490 y([16])19 b(Hans)14 b(Kmo)q(c)o(h)f(\(IM\).)19 b(P)o(a)o(wn)13 b(p)q(o)o(w)o(er)i(in)e(c)o(hess,) 19 b(Do)o(v)o(er)14 b(publications)f(1990.)k(ISBN)e(=)f(0-486-26486-6.)0 1576 y([17])19 b(N.)g(Krogius)g(\(GM\),)f(A.)h(Livsic,)g(B.)g(P)o(arma,)g (and)f(M.)h(T)m(aimano)o(v)d(\(GM\).)33 b(Encyclop)q(edia)19 b(of)g(c)o(hess)h(middlegam)o(es)d(and)85 1626 y(com)o(binations.)f(FIDE,)e (Beograd)g(1980.)0 1712 y([18])19 b(I.A.)13 b(Horo)o(witz)h(\(IM\).)k(Ho)o(w) c(to)g(win)f(in)g(the)i(c)o(hess)g(endings,)k(T)m(artan)13 b(b)q(o)q(oks,)g(Da)o(vid)g(McKa)o(y)h(co.)g(inc.)f(New)i(Y)m(ork)e(1957.)0 1798 y([19])19 b(V.)14 b(Hort)g(\(GM\))g(and)f(V.)h(Jansa.)k(The)c(b)q(est)h (mo)o(v)o(e,)i(RHM)c(press)j(\(apparen)o(tly)e(no)o(w)f(defunct\))i(New)f(Y)m (ork)g(1980.)0 1884 y([20])19 b(Ra)o(ymond)14 b(Keene)j(\(GM\))e(and)h (Andrew)h(Whiteley)m(.)22 b(Ra)o(y)15 b(Keene's)i(go)q(o)q(d)e(mo)o(v)o(e)f (guide,)24 b(Oxford)16 b(Univ)o(ersit)o(y)f(Press)j(1982.)85 1933 y(ISBN)d(=)f(0-19-217582-3.)0 2019 y([21])19 b(Ra)o(ymond)12 b(Keene)j(and)f(D.N.L.)e(Levy)i(\(IM\).)k(Ho)o(w)c(to)g(pla)o(y)f(the)h(op)q (ening)g(in)f(c)o(hess,)20 b(B.T.)13 b(Batsford)h(Ltd.,)f(2nd)h(ed)g(1980.)0 2105 y([22])19 b(Alexander)c(Koto)o(v)e(\(GM\).)18 b(Think)c(lik)o(e)f(a)g (grandmaster.)18 b(B.T.)13 b(Batsford)h(ltd,)f(1971.)g(ISBN=0-7134-3160-1.)0 2191 y([23])19 b(Ben)o(t)c(Larsen)g(\(GM\):)j(Ben)o(t)c(Larsen's)h(go)q(o)q (d)e(mo)o(v)o(e)g(guide,)k(Oxford)d(Univ)o(ersit)o(y)g(Press)i(1982.)h(ISBN)d (=)g(0-19-217593-9.)0 2277 y([24])19 b(A.)14 b(Livshits)g(and)f(J.)h(Sp)q (eelman.)j(T)m(est)d(y)o(our)g(endgame)f(abilit)o(y)m(,)j(2nd)d(edition,)g (Batsford)i(1992.)0 2363 y([25])k(M.A.)13 b(Minsky)h(and)g(S.L.)f(P)o(ap)q (ert.)19 b(P)o(erceptrons,)h(MIT)14 b(Press)h(1969.)0 2449 y([26])k(M.)d(Newb)q(orn.)27 b(A)17 b(h)o(yp)q(othesis)g(concerning)g(the)g (strength)h(of)e(c)o(hess)i(programs,)26 b(ICCA)16 b(J)h(8,4)e(\(Dec)j (1985\))d(209-215;)h(9,4)85 2499 y(\(Dec)f(1986\))e(199.)0 2585 y([27])19 b(J.B.)14 b(Nielsen.)k(A)c(c)o(hess-computer)h(test)g(set,)k (ICCA)14 b(J)g(14,1)f(\(Marc)o(h)h(1991\))f(33-37.)0 2670 y([28])19 b(Aron)c(Nimzo)o(witsc)o(h)e(\(GM\).)19 b(My)14 b(System,)k(\(New,)d (re-edited)g(edition\))f(Ha)o(ys)g(Publishing)g(Inc.)g(1991.)k(ISBN)d(=)f (1-880673-)85 2720 y(85-1)0 2806 y([29])19 b(Aron)14 b(Nimzo)o(witsc)o(h.)j (Chess)e(Praxis,)j(Do)o(v)o(er)c(Reprin)o(t)f(1962.)14 2881 y Fv(Do)q(cNum)891 b Fk(9)885 b Fv(.)12 b(5.)f(0.)g(0)p eop %%Page: 10 10 bop 12 -158 a Fv(Lang)10 b(and)h(Smith)600 b(t)o(yp)q(eset)8 b(754)h(Jun)g(29,)h(1993)660 b(Chess)12 b(T)m(est)0 -75 y Fk([30])19 b(F)m(red)d(Reinfeld.)21 b(1001)14 b(winning)g(c)o(hess)j(sacri\014ces)g(and) e(com)o(binations,)20 b(Melvin)14 b(P)o(o)o(w)o(ers)i(Wilshire)f(b)q(o)q(ok)f (compan)o(y)g(\(third)85 -25 y(prin)o(ting)f(1955\))18 b(ISBN)c(=)h (0-87980-111-5.)0 58 y([31])k(F)m(red)c(Reinfeld.)i(Win)c(at)h(Chess,)19 b(Do)o(v)o(er)13 b(1945)18 b(ISBN)c(=)g(0-486-20438-3.)0 141 y([32])19 b(F)m(red)c(Reinfeld.)i(The)d(complete)f(c)o(hesspla)o(y)o(er,)20 b(Pren)o(tice)15 b(Hall)e(1953.)0 224 y([33])19 b(M.I.)13 b(Shereshevsky)m(.) 20 b(Endgame)13 b(Strategy)m(,)18 b(P)o(ergamon)12 b(1985)18 b(ISBN)c(=)g(0-08-029746-3.)0 307 y([34])19 b(Jon)14 b(S.)g(Sp)q(eelman)f (\(GM\).)18 b(Endgame)12 b(Preparation,)19 b(Batsford,)13 b(1981.)k(ISBN)e(=) f(0-7134-3999-8.)0 390 y([35])19 b(Jon)14 b(S.)g(Sp)q(eelman)f(\(GM\).)18 b(Analysing)12 b(The)j(Endgame,)i(Batsford)d(1981.)j(ISBN)d(=)g (0-7134-1897-4.)0 473 y([36])19 b(Eugene)e(A.)f(Znosk)o(o-Boro)o(vsky)m(.)24 b(Ho)o(w)16 b(to)g(pla)o(y)f(the)i(c)o(hess)g(op)q(enings,)25 b(Do)o(v)o(er)16 b(1971,)f(reprin)o(t)i(of)e(Pitman)g(1935.)23 b(ISBN)17 b(=)85 523 y(0-486-22795-2.)0 606 y([37])i(Eugene)g(A.)d(Znosk)o (o-Boro)o(vsky)m(.)28 b(Ho)o(w)17 b(to)g(pla)o(y)f(the)i(c)o(hess)h(endings,) 29 b(Do)o(v)o(er)17 b(1974,)f(reprin)o(t)i(of)f(McKa)o(y)g(1940.)27 b(ISBN)18 b(=)85 656 y(0-486-21170-3.)0 747 y(\(Higher)c(c)o(hess)i(titles)e (than)f(national)g(master)g(ha)o(v)o(e)h(b)q(een)h(listed,)e(for)h(authors,)g (when)g(kno)o(wn.\))14 2881 y Fv(Do)q(cNum)880 b Fk(10)863 b Fv(.)16 b(5.)f(0.)g(0)p eop %%Trailer end userdict /end-hook known{end-hook}if %%EOF gnuchess-4.0.pl70/test/CHESSTEST/samplepos.ps100644 21542 13 123212 5527662451 17743 0ustar cracraftuser%!PS-Adobe-2.0 %%Creator: dvips 5.47 Copyright 1986-91 Radical Eye Software %%Title: samplepos.dvi %%Pages: 1 1 %%BoundingBox: 0 0 612 792 %%EndComments %%BeginProcSet: tex.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /exch load def /X{S N}B /TR /translate load N /isls false N /vsize 10 N /@rigin{ isls{[0 1 -1 0 0 0]concat}if 72 Resolution div 72 VResolution div neg scale Resolution VResolution vsize neg mul TR matrix currentmatrix dup dup 4 get round 4 exch put dup dup 5 get round 5 exch put setmatrix}N /@letter{/vsize 10 N}B /@landscape{/isls true N /vsize -1 N}B /@a4{/vsize 10.6929133858 N}B /@a3{ /vsize 15.5531 N}B /@ledger{/vsize 16 N}B /@legal{/vsize 13 N}B /@manualfeed{ statusdict /manualfeed true put}B /@copies{/#copies X}B /FMat[1 0 0 -1 0 0]N /FBB[0 0 0 0]N /nn 0 N /IE 0 N /ctr 0 N /df-tail{/nn 8 dict N nn begin /FontType 3 N /FontMatrix fntrx N /FontBBox FBB N string /base X array /BitMaps X /BuildChar{CharBuilder}N /Encoding IE N end dup{/foo setfont}2 array copy cvx N load 0 nn put /ctr 0 N[}B /df{/sf 1 N /fntrx FMat N df-tail} B /dfs{div /sf X /fntrx[sf 0 0 sf neg 0 0]N df-tail}B /E{pop nn dup definefont setfont}B /ch-width{ch-data dup length 5 sub get}B /ch-height{ch-data dup length 4 sub get}B /ch-xoff{128 ch-data dup length 3 sub get sub}B /ch-yoff{ ch-data dup length 2 sub get 127 sub}B /ch-dx{ch-data dup length 1 sub get}B /ch-image{ch-data dup type /stringtype ne{ctr get /ctr ctr 1 add N}if}B /id 0 N /rw 0 N /rc 0 N /gp 0 N /cp 0 N /G 0 N /sf 0 N /CharBuilder{save 3 1 roll S dup /base get 2 index get S /BitMaps get S get /ch-data X pop /ctr 0 N ch-dx 0 ch-xoff ch-yoff ch-height sub ch-xoff ch-width add ch-yoff setcachedevice ch-width ch-height true[1 0 0 -1 -.1 ch-xoff sub ch-yoff .1 add]{ch-image} imagemask restore}B /D{/cc X dup type /stringtype ne{]}if nn /base get cc ctr put nn /BitMaps get S ctr S sf 1 ne{dup dup length 1 sub dup 2 index S get sf div put}if put /ctr ctr 1 add N}B /I{cc 1 add D}B /bop{userdict /bop-hook known{bop-hook}if /SI save N @rigin 0 0 moveto}N /eop{clear SI restore showpage userdict /eop-hook known{eop-hook}if}N /@start{userdict /start-hook known{start-hook}if /VResolution X /Resolution X 1000 div /DVImag X /IE 256 array N 0 1 255{IE S 1 string dup 0 3 index put cvn put}for}N /p /show load N /RMat[1 0 0 -1 0 0]N /BDot 260 string N /rulex 0 N /ruley 0 N /v{/ruley X /rulex X V}B /V statusdict begin /product where{pop product dup length 7 ge{0 7 getinterval(Display)eq}{pop false}ifelse}{false}ifelse end{{gsave TR -.1 -.1 TR 1 1 scale rulex ruley false RMat{BDot}imagemask grestore}}{{gsave TR -.1 -.1 TR rulex ruley scale 1 1 false RMat{BDot}imagemask grestore}}ifelse B /a{ moveto}B /delta 0 N /tail{dup /delta X 0 rmoveto}B /M{S p delta add tail}B /b{ S p tail}B /c{-4 M}B /d{-3 M}B /e{-2 M}B /f{-1 M}B /g{0 M}B /h{1 M}B /i{2 M}B /j{3 M}B /k{4 M}B /w{0 rmoveto}B /l{p -4 w}B /m{p -3 w}B /n{p -2 w}B /o{p -1 w }B /q{p 1 w}B /r{p 2 w}B /s{p 3 w}B /t{p 4 w}B /x{0 S rmoveto}B /y{3 2 roll p a}B /bos{/SS save N}B /eos{clear SS restore}B end %%EndProcSet TeXDict begin 1000 300 300 @start /Fa 9 117 df<0003F020001E0C60003002E000E003 C001C001C0038001C0070000C00E0000801E0000801C0000803C0000803C000000780000007800 000078000000F0000000F0000000F0000000F0000000F0000400F0000400F0000400F000080070 0008007000100038002000180040000C0180000706000001F800001B1E7A9C1E>67 D87 D<03CC063C0C3C181C3838303870387038E070E070E070E070E0E2C0E2C0E261E462643C380F12 7B9115>97 D<01E007100C1018083810701070607F80E000E000E000E000E000E0086010602030 C01F000D127B9113>101 D<0FC00001C00001C000038000038000038000038000070000070000 0700000700000E78000E8C000F0E000E0E001C0E001C0E001C0E001C0E00381C00381C00381C00 383800703880703880707080707100E03200601C00111D7D9C15>104 D<018003800100000000 00000000000000000000001C002600470047008E008E000E001C001C001C003800380071007100 7100720072003C00091C7C9B0D>I<3C3C002646004687004707008E07008E07000E07000E0700 1C0E001C0E001C0E001C1C00381C40381C40383840383880701900300E0012127C9117>110 D<01F006080C080C1C18181C001F001FC00FF007F0007800386030E030C030806060C01F000E12 7D9111>115 D<00C001C001C001C00380038003800380FFE00700070007000E000E000E000E00 1C001C001C001C00384038403840388019000E000B1A7D990E>I E /Fb 19 116 df<000101808053>48 D<00000000F80000000000000001040000000000000002020000 000000000002020000000000000002020000000000000002020000000000000002020000000000 000001040000000000000000F80000000000000000500000000000000000880000000000000001 040000000000000006030000000000000008008000000000000030006000000000000040001000 000000000180000C00000000000200000200000000000400000100000000000800000080000000 001000200040000000002000200020000000004000200010000000004000200010000000008000 200008000000008000200008000000008007FF0008000000010000200004000000010000200004 000000010000200004000000010000200004000000010000200004000000010000000004000000 010000000004000000008000000008000000008000000008000000004000000010000000004000 000010000000002000000020000000001007FF00400000000008F800F880000000000700000700 000000000400000100000000000400000100000000000400000100000000000400000100000000 000800000080000000000807FF008000000000087800F080000000000980000C80000000001600 0003400000000018000000C0000000000600000300000000000180000C0000000000007800F000 000000000007FF000000000000000104000000000000000202000000000000000C018000000000 0180F000780C0000007E7F000007F3F000038000000000000E000C000000200000018010000000 D800000040600000030600000030800003FC01FE0000084007FC000001FF001020380000000000 E02010C000000000001840090000000000000480060000000000000300454779CA53>66 D74 D76 DI79 D<000003F800000000000C06 000000000010010000000000200080000000002000800000000040004000000000400040000000 004000400000000040004000000000400040000000002000800000000020008000000000100100 00000000080200000000001E0F00000000006000C0000000018000300000000200000800000004 000004000000080000020000000800000200000010000001000000100000010000002000000080 000020000000800000200000008000002000000080000020000000800000200000008000001000 000100000010000001000000080000020000000800000200000004000004000000020000080000 000180003000000000400040000000018000300000000600000C00000008000002000000300000 018000004000000040000080000000200001000000001000020000000008000400000000040004 000000000400080000000002001000000000010010000000000100200000000000802000000000 008040000000000040400000000000404000000000004040000000000040800000000000208000 000000002080000000000020800000000000208000000000002080000000000020800000000000 208000000000002080000000000020800000000000207FFFFFFFFFFFC0334370CA53>I<1FF807 FFC03FF010080400402010100804004020101008040040201010080400402010100FFC007FE010 10000000000010100000000000101000000000001010000000000010100000000000101FFFFFFF FFFFF0080000000000200400000000004003000000000180008000000002000040000000040000 300000001800001FFFFFFFF0000010000000100000100000001000001000000010000010000000 100000100000001000001000000010000010000000100000100000001000001000000010000010 000000100000100000001000001000000010000010000000100000100000001000001000000010 000010000000100000100000001000001000000010000010000000100000100000001000001000 000010000010000000100000100000001000001FFFFFFFF0000020000000080000400000000800 00800000000400008000000002000100000000010002000000000080040000000000400FFFFFFF FFFFE0080000000000200800000000002008000000000020080000000000200800000000002008 000000000020FFFFFFFFFFFFFE8000000000000280000000000002800000000000028000000000 000280000000000002FFFFFFFFFFFFFE374072C753>82 DI90 D<00000001F00000000000000003F80000000000000007FC0000000000000007FC000000000000 0007FC0000000000000007FC0000000000000007FC0000000000000003F80000000000000001F0 0000000000000000400000000000000001F00000000000000003F80000000000000007FC000000 000000001FFF000000000000003FFF80000000000000FFFFE0000000000001FFFFF00000000000 07FFFFFC00000000000FFFFFFE00000000001FFFFFFF00000000003FFFFFFF80000000007FFF9F FFC000000000FFFF9FFFE000000000FFFF9FFFE000000001FFFF9FFFF000000001FFF001FFF000 000001FFF001FFF000000003FFFF9FFFF800000003FFFF9FFFF800000003FFFF9FFFF800000003 FFFF9FFFF800000003FFFFFFFFF800000003FFFFFFFFF800000003FFFFFFFFF800000001FFFFFF FFF000000001FFFFFFFFF000000000FFFFFFFFE000000000FFFFFFFFE0000000007FF803FFC000 0000003F80003F80000000001E03F80F00000000000E3FFF8E000000000007FFFFFC0000000000 07FFFFFC00000000000FFFFFFE00000000000FFFFFFE00000000000FFFFFFE00000000000FF001 FE00000000001F80003F00000000001E07FC0F0000000000183FFF83000000000018FFFFE30000 0000000BFFFFFA000000000003FFFFF8000000000000FFFFE00000000000000FFE000000000000 0001F00000000000000003F8000000000000000FFE000000000000003FFF80000000003FFFFFFF FFFF800003FFFFFFFFFFFFF8000FFFFFFFFFFFFFFE001FFFFFFF1FFFFFFF007FFFFFFC07FFFFFF C0FFFFFFE000FFFFFFE0FFFC0000000007FFE07FC000000000007FC03F0000000000001F801C00 00000000000700080000000000000200434778CA53>98 D106 D108 DI<0000000080000000000000C00180000000000000F003C000 0000000000F807C0000000000000FE0FC0000000000000FF9FE0000000000000FFFFE000000000 0000FFFFF0000000000000FFFFF0000000000000FFFFFFFE00000000007FFFF003C000000000FF FFF0003000000000FFFFFFF80800000001FFFFFFFF8600000003FFFFFFFFE100000007FFFFFFFF F08000000FFFFFFFFFFC4000001FFFFFFFFFFE2000003FC7FFFFFFFF1000003F8FFFFFFFFF8000 003F0FFFFFFFFFC800003F1FFFFFFFFFC400003E3FFFFFFFFFE400003C7FFFFFFFFFE200003DFF FFFFFFFFF200003FFFFFFFFFFFF100007FFFFFFFFFFFF900007FFFFFFFFFFFF80000FFFFFFFFFF FFFC8000FFFFFFFFFFFFFC8001FFFFFFFFFFFFFC4001FFFFFFFFFFFFFE4003FFFFFFFFFFFFFE40 07FFFFFFFFFFFFFE200FFFFFFFFFFFFFFF200FFFFFFFCFFFFFFF201FFFFFFF8FFFFFFF203FFFFF FE0FFFFFFF103FFFFFFC0FFFFFFF907FFFFFF00FFFFFFF907FFFFFC00FFFFFFF9079FFFF000FFF FFFF88F0FFFC000FFFFFFFC8E0FFF8001FFFFFFFC8E1FFF0001FFFFFFFC8E3FFE0001FFFFFFFCC EFFFC0001FFFFFFFC47FFFC0003FFFFFFFE47FFF80003FFFFFFFE43FFF80007FFFFFFFE41FFF00 00FFFFFFFFE407FF0000FFFFFFFFE6007E0001FFFFFFFFE6007C0003FFFFFFFFE200380007FFFF FFFFF20000000FFFFFFFFFF20000001FFFFFFFFFF20000003FFFFFFFFFF20000007FFFFFFFFFF3 000000FFFFFFFFFFF3000001FFFFFFFFFFF3000003FFFFFFFFFFF3000003FFFFFFFFFFF1000007 FFFFFFFFFFF9000007FFFFFFFFFFF900000FFFFFFFFFFFF900000FFFFFFFFFFFF900000FFFFFFF FFFFF900000FFFFFFFFFFFF900000FFFFFFFFFFFFF00000FFFFFFFFFFFFF48477BCC53>II<000003F800000000000FFE00000000001FFF00000000003FFF80000000003FFF800000 00007FFFC0000000007FFFC0000000007FFFC0000000007FFFC0000000007FFFC0000000003FFF 80000000003FFF80000000001FFF00000000000FFE00000000000FFE00000000007FFFC0000000 01FFFFF000000003FFFFF800000007FFFFFC00000007FFFFFC0000000FFFFFFE0000000FFFFFFE 0000001FFFFFFF0000001FFFFFFF0000001FFFFFFF0000001FFFFFFF0000001FFFFFFF0000001F FFFFFF0000001FFFFFFF0000001FFFFFFF0000000FFFFFFE0000000FFFFFFE00000007FFFFFC00 000007FFFFFC00000003FFFFF800000001FFFFF0000000007FFFC000000000FFFFE000000003FF FFF80000000FFFFFFE0000003FFFFFFF8000007FFFFFFFC00000FFFFFFFFE00001FFFFFFFFF000 03FFFFFFFFF80007FFFFFFFFFC0007FFFFFFFFFC000FFFFFFFFFFE001FFFFFFFFFFF001FFFFFFF FFFF003FFFFFFFFFFF803FFFFFFFFFFF803FFFFFFFFFFF807FFFFFFFFFFFC07FFFFFFFFFFFC07F FFFFFFFFFFC0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFF FFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFFFFFFFFFFE0FFFF FFFFFFFFE0334370CA53>I<3FF007FF007FE03FF007FF007FE03FF007FF007FE03FF007FF007F E03FF007FF007FE03FFFFFFFFFFFE03FFFFFFFFFFFE03FFFFFFFFFFFE03FFFFFFFFFFFE03FFFFF FFFFFFE030000000000060300000000000400FFFFFFFFFFF8007FFFFFFFFFE0001FFFFFFFFFC00 00FFFFFFFFF0000030000000600000100000004000001FFFFFFFC000001FFFFFFFC000001FFFFF FFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC00000 1FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFF C000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC000001F FFFFFFC000001FFFFFFFC000001FFFFFFFC000001FFFFFFFC00000100000004000001000000060 00003FFFFFFFF000007FFFFFFFF80000FFFFFFFFFC0001FFFFFFFFFE0003FFFFFFFFFF00000000 00000000080000000000800FFFFFFFFFFF800FFFFFFFFFFF800FFFFFFFFFFF800FFFFFFFFFFF80 0FFFFFFFFFFF8008000000000080080000000000F8FFFFFFFFFFFFF8FFFFFFFFFFFFF8FFFFFFFF FFFFF8FFFFFFFFFFFFF8FFFFFFFFFFFFF8FFFFFFFFFFFFF8353F71C653>114 DI E /Fc 30 120 df<000301800003018000030180000603000006030000060300 0006030000060300000C0600000C0600000C0600000C060000180C007FFFFFF8FFFFFFFC003018 0000301800003018000030180000603000006030000060300000603000FFFFFFFC7FFFFFF800C0 60000180C0000180C0000180C0000180C000030180000301800003018000030180000603000006 030000060300001E257E9C23>35 D<60F0F8680808081010204080050C7C9C0C>39 D<60F0F06004047C830C>46 D<00010003000600060006000C000C000C00180018001800300030 00300060006000C000C000C0018001800180030003000300060006000C000C000C001800180018 00300030003000600060006000C000C00010297E9E15>I<03C00C301818300C300C700E600660 06E007E007E007E007E007E007E007E007E007E007E007E007E00760066006700E300C300C1818 0C3007E0101D7E9B15>I<030007003F00C7000700070007000700070007000700070007000700 0700070007000700070007000700070007000700070007000F80FFF80D1C7C9B15>I<07E01830 201C201C781E780E781E381E001C001C00180030006007E00030001C001C000E000F000F700FF8 0FF80FF80FF00E401C201C183007E0101D7E9B15>51 D<00F0030C06040C0E181E301E300C7000 70006000E3E0E430E818F00CF00EE006E007E007E007E007E007600760077006300E300C18180C 3003E0101D7E9B15>54 D<60F0F0600000000000000000000060F0F06004127C910C>58 D<003F800000E0E0000380380007001C000E000E001C0007003C00078038000380780003C07800 03C0700001C0F00001E0F00001E0F00001E0F00001E0F00001E0F00001E0F00001E0F00001E070 0001C0780003C0780003C0380003803C0E07801C1107000E208E000720DC0003A0F80000F0E020 003FE0200000602000007060000078E000003FC000003FC000001F8000000F001B257E9C20>81 DI87 D<1FC000307000783800781C00301C00001C00001C0001FC000F1C00381C00701C00601C 00E01C40E01C40E01C40603C40304E801F870012127E9115>97 D<07E00C301878307870306000 E000E000E000E000E000E00060007004300418080C3007C00E127E9112>99 D<003F0000070000070000070000070000070000070000070000070000070000070003E7000C17 00180F00300700700700600700E00700E00700E00700E00700E00700E007006007007007003007 00180F000C370007C7E0131D7E9C17>I<03E00C301818300C700E6006E006FFFEE000E000E000 E00060007002300218040C1803E00F127F9112>I<00F8018C071E061E0E0C0E000E000E000E00 0E000E00FFE00E000E000E000E000E000E000E000E000E000E000E000E000E000E000E000E007F E00F1D809C0D>I<00038003C4C00C38C01C3880181800381C00381C00381C00381C001818001C 38000C300013C0001000003000001800001FF8001FFF001FFF803003806001C0C000C0C000C0C0 00C06001803003001C0E0007F800121C7F9215>II<1800 3C003C0018000000000000000000000000000000FC001C001C001C001C001C001C001C001C001C 001C001C001C001C001C001C001C00FF80091D7F9C0C>I108 DII<03F0000E1C00180600300300700380600180E001C0E001C0 E001C0E001C0E001C0E001C06001807003803003001806000E1C0003F00012127F9115>II114 D<1F9030704030C010C010E010F8007F803FE00FF000F880388018C018 C018E010D0608FC00D127F9110>I<04000400040004000C000C001C003C00FFE01C001C001C00 1C001C001C001C001C001C001C101C101C101C101C100C100E2003C00C1A7F9910>I118 DI E /Fd 27 120 df<70F8F8F8700505788416> 46 D<000180000380000380000700000700000E00000E00001C00001C00003800003800007000 00700000E00000E00001C00001C0000380000380000700000700000E00000E00001C00001C0000 380000380000700000700000E00000E00000C0000011207E9C16>I<03E0000FF8001FFC001E3C 00380E00780F00700700700700E00380E00380E00380E00380E00380E00380E00380E00380F007 80700700700700780F003C1E001E3C001FFC000FF80003E00011197E9816>I<01800380038007 800F807F80FF807380038003800380038003800380038003800380038003800380038003807FF8 7FFC7FF80E197C9816>I<07E0001FF8003FFC00783E00E00700F00780F0038060038000038000 0380000700000700000E00001C0000380000700000E00001C0000380000F00001E03803803807F FF80FFFF807FFF8011197E9816>I<07E0001FF8003FFC00781E00780700300700000700000700 000E00003E0007FC0007F00007FC00001E00000700000300000380000380600380F00380E00700 781E003FFC001FF80007E00011197E9816>I<007C0000FC0000DC0001DC00039C00039C00071C 000F1C000E1C001E1C003C1C00381C00781C00F01C00FFFFE0FFFFE0FFFFE0001C00001C00001C 00001C00001C0001FFC001FFC001FFC013197F9816>I<00F80003FC0007FE000F07001C0F0038 0F00780600700000700000E3F800EFFC00FFFE00F80F00F00700F00380E00380E0038070038070 03807007803807003C1E001FFC000FF80003E00011197E9816>54 D<7FF800FFFE007FFF001C0F 001C07801C03801C03801C03801C07801C07001FFF001FFE001FFE001C1F001C03801C03C01C01 C01C01C01C01C01C01C01C03C01C07807FFF80FFFF007FFC0012197F9816>66 D<7F0FE0FF8FF07F0FE01C07801C0F001C0E001C1C001C3C001C78001CF0001CE0001DF0001FF0 001FF8001F38001E1C001C1C001C0E001C0E001C07001C07001C03807F07E0FF8FF07F07E01419 809816>75 D<7E1FC0FF3FE07F1FC01D07001D87001D87001D87001DC7001DC7001CC7001CC700 1CE7001CE7001CE7001C67001C67001C77001C77001C37001C37001C37001C17007F1F00FF9F00 7F0F0013197F9816>78 D<7FF800FFFE007FFF001C0F801C03801C03C01C01C01C01C01C01C01C 03C01C03801C0F801FFF001FFE001FF8001C00001C00001C00001C00001C00001C00001C00007F 0000FF80007F000012197F9816>80 D<1FFC003FFE007FFF00780F00F00780E00380E00380E003 80E00380E00380E00380E00380E00380E00380E00380E00380E00380E00380E0E380E1E380F0F7 80787F007FFF003FFE001FFC00001C00001E00000E00000F00000700000700111F7E9816>I<7F E000FFF8007FFC001C1E001C0F001C07001C07001C07001C07001C0F001C1E001FFC001FF8001F FC001C1C001C0E001C0E001C0E001C0E001C0E201C0E701C0E707F07E0FF87E07F03C014197F98 16>I<7E0000FE00007E00000E00000E00000E00000E00000E3E000EFF000FFF800F83C00F00E0 0E00E00E00700E00700E00700E00700E00700E00700E00E00F01E00F83C00FFF800EFF00063C00 1419809816>98 D<003F00007F00003F0000070000070000070000070003C7000FF7001FFF003C 1F00780F00700700E00700E00700E00700E00700E00700E00700700F00700F003C1F001FFFE00F E7F007C7E014197F9816>100 D<03E00FF81FFC3C1E780E7007E007FFFFFFFFFFFFE000E00070 0778073C0F1FFE0FFC03F010127D9116>I<001F00007F8000FF8001E78001C30001C00001C000 7FFF00FFFF00FFFF0001C00001C00001C00001C00001C00001C00001C00001C00001C00001C000 01C00001C0003FFE007FFF003FFE0011197F9816>I<03E3C007F7E00FFFE01C1CC0380E00380E 00380E00380E00380E001C1C000FF8001FF0001BE0003800001800001FFC001FFF003FFF807803 C0E000E0E000E0E000E0E000E07001C07C07C03FFF800FFE0003F800131C7F9116>I<018003C0 03C0018000000000000000007FC07FC07FC001C001C001C001C001C001C001C001C001C001C001 C001C07FFFFFFF7FFF101A7D9916>105 D<7E0000FE00007E00000E00000E00000E00000E0000 0E7FE00E7FE00E7FE00E0F000E1E000E3C000E78000EF0000FF0000FF8000FBC000F1E000E0E00 0E07000E07807F87F0FFCFF07F87F01419809816>107 DI<7E3C00FEFE007FFF000F87 800F03800E03800E03800E03800E03800E03800E03800E03800E03800E03800E03807FC7F0FFE7 F87FC7F01512809116>110 D<7E3E00FEFF007FFF800F83C00F00E00E00E00E00700E00700E00 700E00700E00700E00700E00E00F01E00F83C00FFF800EFF000E3C000E00000E00000E00000E00 000E00000E00007FC000FFE0007FC000141B809116>112 D<07C7000FE7001FF7003C1F00700F 00700F00E00700E00700E00700E00700E00700E00700700F00700F003C3F003FF7001FE70007C7 00000700000700000700000700000700000700003FE0007FF0003FE0141B7E9116>II 119 D E end %%EndProlog %%BeginSetup %%Feature: *Resolution 300 TeXDict begin %%EndSetup %%Page: 1 1 bop 125 357 a Fd(2rr3k/pp3pp1/1n)o(nqbN1)o(p/3pN)o(3/2pP)o(4/2P)o(3Q1/P)o (PB4P/)o(R4RK1)o(/w)19 b(Qg3g6)i(Reinfeld.300.1)125 448 y Fc(whic)o(h)47 b(indicates)h(the)h(follo)o(wing)c(p)q(osition:)p 125 465 673 5 v 125 1129 5 665 v 130 548 a Fb(0Zrs0Z0j)130 631 y(opZ0Zpo0)130 714 y(0mnlbM0o)130 797 y(Z0ZpM0Z0)130 880 y(0ZpO0Z0Z)130 963 y(Z0O0Z0L0)130 1046 y(POBZ0Z0O)130 1129 y(S0Z0ZRJ0)p 793 1129 V 125 1133 673 5 v -152 1183 a Fc(White)14 b(to)f(mo)o(v)o(e)f(Qg3g6.)18 b(#1/300)12 b(test)j(p)q(ositions)f(from)e(Reinfeld's)h Fa(Win)i(at)g(Chess)p Fc(.)965 2574 y(1)p eop %%Trailer end userdict /end-hook known{end-hook}if %%EOF gnuchess-4.0.pl70/test/CHESSTEST/README.gnu100644 21542 13 643 5527662451 16766 0ustar cracraftuserTo run all the Chess Test tests just type make. It will make the programs and start the testing. When I ran it it took approximately 75 hours to run. The only configuration is to set the time per move in the script testall. The last two arguments of testgen ate the #moves and the time in minutes. On the Sun systems and the 486 running BSDI I experienced none of the hanging problems reported on the SGI machines. gnuchess-4.0.pl70/test/CHESSTEST/486.results100644 21542 13 1111 5527662451 17271 0ustar cracraftuser BSDI/386 on 486/33 compiler is gnucc 1.40 test right wrong total percent bellin 8 25 33 24 ece3 804 993 1797 45 finecomb 8 42 50 16 gelfer 79 248 327 24 hardmid 268 610 878 31 hortjan 55 78 133 41 jenoban 112 90 202 55 kcmdm 38 110 148 26 kotov 40 75 115 35 larsen1 71 29 100 71 larsen2 15 33 48 31 larsen3 21 42 63 33 openings 33 77 110 30 positional 55 99 154 36 reinfeld 587 412 999 59 sherev 11 49 60 18 speelman 63 104 167 38 winatchess 222 78 300 74 total 2490 3194 5684 44 total 2490 3194 5684 44 gnuchess-4.0.pl70/test/CHESSTEST/test.result100644 21542 13 1200 5555627721 17545 0ustar cracraftuser test right wrong total percent CHESSTEST/bellin 7 26 33 21 CHESSTEST/ece3 718 1077 1795 40 CHESSTEST/finecomb 9 41 50 18 CHESSTEST/gelfer 77 250 327 24 CHESSTEST/hardmid 355 485 840 42 CHESSTEST/hortjan 52 81 133 39 CHESSTEST/jenoban 101 100 201 50 CHESSTEST/kcmdm 37 41 78 47 CHESSTEST/kotov 33 82 115 29 CHESSTEST/larsen1 82 18 100 82 CHESSTEST/larsen2 13 35 48 27 CHESSTEST/larsen3 25 38 63 40 CHESSTEST/openings 33 77 110 30 CHESSTEST/positional 44 110 154 29 CHESSTEST/reinfeld 634 242 876 72 CHESSTEST/sherev 15 45 60 25 CHESSTEST/speelman 61 106 167 37 CHESSTEST/winatchess 239 61 300 80 total 2535 2915 5450 47 gnuchess-4.0.pl70/test/CHESSTEST/cmpr100755 21542 13 22374 5554025750 16245 0ustar cracraftuserELFx4 4 (44 /usr/lib/ld.so.15A.43&0)=7</:*+@29'5>1$,#?-8!"( %;6$x L X ` h  $` xtX (d*d,.7<RTY`^b Xhmr{l!$x xx\ h d  <<$(/L  __DTOR_LIST___startAB__CTOR_LIST__abi_environ_end_GLOBAL_OFFSET_TABLE_atexitexitaaa_initfailloop_DYNAMICbbbprintfright_exitaaenvironbbfgets_edata_PROCEDURE_LINKAGE_TABLE_fopen__do_global_dtors__CTOR_END___etext_lib_version__do_global_ctors__DTOR_END__mainnumstrlen_finilibc.so.1"T%`&l/x63?- @D# @AC"L@A@R, @ "@@A@A㿐C"\"\  C  C@A!x㿐'D'H H @Cp@A"c H @Cp@A|"c" " c d@Ar c@An   H Cx@@Af@AU" ` " ` d@AN`@AM   H Cx@@AE@A4" " ` *`: : ` " ` *`: : ` " `" `" `" `"  "##`Y" "  `. `  @*`: * :@ " ` " ` " ` "  `` *`: ,`"  "#` " "# ` ` "  H C"@@@㿐C"` "``   ` `@  C"`*`?2㿐㿠㿐C"\"\  C  C@@H!x㿠rbad file %s %s %d RIGHT %d 5  L ? $T$` 00<0H0T0`0l0x0$x L X ` h  $ $ :HOYd z` xtX ddT` X  l #!+.4;$Ux[ xxm\ zh d  <<L  cmprcrti.svalues-Xa.ccrtstuff.c__do_global_ctors_auxforce_to_datacmpr.clibgcc2.ccrtstuff.c__do_global_ctors_auxforce_to_datacrtn.s__DTOR_LIST___startAB__CTOR_LIST__abi_environ_end_GLOBAL_OFFSET_TABLE_atexitexitaaa_initfailloop_DYNAMICbbbprintfright_exitaaenvironbbfgets_edata_PROCEDURE_LINKAGE_TABLE_fopen__do_global_dtors__CTOR_END___etext_lib_version__do_global_ctors__DTOR_END__mainnumstrlen_fini d/dQ88F<@(#)SunOS 5.3 Generic September 1993as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8ld: (SGU) SunOS/ELF (LK-1.4 (S/I))) d x'd x3<BdvԀ\zՀ@[wUW345&607;8F9Q>\Eil.$ x.interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.ctors.dtors.rodata.got.dynamic.plt.data.bss.symtab.strtab.stab.index.comment.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.c/1093/on1093_ws/usr/src/lib/libc/port/gen/values-Xa.cXt ; V=2.0/opt/home/mwm/CHESS/gnuchess-4.0/test/CHESSTEST/usr/ccs/lib/values-Xa.olibgcc2.c/export/home/mwm/gcc-2.5.8/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19reg_class:T20=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T21=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,SFmode:11,DFmode:12,XFmode:13,TFmode:14,SCmode:15,DCmode:16,XCmode:17,TCmode:18,CQImode:19,CHImode:20,CSImode:21,CDImode:22,CTImode:23,COImode:24,BLKmode:25,CCmode:26,CC_NOOVmode:27,CCFPmode:28,CCFPEmode:29,MAX_MACHINE_MODE:30,;mode_class:T22=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T23=s8high:1,0,32;low:1,32,32;;DIunion:t24=u8s:23,0,64;ll:6,0,64;;func_ptr:t25=*26=f19__do_global_dtors:F19  ?  )$$T 3xx|9 X?LL EXXL``Shh0[`i$$ nty&DH ! ngnuchess-4.0.pl70/test/CHESSTEST/testgen100755 21542 13 32610 5556702167 16755 0ustar cracraftuserELF 41x4 (44PPPPTT/usr/lib/ld.so.1C[JY?BZF= E4"#0<D/>$%T8G1'()V*+@IXKLMUO3SW9Q!&5,A6:2C.NP;H-7Rh     $ , 8 P T,  t<!#$ 13;=?@A,C0E4G8I<K@MDOHQYLb#HgP}P `XxTTTX$L! X \ ` H0% l(Dx:"ld@( MPT8 a s0  h   "l""d#<#@#D__DTOR_LIST___startatoicolorF__CTOR_LIST__OisdigitRWbcijklpqrtoupper_environ_end_GLOBAL_OFFSET_TABLE_colortatexitexittolowersprintf_initcount.remfclose_DYNAMICcountxepsstrncmpmove_exitenvironbkbqfnfgetsisupper_edata_PROCEDURE_LINKAGE_TABLE_fopenin__do_global_dtorsnamer__CTOR_END___etext_lib_version__do_global_ctors__DTOR_END__main.div_finitimecfprintftimemnametimeswkwqlibc.so.1L. 23$?0H<HDT=`5lUx9!E4-R8 @D# @DSF"@DO@z, @ L"@@DD@DE㿐F"("(  F  F@D-!D㿀'D'H ""8 H @F@@D&"a! H @@D *@*`"*"@*`$"А H @@D"bԐ H @@D "c<< +  * + bД@ "" d"!`l"@C FbHl @C `lFP @C `lFX @C `lF` @C Fbhl @C aВ "!!Ѐ`cL"!aԒ "!Ԑ H bF"p@C H  H blFbx!@C!Ԁ` aF@Ca@CbF@Cj"ablF@Cb"aaF@CiaF@Cc "X "\ "c@ "#D""0"0`'""4"4`b0*` 4  .*b4 ""4b0 ""0l""@""H"","H`vb@ *`: nb@ *`:  @C b,@ *; @ "",Mb@ *`: / bH ""H"",:b@ *`:  @B b@ *`:  @B@*@ b@ *`:  @B@*@bH*` , @ @*b, "",b@ ""@b@ *`: w F"!F""P F"!F""Pb@""@ H ``F"8@B|X""Db@ *`: wb@ *`:  @Bt  b@ ""@b@ *`: x b@ ""@b@ *`: + b@ ""@b@ *`: ! b@ ""@b@ *`: ? b@ ""@b@ *`: = b@ ""@bD "bDb@"b@ *"D`""D*@aFX@Ab8 ""8``F@A"aaF`@A#!"Вcp@A"Вcp@AaF"Ԗ@A!FP@Ab#\b#`b#d!F#TXb@A""H"H`wbH0!F@A"",",`H *@ ,@ @*:`!F@Azb, "","H``\X@ `   !Fc\ X@AV%"H`cD@@ `   !FcD#@@A9aF@A1bH ""HaG@A"a@A!aF@Aa@Aa@A㿐F", ",`   ` `@  F",*`?2㿐㿠㿐F"("(  F  F@@Ð!D㿠rbegin # %s%02d%s.%s%02d.ANSquit w0 0 get WhitewhiteBlackblack%s%03dMy move is: %s %s level %d %d:%d %s post go White computer Black Human 1 eps %d # To move %s correct %s Castled White false Black false # ep TimeControl 0 Operator Time 0 White Clock %d Moves %d Black Clock %d Moves %d %c %c %d 10 10 10 %d 10 10 %d 10 10 10 10 10 10 10 10 abcdefgh move score depth nodes time flags capture color T    h    00<0H0T0`0l0x0000000000h     $ , 8 P T '=KU_j,  t<$ @,048<@DHL#HPP $,`4X:@ExLTU\T`ThXm$sL!{ X~ \ ` H0 lDx"ld( P8  0  h   $"*l2"8"d=#<C#@F#Dtestgencrti.svalues-Xa.ccrtstuff.c__do_global_ctors_auxforce_to_datatestgen.clibgcc2.ccrtstuff.c__do_global_ctors_auxforce_to_datacrtn.s__DTOR_LIST___startatoicolorF__CTOR_LIST__OisdigitRWbcijklpqrtoupper_environ_end_GLOBAL_OFFSET_TABLE_colortatexitexittolowersprintf_initcount.remfclose_DYNAMICcountxepsstrncmpmove_exitenvironbkbqfnfgetsisupper_edata_PROCEDURE_LINKAGE_TABLE_fopenin__do_global_dtorsnamer__CTOR_END___etext_lib_version__do_global_ctors__DTOR_END__main.div_finitimecfprintftimemnametimeswkwq d/dQ88F<@(#)SunOS 5.3 Generic September 1993as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 @(#)stdio.h 1.1 90/04/27 SMI@(#)strings.h 1.1 90/04/27 SMIGCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8ld: (SGU) SunOS/ELF (LK-1.4 (S/I))) dD'dD3<BdvԀ\zՀ@[wUW345&607;8F9Q>\Eil.$D.interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.ctors.dtors.rodata.got.dynamic.plt.data.bss.symtab.strtab.stab.index.comment.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.c/1093/on1093_ws/usr/src/lib/libc/port/gen/values-Xa.cXt ; V=2.0/opt/home/mwm/CHESS/gnuchess-4.0/test/CHESSTEST/usr/ccs/lib/values-Xa.olibgcc2.c/export/home/mwm/gcc-2.5.8/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19reg_class:T20=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T21=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,SFmode:11,DFmode:12,XFmode:13,TFmode:14,SCmode:15,DCmode:16,XCmode:17,TCmode:18,CQImode:19,CHImode:20,CSImode:21,CDImode:22,CTImode:23,COImode:24,BLKmode:25,CCmode:26,CC_NOOVmode:27,CCFPmode:28,CCFPEmode:29,MAX_MACHINE_MODE:30,;mode_class:T22=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T23=s8high:1,0,32;low:1,32,32;;DIunion:t24=u8s:23,0,64;ll:6,0,64;;func_ptr:t25=*26=f19__do_global_dtors:F19  hh    )  3 9X? E$$L,,S88[PP`TTi ntpyp&$HI&H &](< *4*+gnuchess-4.0.pl70/test/CHESSTEST/score100755 21542 13 23160 5554026027 16407 0ustar cracraftuserELF4"`4 (44@/usr/lib/ld.so.15A?21*+ ="5<.9,>;8@%3:/(#047-&6!$)'($ 0 8 @  L8 t0 +-/ 1d3t<AEIOe|lqXwt!LPx4 @  < & X+$  1x6__DTOR_LIST___startatoiI__CTOR_LIST__pqrs_environ_endovcovsfirst_GLOBAL_OFFSET_TABLE_atexitexit_init_DYNAMICprintf_exitenvironstrcmpfgets_edata_PROCEDURE_LINKAGE_TABLE_fopen__do_global_dtors__CTOR_END__strcpy_etext_lib_version__do_global_ctorssco__DTOR_END__main_finilastcntlibc.so.1t#|)*.4-170 @D# @AC#$@A@, @ t"@@A@A㿐C#4#4  C  C@A͐"P㿐'D'H H @CH@A"aCcP@Aa d@A "!a *`: . a "!a"!a *`:  a "!a "!a"! a *`:  a  "! a  "! a *`:  a  "! a  "! a* 쀢` ax@AN" ax@AI !a@AD`$ !a @A;`$ B `"   $C#DC#DB'Ccx @A ax@A `@ " `@ " a @@"`a@@"`# `"   $C#DC#DB'Ccx @@`@ " `@ "  "   $C#DC#DB'Cc`@@㿐C#8 #8`   ` `@  C#8*`?2㿐㿠㿐C#4#4  C  C@@\"P㿠r test right wrong total percent %9s %d %d %d %d total %d %d %d %d @Y?:  $ D Ll(x 00<0H0T0`0l0x000($ 0 8 @  L%;IQ[f|8 t0  dt|Xt!%,29LSYPxk4 x@  <  X$  xscorecrti.svalues-Xa.ccrtstuff.c__do_global_ctors_auxforce_to_datascore.clibgcc2.ccrtstuff.c__do_global_ctors_auxforce_to_datacrtn.s__DTOR_LIST___startatoiI__CTOR_LIST__pqrs_environ_endovcovsfirst_GLOBAL_OFFSET_TABLE_atexitexit_init_DYNAMICprintf_exitenvironstrcmpfgets_edata_PROCEDURE_LINKAGE_TABLE_fopen__do_global_dtors__CTOR_END__strcpy_etext_lib_version__do_global_ctorssco__DTOR_END__main_finilastcnt d/dQ88F<@(#)SunOS 5.3 Generic September 1993as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 @(#)stdio.h 1.1 90/04/27 SMIGCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.5.8ld: (SGU) SunOS/ELF (LK-1.4 (S/I))) dP'dP3<BdvԀ\zՀ@[wUW345&607;8F9Q>\Eil.$P.interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.ctors.dtors.rodata.got.dynamic.plt.data.bss.symtab.strtab.stab.index.comment.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.c/1093/on1093_ws/usr/src/lib/libc/port/gen/values-Xa.cXt ; V=2.0/opt/home/mwm/CHESS/gnuchess-4.0/test/CHESSTEST/usr/ccs/lib/values-Xa.olibgcc2.c/export/home/mwm/gcc-2.5.8/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19reg_class:T20=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T21=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,SFmode:11,DFmode:12,XFmode:13,TFmode:14,SCmode:15,DCmode:16,XCmode:17,TCmode:18,CQImode:19,CHImode:20,CSImode:21,CDImode:22,CTImode:23,COImode:24,BLKmode:25,CCmode:26,CC_NOOVmode:27,CCFPmode:28,CCFPEmode:29,MAX_MACHINE_MODE:30,;mode_class:T22=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T23=s8high:1,0,32;low:1,32,32;;DIunion:t24=u8s:23,0,64;ll:6,0,64;;func_ptr:t25=*26=f19__do_global_dtors:F19  D  )((l 389X?$$ E00L88S@@[`iLL nty&H >$ |gnuchess-4.0.pl70/test/CHESSTEST/SUN-LX100644 21542 13 730 5556416655 16231 0ustar cracraftuser test right wrong total percent bellin 7 26 33 21 ece3 718 1077 1795 40 finecomb 9 41 50 18 gelfer 77 250 327 24 hardmid 355 485 840 42 hortjan 52 81 133 39 jenoban 101 100 201 50 kcmdm 37 41 78 47 kotov 33 82 115 29 larsen1 82 18 100 82 larsen2 13 35 48 27 larsen3 25 38 63 40 openings 33 77 110 30 positional 44 110 154 29 reinfeld 634 242 876 72 sherev 15 45 60 25 speelman 61 106 167 37 winatchess 239 61 300 80 total 2535 2915 5450 47 gnuchess-4.0.pl70/test/gnutest.run100755 21542 13 2640 5527662452 16213 0ustar cracraftuser0 0 get /tmp/gnutest/1.bt level 1 15 white post go get /tmp/gnutest/2.bt level 1 15 white post go get /tmp/gnutest/3.bt level 1 15 white post go get /tmp/gnutest/4.bt level 1 15 white post go get /tmp/gnutest/5.bt level 1 15 white post go get /tmp/gnutest/6.bt level 1 15 black post go get /tmp/gnutest/7.bt level 1 15 black post go get /tmp/gnutest/8.bt level 1 15 white post go get /tmp/gnutest/9.bt level 1 15 black post go get /tmp/gnutest/10.bt level 1 15 white post go get /tmp/gnutest/11.bt level 1 15 black post go get /tmp/gnutest/12.bt level 1 15 white post go get /tmp/gnutest/13.bt level 1 15 white post go get /tmp/gnutest/14.bt level 1 15 white post go get /tmp/gnutest/15.bt level 1 15 white post go get /tmp/gnutest/16.bt level 1 15 black post go get /tmp/gnutest/17.bt level 1 15 white post go get /tmp/gnutest/18.bt level 1 15 white post go get /tmp/gnutest/19.bt level 1 15 black post go get /tmp/gnutest/20.bt level 1 15 white post go get /tmp/gnutest/21.bt level 1 15 white post go get /tmp/gnutest/22.bt level 1 15 white post go get /tmp/gnutest/23.bt level 1 15 white post go get /tmp/gnutest/24.bt level 1 15 white post go get /tmp/gnutest/25.bt level 1 15 black post go get /tmp/gnutest/26.bt level 1 15 white post go get /tmp/gnutest/27.bt level 1 15 white post go get /tmp/gnutest/28.bt level 1 15 white post go get /tmp/gnutest/29.bt level 1 15 white post go get /tmp/gnutest/30.bt level 1 15 white post go quit gnuchess-4.0.pl70/test/test.tar.z100644 21542 13 3527 5527662452 15735 0ustar cracraftuser d+]6_qF{Ө#1JZvήkLIda[MF>Àc,L3tӯ,``'2O&;6r0ص=hqFŵK O|x:=9d}O"l(r(_NGh?H|I1,oO]d_HQ+,Q^o_S.)N`t&0kz̻)#K 8tJnȾΝw JrY []Vz--h[ț"Y`D…gzJ>/A;Zڼ4*zȵ8ڜ=Ԏ:C6mzJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ? #include /* convert fen notation to gnu save format */ char b[8][8]; char fn[12],*color; int i, j, k, l; int r, c; int eps; char *p, *q; FILE *F, *O; int wq, wk, bq, bk; char in[128]; /* */ /* fen2gnu fen-file > outfile */ /* */ main(argc,argv) int argc; char *argv[]; { k = 1; F = fopen(argv[1], "r"); while (fgets(in, 128, F) != NULL) { if (strncmp("svfe", in, 4) == 0) { wq = wk = bq = bk = 10; for (i = 0; i < 8; i++) { for (j = 0; j < 8; j++) { b[i][j] = '.'; } } p = &in[5]; r = 0; c = 0; while (*p != ' ') { if (isdigit(*p)) { c += (*p - '0'); } else if (*p == '/') { r++; c = 0; } else { if(isupper(*p))*p = tolower(*p); else *p = toupper(*p); b[r][c] = *p; c++; } p++; } p++; if(*p == 'W') color = "White"; else color = "Black"; p += 2; if (*p == 'K') { wk = 0; p++; } if (*p == 'Q') { wq = 0; p++; } if (*p == 'k') { bk = 0; p++; } if (*p == 'q') { bq = 0; p++; } while (*p != ' ') p++; p++; q = p; while (*q != ' ') q++; *q = '\0'; if(*p == 'n')eps = -1; else eps = (*p -'a')*8 + *(p+1)-'0'; } else if (strncmp("srch", in, 4) == 0) { sprintf(fn, "bk%03d", k); k++; O = fopen(fn, "w"); fprintf(O, "White computer Black Human 1 eps %d # To move %s correct move %sCastled White false Black false # ep %s\nTimeControl 0 Operator Time 0\nWhite Clock 0000 Moves 0\nBlack Clock 0000 Moves 0\n\n", eps,color,&in[5], p); for (r = 0; r < 8; r++) { fprintf(O, "%c ", '0' + r); for (c = 0; c < 8; c++) { fprintf(O, "%c", b[r][c]); } if (r == 0) fprintf(O, " %d 10 10 10 %d 10 10 %d\n", bq, ((bq + bk) > 10) ? 10 : 0, bk); else if (r == 7) fprintf(O, " %d 10 10 10 %d 10 10 %d\n", wq, ((wq + wk) > 10) ? 10 : 0, wk); else fprintf(O, " 10 10 10 10 10 10 10 10\n"); } fprintf(O, " abcdefgh\n\nmove score depth nodes time flags capture color\n"); fclose(O); } } } gnuchess-4.0.pl70/test/gnutest.tar.z100644 21542 13 5527 5527662452 16451 0ustar cracraftusera+msbI.xdZ6UB3m $$\w>Nn- uW#m,Oŧmg;m:˩n Y^hUD m{+ǁ=®G^;!q_Ժ>?'!?*I+zj.{.&< w'&;6E͎œyQr[4ϳ[|`SG1ƿc7])OzSf@B7YN^ؿw;uQUtX[vMפVl pcݱ&=6ZѼjٺ]OGNb^&cqEQsӔS3 m-u>c6mvqW7u.O]&<+vS7Uq(ܭ~$OYOWP~|so $7w87s * |4JD_Y>y:bW l{ [_"?Y_>5qrcz~2]Hf#]< ~GLtOм/)\%J^埋)^5J-dyn@g8M+ZMM Y;$i1L?<63 iUvquT'|}=Vp57 k \]%EKBĺՒy `ϚaEE!DDHoQe7+zЅdEت"Uo@S,aFD!e\)?9:.S֡)S/?: D7DrEDT./d?RTOG6T頋De-0 Ϻ?Wύ|$/־RՆd!S(K)3H_B_ekKj`_fɑH0W=jKӅYh@L>!g1w/s(\u7Zes/m?3?fWl"G|fr3'I'X ץ7Bяu_$}˪ya~WĤ!)6 ~Q.,gO&?˭4Å]CnWzP,E@W*@f3cԭȃIʼP'yp_feo ץ9oPP*D5G?W](%I=1iX_3_ U"Gr/yO:?!WJ_QɏDPq~ Ѯ([ocx)|˿ EmS;h?Q~ pʥ/҈du)@/jM~Oo?" yO9_m?bwLo ?ϥ0 eId_ Dk~(Ϙ`\6sٴ?Q;rnm@7vf}hp! ht7 !Pzô-pp|hpl:ݎ9켝ipaPA$mGv9vQt= ]w`o:'"XNuWuM۠7v7 a;ȝ}qoau{K O.KgĈ/'m+}~1kƿ3o*я7_7M3n?SgLtb>;'M;gnuchess-4.0.pl70/test/SAN-testsuite.tar.z100644 21542 13 353370 5527662453 17473 0ustar cracraftuserP-MH%:Hg5 iV"(fFKWsBcHKJݟXF|G]޵,ʹGGEK5R8o?/k7ޚƇ .v{kyǿ_.~x߿?ooݔ:504NӟϿ}_~_?۟ǟ_Ͽ}?%??|{]+o-oK27\Oo><߾sּuosk\Y޼{/k?}}s7ms{m{[x}}&w?4oHJ??v/hͿ5-mNOMҪs/|\3{XuMayMimr׻KO;SzὛ?>O".-lmZ}{㻟셻ϮwCv?.|woi7zm+~i~!΃7ۗq6g|H[LW8_UVO壱 w{zS) q*Aӓh0;нސl;2up+8uOs6:t&>9ŏ8}r*=FsӶ~%W8GNXtmyv) =W`:=N[đG->=Z߭K#]"|>9/SgQ,@*} 3OHՇK jSiYnWM'\inEojs|=+h[|{~) w@ŏ>ݓ#rjqWy8nt6H_>5dPaG}9tM]7ut\޷#{t9|)P 56'Ma!]wX*c=S\1, 3}1NO*}1?1xBr(غ{Eu).o?q_KJ ~_z_/x /]~׷o_??_?eϿoi]w9O#҉$m߿?~|_޾?ׯ)׿'{Jgַo_OFO)O]e?39,]W"~K/^%zJÅ97ޔR!/RCyp{egjR9DφݺDتت6ԕRvWWkc0Zgy*^`s^"kuvjo SKl-uKc\7dk/_֩pVk5ҁuȪ/*9rKD)Iޔʁ/8#K^|rK-n}Zt9UuZd[mi{sDʑwz!mI%N;=,MQڭ'mywr|t׏oZ\WZmWISZ^adEX+˕w3\J?_Ziljѧʗ^"p)bxq~:WT0sq O'_NV>RqqWr}*MY*օ,v];,_NoB.k`'_NﳕtAL=-kLߨdB9>_^ևc'JWT/W]aLZƁZKFK%G_QbSxrCt<يbjn:t9?b!2t趰'eFXj?ib[ _yb9˱+Ym=V9y]/-U}<pQbS}'r7̀rST>9&TaXqI5>,jXԴm5773TTN|>ҼTw7};)罉Ǖ8gT6irܛ MqS~nW8ͥ.|oO)/gyȚR9ЮB-krқH+}E81i-9?ެF;Jm=dI4e}V-}NEap[cfZ% 2^\k ;yUmƷ+g +$/IYTyK۽u=[rb.0?lokNuBIA\irV~Ǘ+K v_O8i~@S'ퟺPZ>QzzK6@pf]=uK"\iI#E+W`r fHrܻl)~/9dUN|W1O)R)Rtwq8gtv ?[\N~'E,~͚q:j/DlbT x K5$s$=u8m)Z\XA}gBͶdQ[tWǣy0h,yI[ c6Ϊfk%>guSg0 AUfcVLJnsйJp)&p3=3kN~wf?7=T#87rEVj%ڵ[+8BfȤ.8Of*buZOi`dbaK_3E )`F~)6p60t6ff] \jDkkU4J`;?}hp/p') תn`!?j-w*?뜯&78rDbד%Jfsm+\a/wX9\=n^A]Eb/LM$ 7ѮV W/.lc*h9+ R}*Cr|= Nߛ+7x;UW3=ڕ"MЙ@q9yb==}aP~ ;* )h `07H`O:gಅߋuLDnX_i 0{:/&OJ ֬jޮhTM =367tsCh{XLt-?!z~֥d';@;Md. ҺG9M|ּt*Nii!ᶍ[Z Yy5#E?WZwLSwn(ZcC4L+rTauVZg9sLk-+"N nGAƒmѧ%q6/W. :AgK[JsQ['{NՌr ˩ǿGe06@F8u5L)Q]2b:l|ʩ]p]QFtc }W UׅH .?| 1l< P2rFљuYj{hi؅ěnلrQ⋱0O=R]*q1;V;^$gv߸*+ ]%euTUu}+ }P7xŎ*G?n/:o庂}Kv"Sfl\+q kfu,5W\Wo֓ރ߲q,wxDʌ"NpeRg\M_u/P-U)nVI\Eu]A]J!]˪+XA? ŋU+(<(3]vw*fHAr)4yZ 0%mOgW50Vɭs8+8#̇c0M㲫Xk :7LT޵ ԛU#_+뎐27d4j\cB.b́w; .ȯd暗U6fPۓ +f3`8 q(Ff馾* [lxs8U(`=RQ v#NbCϠz6 |vr̈́ě꽫+H5>I'4Wa׹x,0o3Td8/ٹ)L>_XXveN-,96*6 rZN068cmxrv:Uo.ׄ Wa}(‹{o2h Zid'~`!T_Cƞ.tWmq3*95Ԑ 7qV؝?t$mmM?WŇ]qMɪg]g`vpvmevhņP%T%é?z{TtZVn(X@a"Wӈ+: lMԏLdnpdͺEZ]%ý9eߺ<]. &-\'s0͔}ݥFSUҸ?G_n+nܘy `|ٓ;[{ >s!}ë/h`x)Kԫ*>lNz]ޮ {: lvF+b?=s% +WK{O'Jekw)*OJqѼ˶}~ 's|POưQ?3,- j| >,a?WrĮ@f^f/;']VhZJF)A/5oB?a{*­}46u2-k^:]įhsJiX^]|Gv\(0οi kAkR/ȹVQкp_‚ a" x]O_uꃴo?kTXٻ*KŤ&562r]Qhը(]rV(mYbEHS-L ;"}d}xk\p2Daz6Lt4+c0Pzҹ:ɵ*y[邪=ˣ/|r[yE#yϡtRB+&mW:P\>4U6H)ԓ=4N懻V.5(,_sD7b ٟj+/qCJ0ZЂ`gDio('}Flrl崇n#63BF |*ߴP]jRai(LHHZ0S Y[>]L}xhSWbP8&B!OnV:xSeI +L0>_Y@gU+N[>]OAm! C'A>0!IF\>c'jDbxl[1#i۲Q# (Iۨ;B}E}aBq<x.=sSNAC|6ۗB ZOWWڋ#IfP_|KG5X <,OF8?V2f[b EnfJQal$oʼn0\"y$Rql_\s0qde4^/rF"پ[6뷢3(lM. aj&NS@Ae+ +%ˏ$ 2yם E`4 )}xj c|/cFGx]+%JC!YU;ҊF+ &bPēKVcоپ}3VLkrw Bھ}%`d%bmr&ZÑFĀ m56oWpM<}LBQ^ɱhUԬB}{q !ϣ|y*텇 |c!՛*/Dа?DTy|_]59Rb6_lf(E}xk2~P>MCrg˩#NIȶ/d'$wNhr VzjC[r("jPm_OQtoDy* JVv|E +ʕp,h1}l,Ds09|hFA%}~>ٛmo ]P({a 3Б yUl YF=4uJ\S+wk4:^QI +X]G.(X$)7.̨9(wo!A#V sllT‹PYp,yVAPQئ82 4!g"9v[8Gܹ6٦jt?]8G|E iZ5A35oM­~:+T+xHo+fil5= sE UZ_JQ*aj/A>XӀt@נlYPp߄KGt8> 9ha?*=t/AİO@oDbU [D>9pK}^ }TR(QJS ؅Ê5R vwr9fk)e"|{4wlЗ:dd KelQb ~5HycG-1*H<.p仐#i&rs-6|HHB'7fVHqEFFiAb=r!dm_5 W%CťڿFSUvg@ۡ@qG &VӚ:nn etj^1P@ִbZhAkj!Aɟܸq F䥞PpҭMo>og}+]zAJmTrY&h\vR'\HؐKX?tC-)ee!\ 27 0bƍR1pcޠ=$ItjLt]Xx8HVb"vɔzSuㆡ7FΞ4g.PtlGmZ;B)Q>5vFAv3=yX7V  G0QA'%* =TVNǓH1]8пH(+h bnxvZB=է5Zi}VV]^\GY x}YNjyC{Ц|0~ڬwxRw'%nHN#ev^'$vTϔot"l|ޫ.8V=6N׹ ݰ]YcqՔDTE&E{=so?q;mH \P| nA\TN2; bH#bBZ+caJiUЇ5k@|(pX54O;WĊ҇## t0tjvurYu+r[:@cwVk [H}($*Nq4=lXMEC'4k=nj ·BJ 1?bIf2 LŪU?vV\:Wfh htD/5:HH-f~hVrwKp֗s|(8XJL+Xa :4B+&.q̠=ZI O|@FTYFQPxzrӭ2"XqPHRFSRZ뭇 PQkF/\sf]x EP v}:{SRԮ@E({y%,ZukɅYGKc#UD$+^A?cܣ#XrZU>1x SAdbwZ+V=Ǒ`A X8,B`ȾX>hwX Ŗ.+jMX8"Wf=y1pq!QgkZՠ2ΨXi(è DbﱱZ-e pDS ,5͋2)h~cjBwtsmKFX(өm׆ U{;ZQ{Ϣ Y_92ZhH2=Gķ>r'N[|QM'3vP E7A6="Q朜N)^㥮;bEql:7mH>iD+ GrCO|:몃﫽nhy,tfFݏj+x}Uo5;;Vf8!+iIC-WضBdp0v?> 4(+foW5܌;bcx2Q?!|C'4X(|a/U+GG4|'ѼX!(,ڡc?[j`@q{jZ>*0nt_KŊB-Lڰ B)(U%ү2qLMmLWC ҨuV<ƃt4n)ـtcowoz[k:U;'l#!X*NJvGi'')5:Q<ݱ:!)yn'0uj bcl𲬪pEc|xu\ fc9 Ċnx(v("Č赠Qܨv)|6*yiaN-?c=1tx;\|{( ;Э6LlVP;fB-c?U@; ͠~]I70, V4;6;fwJ*dȎ^Ã'.ոml+p<=E 54GVq EA3^}EV:6j jρu*R~%S%\:UAڻjT$UD(U:BGWXLT[ThzZ7BLLS邺gN/X-?nh5W' N6,M_C[vMD05 Xi0sWJ ~-{/Ǧ˱N\yZ5[uʐr8VJ-ͮW,9v+t[i| ):w%G0H1ʱ0 h(#ޚo[NMŕڮ3i=9MŖcw-f`&p9^4rwuBmsKU8Ycq0vT9*j6b8H5M4\,g|(,/axVc._"}t=<"oZWnbα`vǢ&g}Ze^3:n%=Mt3VP 's`oEk4GDfPU: zT0:^*hh Z{U<:@}ap 3VV!3O`[+/[8޿WPFii.+=f#NtӓlMCH;ghX/{˹KFs/.w=Nf<[cT9}_PHGoT9Iٙpی2XEZus?i^ TTkh񚡮v'p/`6z+MŨӡ6v7DW R7G,qЄ/cCFN R7%tE5c,WMA40g*>O0(UK(xr8G{@xBMAPШlV#hh$4nzɿ7|Q7" e7"B# gwHFEٍHIO[5nCAҾ7i Ȉ*݈A[Vtm̑F-\!F|F2q"-I&Te?:EJ978cMEpm( NzE3wCe28`Ozj>EY)4qB=v0xS~qEtYzoC8l7&%F2k,qJ+2ވYi*=u XO1,}@y#\9''`bQ? -77KY:hy#TlSklծb0p3fF$ed5o"i<Ԫ1M=n*p=i5RCjz5o ?4.y"n[1b5`4swR§_h\naH7zٍOjR(v\=&)Зxj*"/%K2<*Z'bh tY}=TvxEzEW; !ce+4Cnh0o=ϰCS&#d9ҍSzU9~ 6Fo9~ Y3=M+Y>Y. XF~1 7 2nSi^M*/DIoϜv:{f4HoG2ެhC.1x1fVٶBQznKDa~81,6mmϘJGcdnmԛXEܛjs-R>m֛ ?q6ErlVhY[=%h%tdNVp)h=#xx+m)`g#,5BM#ۍ5o@fT]mٛRz8alR0"]>i+vb`BvSP\+(j̨mEܛpP3e>1YD5'{sGqogm\KZ5{ClCFaCoxpBa |`*SpC[aq%r:솩4h(P|Ӊ:!EPSf7f4o OrHa( ,4(Y0֮6%< ;b/Tu1fo XGiBZyz̢/6o0e<+ĪM!4U+,2F]G/XM#;RTcMdnZԱ, V@)> 6 ylNnۊ7GLS*Cq>|[3|KW.шQ[wk-6E YmGԲOmi-<8t4po ;N'6 }ƋWÑqr"5>VпnxSRIrTw#n`h<Ī!UdrvJnTtJh d 2E>NWb/Jh  =CtC.ÂCHJ h.o}SG]kN $eV~@sПvdhh CZAj0@3dž;1W18LY4m-/k;֫ղh[o0kHxckVXOF~b9ՑrˠKJ!h 6"'&ؘ *=pwc8%HE}>btrŌ BKn. :|ܲ^`(r9~LXCE[){3Uڒ<<*smHzF::VXvy/uO 2.v1⍵Azť4e aٕ&ځ[|V5XywhT=4Q92}? zPi[iW4r?v8~6 hen* W/ ڣ$mՌW%"-@\BglhSTjn>u[I?7]h܍3*+!Eipr,|YV~C_(:V,cҊE Q`Qz@o_t9o[1a7,eQ!Vl=p;:IS|`jpz @ TmY-sFma1雧'H*|8qY `f Zh+z߆棿LÞ*m֣Uc(L<\ ݥZ5)`=\gIh 4R۠#30ۧ܂@?˨1ed9=ӗ;zk[)H}ZmjωQl8}{vPwo(U=*,Zf~rbx\.I4b٠o!̪ ثVBm|Wex[^ zoȤzK(To̷g(M)hyABڊʷQ4FN2S1ɦU/fRV#b(,Ŵ T4-܈b9v32vZ@!F*9k/T1V8W-jQM ̠mSB=9:?3 )L' M/V aa ٶbmAGs|C35磫h{(6q,7NkWQPHhy3tUpmJ @e=9 ]]z+td#7Zuqz[p 1KW=j~Yj z[H$/x{ZlNw6#b-wv9o+Ź% 򪶭uW!󶭾T9@#Ff$IӆE+J&o{F$Z:o*22ro*83JWp΂Rӣ)U0BwOwT5!+]&#hl1vN-->^@4 쇸Uz U-T]˓jUUк-$*'un GAJP=Zu[ R`NZO' ZPQTl R#`*-m*;/RڑXU.| ɢ3nM͞F#Z5B"y[۳fu"_GlUm̺zV+|^9o)xjgRaP?+H_:sU(Ynz| yʧY]E~"Ҝڮ][aQkWsr}T-x(Z4rR߇:rW}@}.h_AW`;Ec=E`-wկRHWӡϸ GW殊2*Iny2w20͝=&$8U@M{/ 6w(oRG36V`-ibZrΚ}q;w urRH%~GijPWN~TP)ʾ9[F`wrXl@qVĹ;bt1]tA*Uؿw)Of^k{sWq}Mƫ9\ėL]ς)#S ?]Q-eIj1d3#\q简~ Le=9s'qP)1ٸ*!лYs]Pg`ئ-P W8OʽZNlm-291z 1V}~x@mF cjx@-d+ Aʹ2U~ sPf?Gj-\PS ߕ^wʓ'0ky+&*9ht\ /]cyx%@ҁa d6o\!msEû"cdo\~3"ݫ!ȿ{OrDtdSQ=0$`P5G\N ˺99kӨ`xw/>n/nd[o[MUH֓Y,GW+ ޝ5jKبA1{R7LQYnH|zjGF/~vl wC}-Ρ<؍14Թ]]aLK_ ]7GhgyF;us;a`CCSwQ8P*'Ch4Ud+,Gpg mc3+2@{kIo >.@zxwy )2=?K6s;8<Ues&zdW&@1-yF7[F]7.qYgbI]2 ECfqU3ss /r贼-ݮ  ȥf&ӪEG!?2]jY>۫r U8{s>Wp|z Cٕ+犏Oݣ#貼3ip76uGsNJA*M]Pns$y0is8Yzi#<Ÿ#AυJ}LFSp.? ΍,&\!s!?bEχaZ;*B}r(0zR&V{Tq;79 db]C%ʙsJݎů0')ҭIHm#a$52W{ zGhqhwq3l3KpD(1(3*;W$Z5VoaMK%Jw+~.@Aб)xKbƲd! ,ٔYE`/~Y`|BP.grb0]?|6*7'$ }rBcFv5J;  rN;9Њ\ U,T>n=>9zO{#X-xUzй)7EVz8WɄQl5 UW gY)sՓZ*,CZsa> f5CEI#Pမ {C[}X5@Ֆdԁے-5DrubM*oӍCC,cima? ..| V?d FgZӊI"(aBZ86uy:W,|[:Ok>E8tkT Z^" e+/_Apז4׼sD(·AD П;W@as*>>voCr$ ^|:W,#A*\Ť?2B fK6ћV}+>nU?Вl~XWl,d=EOGf͡B)&C&Rss"s#(f9=Rss,Q wQ;h.?*M [hfhRsa#2JOnf2!U(t.VzbCo}eZjM=_@T/ tY{G.2VhuTY) [ hAӟ;~@ 6,CYRsA VGT/?wsC6 Qxf`5! rװ1 `KRs1U..ȰP`JK/?f~ENÆ1(#:k /?wq߽:#Oj0RP̥'{*.d!tBfzk;`\BOeŢՂF "#auB+7JkZ@"0dAx"$Xəa=?i~è>cZ T,܁0DȰ'SY6f΃H03Z -ߡ# χ,ST>[T#eA )^q)ƹTY({U`|} ^]*,4(e븅Z=&pix;5x  WǙa'OTV Jw.au#K%/-N\17rY8_6EJZ+S /;UvJDS/]-p>5:\/8y X6U /w: S̙v2ş[V8pyZH$Ͱ1 L(lʗ!*g{O9* 5rTK&0l94;sOLJ\*r:hGsq=-l>݁i af6Br\D-ii2 uˉ::6RB^if!ҘxFAΓ^<}]qͭ<ٜ7kP+j{+{2k-`h\*"\P\ݖ\S&Џob_`JMJ1Ke\ ۛPsn*Ƃժʀ;S"=9+IO+R YfԾ=g0/]H \Iªtjgz(M+r1KqxS%BC7}UE P,&'׻T=fA}itR3IBd-&*PڨTzo(5]` ͛i+C%\XA.q6@f]Bi@X[[^0J@C)G88-0ڨ T¥(;7,EıazFw4L pDi1~JEj :5S(ǡA;IUdL.p)є&{N>Q4q+"Nq6^(_`ggv[M@$'?CfCb\]4֭廇cETyl.0fXto [ dP.2 Yk2:3 1L#p4Ksq4| m̩ᰍ2.ut|8UkGŹ:4*hK匯;UhF{@0dotдd5B=X!A[G)XMpg#7MvRhI&40f<|4UOKVc)?:BG31U媱1v)o|4[ G֬ЬY"6œpZ؀7>ESƴfBB$3G̨mr9:OǮ"9o)oVe/ K)V;U&¥0R\1hfQdA`"S֘3a膪VSnܬ\K J4\W*ivmTFP:Ї2.̚XS괘zmz( y޸zӂՈ@]n;֫&tT':@ c+~S$^5'ȯk4sp--V {hq6sibRS!\ 'Z` z&EYڳp-zy@ijB?de j0掦M|3GGcĦqB*RXn_7G2rœWW\ `I\;|VzRRijjXc5r(gp9 *+ P%Ժƭ\9GIpЖZ qW%\Fq<ؗs"-X HM\l5BCZEFURaL'cTF0 ,r@N@jc?p+r>?~(Ki,ZϪ!4 N]DqtҬ< yR6e4rEZP*uI3m#6R0qM9 hkz<( <4 ƹV:ij$N@$g"ӂgYT Uf3r07 %(zUqkJ#vHMtw?ŢX~Q}oUC]W[ҪNV=&0-ocT'iU/>p3kՁV7ԡak0|Կnh>b F2ip(\>d}rb]YӭaiPD_#&Vf71\>K _5b^B]q-@CsCԊypZ Gr,ggXWHE7XpiP]܊}v(lP:*Nf*xu#~hQkż7%,~G}idX#`1whj@] ZΧZ11E t/pchtZ<7-/V̍D6' H34SFœOk^z'=SR{gi(:bv(Z̥{sZ;uby!_KUh1*'n(QWp׬rfb+ٱ!1*6-*I,q&f͉0NL,p{ qG7Ry=3-,&'䂰޶m ?#Hi (k/ vόױp@%Xp -xta$'bDRǬE/ޔg׭i5Qq:Q0Vb܃1P(Œ2"g mR8z7HRO9vW2tt? ɔ)bn Y"B3 R2NP)tfQ + "6j~%أ^A^edX . i.iDY S(], uӍ xρࣴAa,`3zDzq91d@휀riX\C9(g:2<[_K v %)&&ɤ#`sn b1=n yxl1t i <*d'88Ǫ!D'݃):O܄ *3n M6G#R;=:$"FQh<ۅX~Ea8$s*w3_ 4Ր0XN΅GnSyctK8a 8?S`&3kYNo\'W'9ntb!bz#Wx ^T(c{zNsYD0YM1][1QOw'pcN| G#Bk6"ÇQs/JtKj~9w#+=7흘I ɳ`Y7[mo/p0JEpbEɩ{2?F+eb\PͶJ.O~A3-)V#LdDn(tnOd؏o>[E5$H"9 ՁN6}@{JrSAPӇ_xE|(ϸ n s?JsAb 9$ >mIBp@R:W\5PE U M.6wcA1$2`'@S/z%* s3s;Go\HKM3{3rᢴN80ZYmYD +•߄0"D=,Reҿ u H@JNMd,+ĆX6f` t,OF1VG̗W%iQ#;o0 %i4D;V7nE<:3k #. su[-W8LI+娗&t} }KR~Kkk~iMqH6)eO }J <:P;YU&< MGګy!H( O6R(+^NH 5 `ަOA^8!N.]8N\gw+"'(~;^I0↓cQ1yɜQ=;N6VHN\59-/ 7\b1If;BpͱbcH8XF(zpC[wI0VhH^y\_kc}B"TáwWZEd==KSqy/!nzM 2MS,@͑4 Xj-H\ iLa̕a] S Pn؈ 7irB>d:3p0qr(Mac'F-KVC БR+zf!<;oNC5MN83J3xF2z&G z 0g>It mBpO*pUR7Hr%OP` V"ub,(VuI-v㾖J5ERxs}ZWBpuxR2Y֍/ X]Oh ; _(<H-nm. {!Yz!4U>44T+ [X8N":]lyBYaju?>l0\*0|L6ۭB]!(Q3}Ps'ȿ+ -gZb@cbST Z~O .-y ݁Hv18wg3{#* kqzsxlD$`. q,Dݬ)^WkK7(pZu&ؿ+L}O36:y0O_43p>,cwY0= mZDce^:f3]Q36ӏ(ؿ/[S+ON0~1> F0 ny??0vxp8+^z^B\'F+/\XWBclfh-*c \>ޤmɹ֜/")FLw9jI1wX ,L(6qxn戓4F^xoBX [,ع]~Ue+_h H BǼfd/tyMz/SK&/-p:5Jr_@jsD PRWc~ UH$'PA@[2!NnZQvD!K*ĩٛ = 9q:ܻcbB8x,v3gk0 g=+E9BҺBNiFg$wIϓg2E{\ȘKLNj4y#{ 7',/L"&QHtkX-6F"Ƒp4lVj&oǛ#&KZ n(FѨ ʹЍ膾:M׈[Ӕă2Zl2 nK$!ҍߖ{u6c|g1 Q`H<ˎA.M2!.7_&綵-5GX=s1^)舛djFZUF <g u) w%L : :@Cn Y 굡2]SƊ[FByT[j~~s"Ƨ-*34Fy |xh(= q&j&oMیj%&^>JI ]V5{ ߠᥕ΄@[M@RZW@ r7RRP*dT&8oS4X3kvׇ]δYLR96i7uk^}Iub)V P}N_FMI']Bbn݋ k5c1\ $H c _ ̑TxU2ȃ|s֍'ͼ @\^ # _L~`! Bo`8=ɬ0.BdHmB"|:L7!F<7Aug CTtB2{] VթFڂ)_Z3 /DY<&7)eJuA0bbc=C{ʧc-}aBw( ˆ3FfKCo5  0I睃E2P_/" 4h k!E^OY H b\gzC. th8Gzø<{3t=GM8DWG"\ zl(pȸZm^qZ~UC8ws0#] +&7F Aqpcx vXFx6/LZ"bV4UxWȝbJOaP0 (,yf> +htvR̥SуCTm4E,`7B3G 0 d`q#)$+BtoomƱ* ?kE*@NWM 42Sg5 hِYհ4?0^fpP0 >i ֝# G,R)wi,rA B7 g9u<[bMҖNȂ +P?HB%㿳'fS%!սtZ,p#/?҅4RWʎu `M)]\Es\( ./)"Z"?b8A>1cv^Ը/5v~ /?Lw5 D) &hGx5f\ |xȵQ9){i6g֕cHW&MX cot P%*yH.͂k=9)P0|a*U""fq65  dp:kec 8)ZzR'܅P dB([` T`dPqA!F @^,H A GW.Ɗ5^4.>cc25A t(-SJ6ޖ灹-[`S w0ІB(H`Q!68a2AB!/tpmwVYp)ZX3.]p}dJfKԂ=>{!im7&|#J*}g];60a װeP:o]FGnC3)䉦QOr߱ni !t!yvrC*?u&zVIJ},*]ۭ^yNK6Cڼ@xHm6iTB3KBe~W;_΄ ܍m٤ xD>J Nrk^X ! .N 20Knw\YMr"4PF keN^d[[K:Bn@\g|oMh9ֵ.܆lmEL hk:lWh xMqIxOH AH <)VX&|LjPDhJOjӘƴY6JAh !J{K&mjHu۸9™a i҄aBlGbCzVPq XU/a5jiZX@4͚e Ha <ɯ 'Y-Vug8g\a jQ 3JSЍ&yiq(P 1$:nvCth4dKQ א[-']9T^: }!4&כnĆ\[|I4 {!pxJA[z-+B] "Ue``(7(pAs"HE ƷL"n)S40 }!2q,)b-Zy@2KV%P7$ߌN(|P ZJ.*%BSMM#ZŎ5"^>B!'d$E 4 R>BLv!J½SFҡɮQ 0ӏD[ORut 0eG- !"e ^LAY_QHϖ~V&EEQxt OM "-j2^ ?$P5Olx(P8w㣒c_\~!bAhbf .,ecּTy &=K@,p(1Y]B@B@RdI}عҩ1B! !4M"W8 !)BJ]B !tuJʨu.EP؋61B%,Ypl*C6?ecsBa'զ;)n2\~kLQX H!' ,FW̫;Plߒ\3 *dfhsCl<n%}&\w+D~~>o16:1s֊906 "~Bj4KeJ/񾶷\HJJtY$ "\c '{5-85fwfDC!"F=Q9sXkδ^XLrJNy"Лn[cbmZD(2¡ 4x+H2bvJvNqS/?|B$0+4 (sT$%B%K@d~HԮ3f9PQ%nIc`mwWK ָ4S,mڠãxid{m# D,JPjDb.,ᯅA8opMs͉cSrPO:"( lKfм0*I.ܣɜRV^; FqVE, z6^fţrGU«,e#fE 4hBoJ@E1ǥhѴ[ODLҝ^$¯PNmLB;jV%1 HݭyHz|$ iO±2f$;y6;P,q,- S:c٨ #E:)uoZ5 " 2$ )HID#&#x6UEtrm4 S[&hpd޵nYDэH&3;oA;}u9\qԘTEtF5Kr3[s>³2o7ȋOmY\fE, f#F3bܒqHid5Bw/,_) ( F;£00?И6Gmn[ұ4yVQͱ_Fq Vj>CBɈMMͺ)/4*~zRԍQQ ̍^7X7%-|ښQ3f䄛n<_b yaXmza1944Ǔ#]Oӓ=@FhD_@p:h;Tܨ1l0ߵHF,$ RGpnŁpt٘Bh17P6TI$iK _# m13J)s# Da 9Dp70;9eBzn=$)4FucSEo뇛'NajeJP:btд51[ޑ{LJP%=>]XH؛\%\(Kے94Hir#|G,xqaMZZ}Oᩄ ɍlħXЁZ vs&GaDzQ%e݉4bzVG c kObp@qՙ0QK3~5yYPAbp1e3(Q4/1NQh!1\&E#PH8#Oy2\ 5$u.lj؆ko(Pz3(cUDwvcc<ԊdGӭBba0 r_`J,,x ZB D@C$gm_W#Y# ':NQBzF:=^(1bI  IyG45kDX6l3ȃФFx-=ܗ42>&s0L#Ė>*zfM)l.[ZKltKPH@.g;bK[QR|0&q :ѱ#xT q؍+V{:@US(-RZՓ& 9Ti F(-PZR) UD(-A!7SɆ"E% 6K#L+ԝLFvQŔ ]rBNʘUUs4K"b%7tqU:0 +L-0ZSM`QCs (#%:*d#CThF-N _@7֜q)%ZT!]hE6mL(!(\6ngnY\~`qZUɨ[b!X"rjFX-ZGM8-G]l2=2Zf* 4BkdC;& YBnBq)F%W.a:d'?kbliuҗ+nKn 5/KLכ5Doer;.HLy~fgA$Z@4#(pXbᰠ4t ut,)x$% 꿤LO'f6 &x /Np+?Tc!w% S$ ӄEw4]I۶#XQW &:Vʹio HSTH0W3n F)s)z*,[ķXGX+Q%Htn,|?O kz&!ݠܩܾ m)\r";}r scm F+M᯴,9xji$ 0Xx \ߠFfma<KƿHH T F*0= kxB.<^ކ`M(+Mb숪/T[iNҎRA|M٨s93!)* o)f@ؐj5o9HdTr'MR J::b aEHO%F+)柘$6nXѪ{+F8,gq'gSzܝnv3o1Ja4A] 8U~of P4gi\ZҸ)c6sGa4 [ T!D4MF5"a4UB6zO4mk mYu )m|n6}g2ja KSx.7 ᜠ`JK >qNx[.Ma8$wQ$` KS.ԩt)S "}hF.MCM&:̬ܔ'a7iD#P^ps,kN=Hۗюۥ)l hMitQd{+fX.~@R-RMaC#L0]h~hS/Yߘa쫘 ͞Xx:bF{q ť)L[{Ǹ5 FI-a R[V:8s/#(Ѣjg/@Y e,;1tc]1h`!|o#͂Z{W4?2 -Dړ0*}`&̽1H0@w>X,Y|۲cۧ=XW)NBNĄF32nj!4BboVCf)  06$6QKd ԓ4²`ohG \~ iPZBi%TqT6'\p͜|`= `91QdF$4&0d6}?!Aa!ME^Bx w>1 0165&f#)x!醸5eL//Kkp-ӧQ72z T-F9O8-MX]C6a4B9=%O,g\1 <)`AݮctXaeNf7w<CTGK#$2 8E+9N(zV8,MᰤӇR(JO9kAkB]i up@ hP/ Œ\iK6[1q!OMC)ʣvV ⧉{.#;ګ'UglOsHy Q yV8+̟#O Vx*MsPmHó?t5R쨐SRLY~Jxkkj xNb4".fdK^JO3<hA(a6"nYVx'da-rCﭩTV8&M{{2 IY+V%M! #j+!.|bJ0 y i)Ly̵%t+ܑrGH|Q(ЭI[qmBiڇ1YlEʼniIF HS8"Lg3_(#Bi#ئ8'˪}O(t949yԭQڌ\]*0 vAKtNZ4GM"m@i+d== ,[Ѩ#P0B؋GbG 3?K7]^dG*c:`4h휥@8zS>0B' fDr1[P3A@a. S2H[ 3Jtp@fhҺ>-a+A=:nf9!Gym mٰm"o  =`5߰Ɓ`Vx m fy#ufaظ@Z9ij\5R;l{Bi v1,)MB}F( m/yR'Q;ı: ?* Itzct7y> ˝ǗCKZ;G+:'<-0&:j׍P>Z+lHKSӖ'DŽъ 3Τ?rG%Faބ5NLsO@r }V`/!~O4-yZw٪F'ԏV >EKԸG5z,܎?M8iP@B ;sK. 4dܠSi ) @yEK@҆CڌMsL{lGEYW [B[a~AeX*S;xP}цP+54"+NG+b%(xa Vm8`;ZZz c>G{$Am T>ٟ(FT8mDz F[w"Sm4dC C- [{v"2#JF[(yh JhB'(:v}fCX&[Bh ޝ!07҈n "vHXJc = 4Lx,O q).ڇ3Rl< ݎƝ)6>XL£39xGο,  1H>ݻ2Z- 5%DMkb'䋶/R ܀3]i,V=> ;^"BCf<:Es %ΜCg:h6ˆ,hVسt' =wBhCˑsjv~ֶX.IB!v#H׷QA.GrHD>YSg.»hsĵEt-2ے!;*܋cͩhD&e0/@l3/䂦/h_ l(s1jP@'ԋ@qmQ*tNYtaBh\Ic}iةz^]섊VRtq,aƚo:)(1*-SUI8qe(~NmK搳w#8Ѿ),Y̚ZjA:hAdZ}ƒ =E7p5ڶ^%$jM<성Ѷ1)͡gw-Nmn09ws" I7" tBh|.ܞz`2WF uBh+!aeCmph5|o2ЬL/h |\=١]ch㣡ndrwBh ˆF~Q"oe_t HݘɍҎT$5:tGJc$y3XPg &>5 j# ^E?6͞DOUh N_ 8 (qvGBhY6blȷÑ2Ҏ:Qg'P:>G^fwPPfϦn;mBh2Of]nL! S0 ã=xlX?LaɄ ˣ=mTAxDEy1 tBhewF{jx#Uڒt D'\p=(*ƒP1х:'>3 a߲(1r+.ɪ YGGq @gTbgD kg{P(1 [.>NpV5ZtBi doo,arB0U3~DPBdi!^PfjB#hc>FY3G-.UՄg(zvBi,Bc,o"\m H{yR@uc߾ !e!PF`AE2<`LYfgBi ybʑh#ɋ08]xfkbHBAAgZQybK@oMhbSp37fZxbP AAqOŲmT9Q)hTB!pB:bN2L ߠ:trUrI 2!MEB U? |U#՜-Όmc~ 93cJHQi헃t =zR[r67ϥj{OHoFm'$D8[U s:q I%( `$mL%b2 X(9jtq\T} ]+tjmEhx/@jED*~n>-F,uTG}'usd)uFct ꨇlT4 B-:lBTցQI'<3,2Riw> + :2DatYBY<%;97AVGq.l G1wh ;PF#p;QkElSQ,d~tX!eIy4S7% !Nh)XY~\*}]NUJTIP#01*% J0`n k=(S۟*.ሄ: E y(+WDYULi'ĠEqwv6e2hHK76"#0Tf%Y0#`|$725}0u3D94JL?Vq/M.ܝC0V" E M"4De'3W7JMBdɶ: + Lph¡i^%(@[7 N<߿o_?ߌ??[_!4ooMCC2Ϳ{;|g߿oow\c?@o_o_ NÑx? m_~t@~_8>߾׷L4-Dzj[Z~۟׷???ӏg/'ˏ_7~ uz?ߵߞ;?ZظRE׿??u㟿1oo??;]L|;_Ͽ}?%?dO?6mH޾//xx??%gg)~׿}/ݖۗǷuK׿'?I??m_]e?ɛ?^ۧJ׼HC2!{!Ґ`br-WtSRSp^JIcT[6aEMkG}2z=`*RN3&)J4s]Cٯ*B;UZ%* b*ѐ8ePYUܶo*f>UT!p%J;o{J} 6JOyxXͺ";Щؔ F`~DծN z)!g\mK`;ڶɏW&&7 ozRԩ2D/%s[!|"uCtO1NS^e*fԕi׆;W@iL?Fw\MhUS^⑙qNS<ȓ#KJ;~S}@$DAw3Y8#ʼnAnwWCI|{V FeZەk{ڨ3b.N_ceE2}hJ>}_3}6S^ddx3$t☎B M=vcNu?[:C!jr~סw ˨zɩ2R/M՗ Q"ۂsZ'h'?qj?4kV٩3'&h 4'Ž~AM,7M_x;cmYWAe6' fc)TG_tTT0103ƊwV륩Q[ț-}f4W.O_VԥS^ YM)7Btmb.OJT P2\/;,Gk+Y5<<Ъ}K[Aةjfw"Y]reμIK{Ph N7 L3:.~DT] K#ݳH*"va (_с6LOƪ_XP7`eHƉcts]P7%yK!Vl۝l3.cBnK+S^!Gȷm!/KcK+D¯,K[ -+qc,pM0>,r/2d_ҼLe]_w7+^VFCмp*MR(|m$1Tq uW\E n(%CJ;97}lCsU-kGlIiE (CP~QiV.E&~Ѻ{zi?h:ƠKWOȮVSɽBO+;!e2edyN.͇VfW?U|d:d#;T1uuwK'q*\Le~߃,YT ͩҁ/*ȻQ{ ?kv928*=R{Xwm>߷unIŗd)V҆/rwRT;[1;T=uwݳ>Ma(n/|5%e"fiP6Z xWS%_JX0-+XuC0 ov w|Eؿ-T D6 Q;N_Q|L;/1Zi^i㨦E3HœNh|jVv;:a78 $S7TMOE]?ܼ/ }.kҘecEad'B^j3K1(&ҷmP@N._Ki<)(,i[['ud|:UZ<: Zrco! '] T:"x/wk ?C"2`wB>$0@;vǫ EqjK(4M.Rѥ N;U KTҫ\/[y ;F~&N?rϑ: Z$1NH6.K W'M=_BR9v<#K.hdFhz*:~|xL;Yyq#jS/> sAKVraXNT51<oc*TG∱$8kA]鑠 &MeB>Nŭ&T(顸gxx1V+V'^}DGtMubONSyаO9(k[ BsřOY$S+w(A&H=E{%Ɩ:vմ`O> B=dGۈ; (Dc^qLMӆQۼR,^JQ5:p*튺PdiQpف(N]̥07F6}r0.9 ,9BbYv܃#@ C)ڥ TZ:;Y7LgT@p rjмOc{X}uئqff(uM)<_Sߧ{m))P'\BYN+)pOPDRާp0W:^PO^.&vg=>%]?۹F'Od_)R"ӗ_J wz8Q5)S8R9bkM y[tT}'aJOIVN8v*L }icZŜ>}0ث> 5j)ŀGb&L M*#"J($S7"H՚-#8Ou*POdueh+ARaAF'׏BEC(lOvPn4~uizXԝb%Ё(, 㩴we=zO1}$ (兓3J i tl=4KTfr,Wm:i<}gGm`u<}~"V@rTɤTEH& *t LЂz(m6jP(:bMTo:醾s9]pf=y5zET_~Q CJN@;bt )Y@T3a]:o}r[;x $wOGr*?*`l˒tcrgJMڣ>QpyS .`1x0?aߌrQ<2 B|1!ٚ^wٯdVKO\zG y`NP5=}+7yϬ`Z[$O D=i3,xN,/c_Sg!/qScX 7_klNSs8,- K.j܁;G"[V/$L#x;C[D'O {_QYh(mMc舓-g!ړF.Y/3ٔ&x>R8xtQ 2DsCso_)(Pw+b Զk kG,A!ӘGd@T /3e+hye,#z6bb3&f_/>yP ьk)@T1g[| 2qcy3dDٹ@¤:΄S; BvTE ^8݇3db7Q"jy*?fo[HGrĔN lEZC-OP$)5bl"^cge]Nr"uy*|2cZ"OtX:?Nt/O$d옙3TQ#WF>+ƒ我jO,zý1 QB/}3'f]'PKfS"eab|haxQ%ahL ;V6h ,Vu O46˯e=pF;򆻳f:aBe@ISDY#nc6nV>Nwt9n (;_/ ߆h25f_"ƮAXs ƝCrJ  OmEQ\!e10;憼[Lh)SσWG)ސcwg9 0DshBs>;n0.U:[oQsRz4"~ŬaX]{uWhv}hŽSKDD I;&;Wwl29b&6lR\!alʯN#$&!cHL_$e'c?$@wDMxe}Rɒ/H, 8 E1=X(w.|5#.l$PȔ˞{M(wBsV5Q 0sf $fݛ(b ]KVL5eln~dOʽsVJ"Id^IY\{=Sw.d~Y@dF ' WeꅂDvg",@J5?ٚiz \Di}rn92P'}}^xw.JtwbExMp#](N/;'Ω9?yyp !-9;fE/l;xC-!EfrK:^ܛm :>·sUy!9!SoByM9BsQnJwOU@1V OA#f^Xw 찟XՆSL0(\!U%Zv +)<3W}_!U^wRvW:*x+%8ʣh ^xw.2HgRQJgRQx00kr杋 Ϛ{B{Vmf}W^w9g{{&><|?P>6aD/$=W#cӎ1M}˜Ti tm¾s}a!L˕dfO3Tt%;V['}$: {LBmLkƝkCOryrԕԮEbAk^sD'0䟶 , @@Yc}:Ui 4Ԡp\@>96TtPD2?t^dUsm3seKDX'W(uPꐔ.YL$!DJCݹE}L@a(@!hC{o)7/:X6Yprߞ'"-3[¥sK77(~xIqbi4e4ulՎJh:A'SXP/\:WtyPٝdqYRQ6&I1ۼ2كZ'iPSP\'ЍKT]leO k5ַ6lNhs8^T]Ok;{4̧\r :֜+9R߮qNSe<2Y(sP}'#}n!j+38=3,q3#ʜ;?Li"SPoO i t^ ;QYR":*R"ꝑDS:%s}ۨFA*z%؍UЄUt22]oAD ARLPz¥DӤ޳[-BOXe>W:7Of,|I G0Qg3'd3bck7BsC0_i#〷)sA.Z^uAV}﷬z[M6ƊnBscL_m"D@R 4ȂiL\!٥-XCBMMb\:ZZBsfH;CK*RS4n~G5zs&bjJ+^wCy}ntfܨ̉ IQ TW4.LݹKMCuw;!)c?==B^v"={Cz 6*A|#upD(J/;wt #4K\0$qvYKK%H/; Y}`#t'# 4<_hxtQGrBݲ:`@x$wWNpP5[nYj.|ãRn+gC;-W/=_X{x} tgXEj3_Es?k5S&l 2{;ˏDtM WEd?f?T.ʕp|[g$SSO',Kk %+5n?:d#Oűtc'`VL{/>_}󿧏>vSi۷kQ@Mnx{ay'>_Σ 杴8K<+3ZؒcH? 7QH&;f=sοE_}<;P%RJH[v'DCW1{7|?OeJ ϻ)<۲PJM=񉠙.S j_$LMr wԤ #Cd`nNm}uֶUB/b/MbEz2 i(y[$KGztO+␉[t' hBڷĆa=)vI~~=Mpn ]Gq a 2 ?_(~4Ƈun 1a]b t )G¨)x {CĶU YH ڕJAd=i;2U]/y(r=e|c ^[BW! h#m MȪt$vX ax؂K> P>Պ&>f*A}^}~A>Q7-@ukgd >_h}l4k7Dw=1'DHYkq >_}1=?DԎ&YgjO./\6n95syƕd{>ZA5A}>V6e" >Drnd)#_יC"> YsLgB_p H_ ާTs_}7fڮ+`8_S.JGKz[‰<4yt׆Q>c >>NՎԜ-H}ܤDa` Q(P\Rc48;9LoX|6n;'-)U3MB7!n\<|/^B-`6 ֟o+#cZL\ȃ#_ B2sP2$H'I_Oh H Z(/2ʋ%ĕp8>H~5 CߎY>ȡͲx))UKa,aNz;<\\7xb}%*WsLz Mu˦N:U@ F{?WɁa)6Sq2#cx $=91" 9'Rh)?5@t 3Ww[jg" YpѬ{Y5n$EC81bz:\{V! B<ĕ@k@dr B.Ak a":uP|JC)}z'!(E5:pC@WrctTȦSz4"Aa ʡȈ4ι1ߎ|55q|,Wjp/ؿm֥'AX4q[3! A{oS~>+Т gp@Y;>L:+ug *߮?% _;q}ڕX>)D/ϦZW)% \LF*DBRNY#=)w W6dп / 5s&=%p!/e|%5u CB sn<\Lو |f(TcǤnb%^!9&6&.44 +X\yD$(3u50T&7VTD"_L%:!B #00phPxr%P;,#@92} N(LЈ6x_M;_qo'ϰd񫚖=QL股90 t,47NwO^3{045*((oT竧sSXiDB%;8u+evT)G[ؖzV?!}f#?T7=c6#CWQ ;D).0ZURո5 0T.8 3dPKB@3,DE0a_% 235 S5qYYۇpC[3] ~xg;zuF ^JP@!M!N픑iU5nE! BLAe(ļە嗨[FՇE$,*+ Wۮ ,XaD;*5 \Ea @Ai!jjok䚂7)'ʋG0 R'=fn+Ԗ E`ޒB~! Jĉ`X J{\]>H&. ]0zwt$xb/ %0&T $K(QȂѹ-<}M1m<3AicNa ,*#R`(C!uʑ8%4{_:9)*|= {0۝L3^$KjP!C?}C%DH3w+B7s!ՑC B${@81]}*' m0ty~ q񥻿_;H1I{!ݯ`2=@r @QAO5 RW 5yTB 0#UrTL'㈫2rLRL$2-* U0|xTVv*W!є5#q54+ Wi;x!\h7XRݵiD! k };]H+4|1J4% C0`S]f(@#A}*rVJ3gCM gsXsylslDJZ= 10kE,6g]fJ/{qu(TP4# yQA" j0yީ38}#etҥK-ZznD /jJg>H=:c} 0ntu%榜$Ma Sc /W]c;It0qtV!*xwzy3i?QZ_+nj5 /\=OX'%ɢ&s[ង*/J2f%ݐ5-Kº_4?7DK1QʯT(9u=0jk2;4jJ#Ѓ2Z?!Ewlf_8>R]I&~|3w ($ X~̕ o|ZQҨхVJX}WYm,=Wf7ˬ:oZ-. /V@RRٶW@$bEZcm_:dX37mȃɄoyF`mp}$MBzJqn}:h,]F.6F{?FDŪHffɎm^~ƁT;X 5'(J\r)o8Vz9sdrBANڑQewا;%\MN)hGE~oR_^_}@_;~ p-h!pQdP$fv@lB#AOwhL7D Claೡ: 0V2J-nI=rw5fw(|\IQȀp JP F nhL@ÜK~-  a@ڳ&={XFG:7Re +MHޠp_` gW)Fd4=ѨDo籺pc-b~&n.5kİ:B`7Vt-k zǥ1h<}>P#>h o4i:B+zp>jpcܩW@#tv* sk۵R`Iq P4z:Rs[   RtF2Y mKej߳kgw\h0T=KRy@"t_]mmeCc%I R\Ն 4p$Q'=O$MY=$G5RoP9J A 8 E:*i f-^\z21ARw v?jƉgPo$Nm.r֘H{T#0r§ ChnYforIaHύc0@G!#=t)**EƦ *3vIVxT_Y}Y,>G]j +0P=?iQ|:zWW5B M`QoUc6җ跬90V GE\?Y{V0d;,2o妣ֳo ?0Vmߥj&s  7g7B 7+5m/$:8Q(r3*QƉGԖP,\Mjn#e,"tuC!>EljN{B_ww gRJ#XkSRY >jNa FDNT3{,7zؖzP:w;}SO!cmcǎmIN0A$X߷_dkIUY$ܗw5ANO6#+F|uVp~udAWHQ{nb]rd ACλ 1i*^!X*H:#sP:I1B}z()H)X5( Aq =|2H: ʖSfU`"5q4tNfDO+.]g2jJjЍAu 0Z,;u VM:/m ҿ{sdR* ^&q4:(F%^)uVz}QXC`qZZ=CvɍWfc)[g`&|Ďҭ\J_HkB)w!T'i ,.@AU mHpdK>mTS["x*ݺTzȋIבAT΄ r'x꘤n4ERR-1u VESXʣnЮRξ>My3Nډ O 6"6ZO/UߣUN VǬ0n%1el(J {XW}#ojG"xGR' Mr5s0D`ՇP\`wi6e;ө]Zgt_~ 6ym2 tO{>ɌU)(Wgt/ŠՋf=⁦FnTm_g\_q}v ϒCH5Q{X{ePW'?.U^$u5]B lм\ ꙫ 2ȯ HXqn&vSDkQ2.CIolv㮭bޅV)ECq2iNn0vـU#F->Wv&B{&~w*>#6>L@v`@Kv5Vj:ceJ O`@itZ(W朝YCcW3b C @͈+oe_#kvs._qA1Z=jB23E˒Wt;=CC/r:Nᶞ0+for$烙-hD lX%u-W$'C,aL z94%Z3Ee0U0#3*v 5Te&q|KwrYޢi~KAONW"2>Ru{Ve´ݯX`DՍ/'| 1Wۤ3 j.4B>2G`,9F3N~~- +c-1dNz+ aDn>$j_YHgDh gF 'j:$ŨLP:z2X.].ə^#ܷ„O#ߠ`J:jCih`x8HlXiZ!QB΀:3oqb.!la<ν(2~#!##]}@< \'ZcEc_dW,8T5.’Fc~r\6\Z@^kRkMwȣ.ReXtji2l~$II"tu}u$sAG']AvJYꚌVʷVC?G|Je(ۺN(@jip .5avV:(th8U4&n42o_ċ5Vy.2L *kyf)?z6g K8sĸW^8&xs"%DpwԼ-MƷn..Au*"RR/Ihsh6V7Wvlk#;4A5v(2&o [.Gpba"W\M;:BwK Zՙ]i]mu6Ӎ H~׫Z$V#|&uYprO71m~j(aAY֘niu4b8#;_E8Eahq&JۇL,3~l7k̚WY!hpu}Z:x5ۀ\ߑ\x-VG۱bJMdˣ3ڬ>߈CsdHlGt`8M =OC CxjCEfzd2Xِo2 44WXrfI`1V'9 ={A 4S &]LwD#-Ѹ`#Zc/TP+1TtZ6tG,-$pg"z]&VҞS# rR.V#Z-"JƀOdÔa!s=~PFy#>0-|lE 4?wuqU*;xĭV:KOڎ2+?+;Ʌnʺ *f)L[須46VLSݚ)(RIZm tasD6,ߓk\9E.ԋNe([l!Sn6"~H&~Mظ :h btRRqalLYɫ m\۬5#EA:k#$}P!l!b}Tl#u16dNKKTu^iK$k!0T]]oW:9 shʢXؙW?(!x1l͵,yOL0i( m _5D$u&ܠz d$vxǼQ}g/m2xm3BnB] J )j~3 ƱtXDC4 g7/ ekWrvT?v3e[PD yf-KgVlZcDuTu@Qlv[ǔGs,vl[V1lr0{lE|gBL~ Yl dkVlFd_g Y}^0xrHH,zvWN͏ch#Ǖ#oswf K}p~( v InbrDPeƖ yƻ5ɳvvޝ  \b'flTk7aoAf)oӵ yg3IPW|T`ƽ5&Zez$>2E¦N.8CQRu:`Fm9f$; N]D%x@8ӨY+GV5Y.BM3ֈ)Ц0UBRIvG\=m-rаYJD寧68?XrI,$>p4;I)["͇o 'X9g*Em6VS^(m2aU؇q~ ArqkR m&L^ZaE $VVx5#Wѐrz)Ѭ,"nM-Ja+_(e,(!Hu]i*̹NQc)iM5. fWÄ+)\=h/쏮<;?&aҙ,S0"LrW,KMT3?䚌"tYL}Kؾh'd5- knwJ:ia'&%MV9PT@`;-km 14uz:NP2_ <ZEwk߽o1\: v:²1}w_Jqc5.h!U)*`(4+9a.ņA5h]]z̐Jܦ~M|S+k,..De zE V2&AV}Y9T7 C>fLlPW*u|0& EL8$;Swm۲~JYLLLNb-dΛ?f^zq1PufY l^ |g{J: Ł]I+u)*{]!5B*+0U ,62lI+R؋#eXR{H\B[hZI[P}GʨZPr m;4u9uaqюR] H,ee14'j-ddqaz h q/b?[`pc+nFCp S>N  feqc{TB:"Q~RIάd9DI^b{PԵCC}%[է9" fAC}VA(Ob^V }A5sBUzfi:~GæzZCZ?f+?MꌃJ!qRZ1*}m)d,`REVη@IvcGeVt;?fl`apg7T sN~KInu6!+d AK$;TMr82m=u@Oya6MJ I~\̹OߎSgNl?%&!UQ=N{K1^qVjW}ā: pHRـkwZ1&j. [ 3ŷ:vV}uhA4HXi7.6^ocw#-DŽc%H=iDm鸟q1 3@ .}G69:u1d)HTIC{(G+3V۝Dsˉ_/ꟾ)N4l׳ PYphiv>(<r.Ͳ.ҿ:΢$U#iղhE\ G#r8:_(+6P@Q۲80 ÷ YlI''u8k;$C}9c0684-Hύm?gޛ9.MX’3 vP%Uno;enjfl^ڻq3KtlNWUE[6 '7܍GJQ""n2sNй-{r8]~-qz[ *N"s5d# S"P&QC@D>enq׀y_|w"? }Ӈ#N9aBqFYitۤ\Z( JWCsHd [(q9b_n$ʼnC GQlmbSYN6/xn閶X| ]MY˨&&A/Z ,3VR]~rHUx&%RQ~}*5:U^ugwU/&2rҮR G" L1ɶVuh,_\ 3 tDifsq| R3jwˡ"'EQ69Qt;0,M ob3~iFH0ŋ/~5⃕/ӾIw{;.)7 lo84# m7´E{[; q"D.Z.MR;;lĊ,6j[',ّ0 V$dc %&' ~NDڦ*,n9H܆ (K`Z3+X>kDtRl/Z$y}5Cw (\ĕ1whڝr I9pEfQۀݖujxr]d|fV=kk}m&UۿV6-ETj p_`T{ IcFHmrrb1XY`r#MpV`8x8(ijqߠ1Ƿ7aa۟JL|8}7͸K a rtr1wLVw^{*;nUGi0ɹ͕@/-[=ົV9hfATXi~ |)C!U\>ck^YY ysDJw ZrXU9)l],L'i~@Op)bD HR9W~L I݄Hl% aHn%OywRA[z - a":xUG n y7j59"0ig*-ǃZ#`v1=Pr"R\&DJd=k*: " CQZ,€d$䱾aGly1"&x@^[mH)!yɑH9G0Ԡ%w,/m񔡐&q%BFm8R6!+q߮bqg41!/G> '1GxUS3\#BSr2#@IA;Fݗ 1Lj]}Vv;‚ǧd f6 䞽vvlyG#4v0hl }fİTn}sbH]fq@ov2=F+##S6Or^Tre1 &vF/KA^um/7xrdqz/RGNd饆,ܢ=yLjVEqMm>vOi?*dNInF' =^uyr 8=d<\۵ -T59Wr6m{@$fd$w5u)vOImQ(uUoP{s9$Dc3_0a'^D'@Ien|˶m@Jq!b ޢJ4I׭C (7adwpB~R{Y i¾c:K/2.vt\})b7źToZ;JPX229^X3$w"1+]ju"x}x״ǧBFaǗy31v"5N"|p"rr:KS3_&TBڅb£f2qsaǗR:^~~W?{?Uᡮká1,??~z7owէ>p~_?~zO݇OOƿ~b|ϯ`^t?^h/Wy#v7~x4~w}?=OӻWo>l/߽ͯu~?><x zW|zLJϟpgMpOq?6ǡ9 |=w#ݫ|xanp>=id?#O>}ڞ_~4=}/gw?}^/?ez}۟w~S ?xw/']_#ԃ_z>>X>_l}|~o̯+$Շ5~.?&$:=?߿'|z_?J=ǐÛOў|\_{+ay^=JӫO~߇d޽޽c,;c{v}z{/.{矧?ߵs0~wwoO_RQ6'|Wj~&^w?3G ??_c|t[` bg?b 0y~ߺ!^㞸 1}|_!lJX&}7{~W'ToXkra瞝?b͌y z=a>[o!s'_~q<_"|7ﶏ."ZۓK#oY._VklS \No6P/?X>?}l~',"'1/㯼{RܲV+g_|2|w?}F~kǯ^%b%q:s87|a|!ҿum޽yOo`_'iZ||մ?})NwL0]>`{zg:<ǘ#H݄nןyX!Lyu~CXyd?p˧< 75 w{_X"byu+=r3ruWOopJlNxrLϟZ_N.1q&A={揟?e|D\m?DZ:Sn'_\e[>{,2rYqix;x+yJ@ OBtlȝ߇.oi~x!אܜֿfJF_#Mz~"(?4+zNY͕|[JҋR7+#wo 'T?J_.9 /$+/0ݿ5Y_Uū&^cQϞk->?o/+I]_oʍTP UwV&ùn0// yd~|x^]$}v zrqU}}]v+~+G A?ra/ >*w[TvzNǞmkwۧ?`#]'I6_˟y-Ád^uqW"{?~`GC~'GZ{;>X_Ʋ0hygTI _۞_}1ĚPF~<ȋz"7B _on4RSg¦E_gyb1/s ?FI/{~p{Wן_[{8wc}lp$>oᐛ^R7smЉ>~G+~O||O|Cc~ D_zI#?;ft}$k_aAqrw=.yޅX׹N_? gv'w?A.p=<$Y Nʈ!l`&>CP+8~)fÕz͓ f2+- u`(NmS솟!"d`6q'`7KOA+G]k8_J!9Fӂ"N0P;B@AY\6YBȜqY;PE0//nuL\zz b %xp8y!Z9I-y)GC@H8kuO9ݩ8m"ggI>DQ}+sߺ|vhi.fC%H;-哄\b2Nn~Vk'P»Io =&.؋PC.&lI3[Y'bgX ##*8$aZM z*_oL)yv惻AXf<`)l?ԚVt^E2$3AϮ_%.<-,1AXΤI1~%'cͿW x2`-cryVV\qODi'@[ZJ]MTħ#:: w^ٮՓ U:oLӏR#XvE #Cռ込*F$Yh0p$t06Ҵwq*Y\*ɲⓎqb-0nAN #PTW:uoyk=eɢn[֠U:0$\3&~m+F\ʏE +[+|8ﰡ4D!%·}IyZ+?Ȋ"IrnIVkP꫍Z36Dbe^mOR 4@AZu1nG1wjlZu|'#o8bRBlxznt˺-ue˺>z9"!J&c)w*ĉK15-|X9[M4@:$5#Vd'W;V Lu-xu:uJݗBY37k/i!b 6<&$%YQնl^5JMÂkAPU;4e}\ƈd8- )X md5D "/|ॉ e[$-ڧoR~# (.luVnHjAnрۗFLZ!ö r=esgr_Oz2Yv \(?VyE) a}| M K$hK康C&656+~˅uLGfhO%rB/1RtW K7tH+!}$W[1`2o^$ÁVjMt?{مĈp^$=;Oo8D힘W&%2EA }YywݲO7QGttUPr p܅G`*N=~<TA{+z}>'V(ʵ V C/a'e*{F~LBP 7N(sAtӂ4Cɩ:hwر}/0>肿-UО}Գ HDTs[4f!T#Ȟ3\ ,*k+JҴ8٠߈֔*+BLOO~WbH4W~'h0'g3B)Q&F1#,f1D` Ҿ((8M 2 %%Mʻj=*A&*,e""e~lSC"YZLu:7'(T/xee`c/poŠm>(?\}X:]jqcϹ+VZ۲r1ݎbeQ-~RTJQRhub.fǵ-a40Q-Q\7P:6:8v)I t̶~. CybliDYa^MhX#}Q;?ئ)wߟ㟈}N? cOZ/YbC8VE\svRwt Bn*r56#rN)Fc*jԇßrqm0M(Uǭn;j)z51#J6KߖER$xyŝXJ$Mҽ.. VA\@ԕfʺ` <i7)CEg`k(.ź\9?; Q'Joc0v{4* o VcT,ZvYS:h+v}g.p~YTFLC-]L0+FWorlc#)Hdii=A:Vl[w6ݷ|XGEbK`.n`6T@A-kZ*"#[yҮo.UÊJՄ s!{~qqCoWAqk0:gD? l3vUۻt8$%!x}AB/"z衘~W_ሰ.CŪL9ߧ1y|rJx"-LF/`6.u 4 D 0Xflh.gu{~Z`2"0!/|JLTK;0@7~"+J̖ۘx7E;Υn\Ly jp%3//nߠβ^bLo~. nŜՃ)E[&{IGyH&=F="`IZ**4$nWiS,o1\tNHGto;I) GC+o~!DԿ_C~x$P(Q )XQr|,NwP_DɾV')'㳃M) v&agv`zౕ{3^NGr?W*qqV(eo!_"gQMRp֌S4?!-$'^|{}tس2+9*g&$ [bJ | C m_n`h*W^WKl@`A'm=p;x)TLZx ;?kS LV*BGԡw_wڗp&[Zslx뜿>>3ݪA5MER9w{'bP !> f*>y9+ e_BIvW 6ݥp}oGD A>=-g\OE{f+m)})*rldc‰e[݆[u7ӹ~Wq|%T{ mc@̜Ky,:E*Mg4K%8W)y7yD J=NnpE=plw3]Ebn;ޱ -6K92\/BӣQ!zh:HGͤam֒h68abE(}!I''~(mrB3|Z@_ZZK^Ì9Qhȱ9WZo}L(Z֙sw` ᚋkf!O8R^S^lU jZs.jG%*2k?E@ocaXןs5r->~H8:|X ʅՐ kI.rˇCn0"~lwE04S3FU0'i4k-3/m­YȀ*Z6쉥6vN76'cؚ^$,Du?NR~zion ?"2nϟ>o?@{?ㅘ}2񝈢+1xE>~ڞ~} 4|~~Ǩ`^@s\P~`DyG mg7olxSQ4񑒩ڇϟϟ5rr~iW7scl[azï>Ͽw|? ɝ}U >H)o3>%DnԿ&O/ !~zMRT(;YH>soiz J0ND͞>x1!Go<~+ 6ٱa7__W|_WhdG&~âQb3DC\d~?`fOX?;`XDqY:_0?^HWW-Y GShZ|kOΊs)q opՋn>b5!Z}A;=,K9>JB4ą>>d.O.O?='OO- i/)$ZtpI1MNXS} A̘?g{/il9>+>W6GGxJ~?'m ?,Io5IO02z>)&OX!C9=E`&=su!WO|7|eĸ3{rк(пۇoOk|fp‘LPQy2(Ftd7|63ğwgV%-/ĉ)Oc dɩhxOE[WZn~o-D_vï?ĕtFrW?3{/~~/Do“>,hlu{yYl&V^_'`YDkIo6V>=LKޞ^ي{ €W11;[_IZx|mÂƛ<,ps%"qWZJ>O>_`t1w&-b,3rw>Jŗ"Tr\#S8i/wagZB~m}e܋Elsa|ۋ5lXW&:^#.x15ԏ_PgS^;=6 9YNDLor0~]%_raض ۼkyw@+>E?CfxCyDףF"7S^-׃l߼)7)wO\W}}+'G ş?nb:t ~㒶l,V);~Qn!?'Kw Gt ~UHVl%|/0}w~ILfoͦ H|s7&ƉC4=wѯ8w(Ћ?8aʶA! a9\'QR^@+7,2X>\{_ſ_&97I>~੃T{4;gt2fssJ^M3%Dr0|gy[>^}ö_gxJ?Bۧ)mO?fx=_||ɮ21~CI҂O~53WNDm}&X䓡ۋH~eX~~F-3r{9~#?#tE9o/oh7rov?/B<ME_[%]XMqר_|gۧ 叒1n?_cߟrZgC]?"Ӈku|e퓇GR$#ɇ{7FPc?i_j~?s1A%?~6_N=?~|# -G?'/8"5z""#jFT;CC^ q;!r+x\ K7E~gOAkLZL`)v7Lj0py|f:Vd;jyT0JJE61m w!jBF|[ܠQn&]EvHȟB;NQ(:f;ح+e{b+fx& d;xj,~w?pPR#7 XuCӻ#)7G ehSGR `s wevNNFkFm@u&N/ uO +ZD , IAYzo"rHl$H/dC4@f_MV~YO^~ p "*U-\\7kcӾ=nffR/I*iKBU+!yQ0%*TEh>jFKC%f pGB,NngSLJ~BvϲKBjm J̴ A^T`yMvRִaֹ:ZueݎZQi;ð'}'a8a>>}ByM7#=VKrqyv?ϭ+coigO?'p}_=߿#oi??} ^'Tzw>=ytw`cem?^5>_w;NR9|dПӇ#d/}~ Q%% UnKW:PݝlSP'f՟[Y;(B$=Bmivwst hK봉jzHEյ4RH) ym).SQa89ɕ e ݨgHHaWis fA*IYs,4ѷPi3G5*4k8;㫓 ΚA;?3'auwe8!i_ 4c2x$Qm71u0\PJnyUa4PBfi\5'Zk{UXsk0rA%r7,Z\ŋ0xWX1Bzmc (SߓMVf7:sb\_SuҴ̇B죅ɭ(YLDi;AN˥4odr&!D6Adhkf3J;adm~)B~/)i}H+FztWDk+Oh"S.c:641+:էt;P5l1h ~U_4YGe#˖;Z-xh2L0b9uO!!&/8=ea#jSK-8-M{x Ue+_Rpap1U =nʉW%ĉ*ׅrЈ`p^ 3vʒ&ISH41p HʱW wh&-@$۪8v)^vS&uPhA.KWBÄa"i^lI/!l2?Te*3BLvE2Q]8=GEWS1{2A} Zty6"9 [>bؗMr+toON0 W cƮo"aBK4 9a8%m{([ͮy>Fm 6"$so߿7d0;?̯~$t%^ʝ>˴XD⿾>0+@.qly:1r2yƀsC{(> N[2+[P4?TJ(Z ,sWbn1ob=INQ p5H׎XT–mV3ky('Bc}~8,9)E~k<_#3kC``"s8Re,Nو!* X̍qB5!d\ ~99]Zm1];$I<Weē^4o$|+ȊeJ#7:ΰ0eSn(I%;wB)LV㝥l'AWZQ^̭hV9m0%ȅ ~G>5#Elk$܉Mc+v]-oQm{57D(r9?L|O<Шˮ"}uQ q;0ͷEsg^*yjeLhqZ.A-rZ`.‚&/ftLX ɻYz)*¡X>3X1dO<誵=%u% OVugOVt\>W{'|X(&vo8Œ[*}W?c\[+M%D "&t9mOh?Q*l#CQtȖ#˩LLd+K8VFI;KҮ8l4l8Dr/ل6}+*v)z4eW,Ra2TD ďjb_@| ژZ0FmO }ݔRRYVnѯ@l!ik,xt˝1ˣ_޸˙dۼ4>cjrAף~VPD,5D ϶Nci>F4fQ#Cq@,seiW!iǓ-t nP{H%v!Z蝎ʙBcJ]Վ^dbǬbƏ*MdCjQt?i\\ˬF֚NMlC8Oa-C:ab$n).y jR?:'v2xǾ6ǫZ1D fH ~Rk h!:)ȄKiF=~X|3/5v /"zbCH<3-]aGt)Љ2]&(_rsXdr$`hOWCpf-:znd[gpN/?)aC/=AJ iRyQ;%P 71aݛI F%RJZIๅbۍyC(k-T~4ىeHJ5ìsV TB& 1/13ޖ/#O\d5<Ω;!}ѻmtP[[TAzaqNg4Oe{NSːQv.o\++d[ZH\q} ġ&(1`iڥ8[߃):Z_"d -XrR-)D+@Zd`wYBg-/z|{MΘG`*۩Dse*(*fؖjlmi*A,ҒtN>, ;ՆW[2E:QYS4MŰ0B*ho~D2BUtUeyLD6$#[ jAYjT;Ɲ!sB'M#'dtxSF9>( *uoе\~(c>}` (\3{ U9/BCy){ބVKyvND.??td.0CS8$ MdP|_{ 5*e7%_Ddy>?&oWwnӱ,3"#`l:brCnۓWab*#mnNc'w|96x"Ym VpSd򎥜(Țet-mvO}Gt#P.++BIH[eNSãr+Y)[]W;?e/1j/n!(GRȥ8AZ4Tlȵ\\?3UGu>5RvF&Mšji M(khlS)K c(-1Y*S#?ͨY!*aiK;E+ <~:vPbzi4^gڠ`sߝ9cu]Q/s>1~Xf'D^trd9=z~9&PŚ{.˄ciT\{!nI-KN+v ՅGH;E9>׌q{@cR }6#XlƓrkbM$أh`ċt Ƿ`q[veЧ\dF%+(oC0J!9^TG7mg#5B9-PK+nu2!O& ̕Qz15Sv4/r:myڊacr~gyWd.g(JBa?MB]톷.:_ZR UlG5m^~$N`͇2EȈ*7V "ȥ”տ́$0Ø]l1ds\AT'F/^I@1wbHʪ("+c$cYj;A\ HXޚњM26|aN3u 0&!a"l h-,+~K-cL:.[r^xlA4S-bnYg1\8 voMpݔr:;1K8F؎ mWTF!wpYtX#1C>_|'mW\K9}@kR(tI%'k%|q&B%=ˋ8eRFMc,#hT7B%u \c8P֙޿P[,$!;BXbBe@Kc> )GȉьGB22) _,nplΎS~Un3IEvw졛s 73J2rUXC=걎;bZ,Ɓp,z~^zwr@mFjNR-%R6b+X{UR!mP!̏ R!v 3 DXK#1;l0|q0 ;)SWei%$m"KJ[ quZhmA-1nڭ~`b71۞Ugm0Y(kmT0&vg&{f!zJj!"]'7 p >jzUjiB$Xj ԓIP;&B$ oè$y+ڕ0.Pr~Agy)<=L,DzGh"%.Z!0WY**+6IJ%`D>RG4cY]dDgO `"W+E%q@/dmu`=%\|s٘zTݙ%Nx :u N|_(b`4mLJ؉ OplsKfO1b&Sm6*g9C9$2DX2tat|}UmRB_Y8*B{t ѱp;Ȣ1@/l?=MYM7]E8Nm]JDR@n82HIhc7Q-qX-/ uZ,ԶOOE1V  1؄ZXCu?3ߤ JKPx_2htDϣ=s^`/c"oXL1t!X,KI%_+|4QՁ*I;eNIv,%.~$=v1USz.?ԗIˀZ U"6IM ׼v)buꬨ. YT]rܵH;9Ys"S:wݝ^t9 I$d7$L+L Dh|z 8?.!Y Y@ DK8`&&Xzu Wu<9O^5(Q!0)Ifkݰ]Zґ>[QʋSNUajkj6A>zNzcQu9 cF B.B =ˠ'p8lz0at`2D.oA/K)HP ,i\cyJ 0PbaP#b?|6.)u |b0Xn!U=4dGp,^'&q㾞ڱ kiA>oqZCJPM B.t Z3-`"~C64~3#\!R.߮9\DW .Qu(~e;z0H)Elѐ X Xڄt8Ց0$LfU!˯YZ"Yp3עT_ 9`DDHBNj <]uƚt8 N-VFPȺM>7:Y kG1TG%jԲɩEi6hEkvo<Ȭq~jlCAeRFֈF%?x>Hq0 ~>7֦-I-V8-`$5 KY#f<5C6M.ӝbv2UhQ=Eȋw-,F\;K-b}IIg^oXJ6{F[B#r M̢VNm©Ȝm BF4E2#R LHQz,|V=}El@J!'2`P+2!:Р4m+#ѣM)@Lwb`*Jy/(;KBpj*-c$z{iJ?\rUs& ZF_U'I%e)0۶"^iH5EqȍZlڡٸ('mAgm(?̬ʏ2ܚLпm3Q%6{%B0%(R"t6Tq{ &d4ٮpwKNKmn0]IJ[ל-:HOS77i3f ;_XgZEw$xrms/5atbD8A3<IP҈+90pB Švd՘WNI).xL_wXu;V]O_2xk X,H,k(&vSkANZ\va y[-m8ߗػ43E}QsKhR KVRfgLqSJ5({Lh6Z" |w>bPk;h$uC6"ʪ-]m\&P [H"G *?:mD9H'Gp[qi0F“l 攻ztT9RG|%@Q|13/GPhΦݗ2RF.2cىwPܰk4Kaw Q,IG_(nzOC\OQ2(V3 xg+-J2E)f>$"j[AV]]\J-ezpJ&AP 淰Y'<`; Jw^[Nn4p N9Qe$3S6)DxRhDϵm۩S5CQ%4:^:ZefwzOԸ p*t,!5AP2&I :.^ݢ~~bFi.a즬=.'!WhÌK)rebBkKp?t?5;dIc;fnkS'Kif}7{pfs ODfCW⼰ﴊsнM1A0e({VԽr'm4+Q'>J!OQD_WY1/!=4nڨYa A[@Yq^368 eτ>15zM -UV7ٙ7yJSA"TepUp~*~kgf{ۻ&pV5<D]B@p罱?ߵ;1wxfk־}7[nv(.lRFk_A}7ZhUվ]ߌZqj߽վ{}V|V|VK.[mcjnFwcnҵ}7VnXc5EKvjnws7W}7Wnwsxjծ'1W+XڿZqX}7U}7UnwS뻡E5T+؝ʴE;U6w'NjWw'~wRKồIw'NjWW+wR]Zw'kwRvI[:ߝrIw'Njտۨ[Qi{^{n:-\uZwi߭Ӿ:MY߭uwoi= c;}wL1ckӔ=gsJ&SZq?Kw_|5ڸxl_Ĩ+|>9 wOWۻ7^=|x_?wt3G{na2/W`/1Q_=Wo_}z𴽖ny~Ö?=mc~~3Qiѻ1qΑ^[|IwHc%9799lV<8sŎ@'9ZbJl1V]r**PIb#UN_6cqgV #wmFR4Kr!1yBŞl+^;[[尃AM2T@[uA1 j@E1͎EP 2, Ș"+Җrhɀ Gd3cF WY)ɂD[z FP]AG:cm 3t05G drSe,,E%]0pJ߅dA5r0=grM:IgN)0p" FإMv!ᓝWS6h|wP6-Hnn^Z8I;#-ߌwNQ"/\L&+~\|v]-d;L@s88ꅭ11ʍc ! YeA}n,vwI H-PV,mDž6Q' V/ٽ?#q\Rnx&K59̆ èe殉|h\C'uc.h~ Lj`]U%+M/BTvbiEg?T*i ݿa+Ƙȥ<ʬ!NAI>L||QN'e; (y+Ϫ_fjtnL,죢,Z`3C҅a2C 戕/~򦔶N^e'ؑe䡢q@%50QilspYO:d2tg[Ӡ!uC<' K?%U86 S66q7rٮ,Kf! %5XOv`D9BVLNpG&\ߊo(kL]BN"MF]ET.t m]ZcMxCMX\T| c8pT> 6bKlتt}sw@[+%(㙑cW1R)0WÔ/ ]0|fN](! TZVsٟ+Qmp_tc4CNyTk/]eEupMso8z~\6["y鄡|^|Nryft('zˮu`CuFX9Y P P9hT8Ť;k7#GGN]UZnXt+ 9=%N-(_d.-{ ;XFXJ+J&}o92AP̪.qd!UlG'Kdtb_ $x0*I-f.B%O8QJh!95J*2jP¾LX+1\fgZ=tas_g"]%ߊ1$\ڢ$4]I#^A|1KPxǓ}xn2#:#DvLA,k4hwʖKTTsi)aŰ`sWrCX=Π[ࣺ-o^KCQ㶜* t(JReVN+f[Y>̴"&x(=f )lx첊C8Ȑr*?BOvHi'I R˔|kX'oLifcmjѐOi^ V,-Q\YJ~9JA61VIS64OUx;|kpaQ/^2hD /ZppNs~81cYyN !ͪokHY'ݯ/w,|0TrtϪX`QNB׼pQ˝Rtzl |D8 X*0$ rZ6nQ}9_o授س✞nLanR!*BЇdw:%HEy <-u +h>C֢"1M ˠPI!=y ;[M|o5Gy&}YpeFB)dߖe*b`+:XZqmLߚA.Š>@qLC .; &kO2!b!pMVc45Kc t )˕橜<.>dFC[A!a&T%Ps ꧙uH!UhO쎅[Y`1[qA3T»"ukaROr6-[0 R7#)Dt OC^WSuy*#eޑ3Lt 羃 1Ea8dvD<[6!xU tDbMI*]:yATr?$#BB\݋g+.JWºɗ6K.W%}Ǡ\~)|ɟ sVi=23]#u 'O#A)zQ~@!Ӎ2J%Crjn&}*K8@+Me\&2EI2!UTHM]_٤/[- ."~wr=lܶѕwy 6= BʶlhgW!,AӻRٛ-jJD2QXXC[-Y  ^(z |_v%0 @5C.ನ%‘@0 u 8(CͮeE`PVFCO/ؒgZ<h _&xMP\g}T |Z+=_ɺ j8B1Q5== ♝.[ԀYœNx).QOmCrqa{F'AN³עm=ܪp^(-e xT xr!ka0@IyufGx0 ՅY䃺b(2˦8McdVm";m`8sCG} zmCtCBs'/5#nU.6X6 j2{!҅F66 ̡̽L/jDmFbUQ룕A)@B'Κi KbBΖfyv\rGCN_켗 y>$Iis^Zh8+68i`օV o|塳FƆ@G` Hru$6Hpՠ$lt_):z,g=)/ Fl:PhKixȮn̂SJ~tnhrOJlPsY *FA[CM[Wu3-/ \"N}+ qO˖dVm$U-".2&ډ&/Ei'<>ӹѥ%+&786$!6m!Kj锯Z*8\$R0" O+ځ@y%E"4)1Yyv|p2uI_m&+ݳrTFNI bf >,}w}>+1l܊]ec4z9!XuY]\DRx4yP! ^Ln3r"`YyAC&(n՘+neal׈J`_kꗮ+2|y S8WmeJ c 7RƼ%ġv+6& FrHp!̲ ]5IίƒZ"4šF,jR=*ĂXĄ &*,4&#/3rȵ j+ržbI51&&sMQ':6 {SziRa>"Sg+VA*)|,4dFuV8U1_eڠ}:SD|Ohc:+~TvbX5&'rWz%=}$%?Rʥ_ jjbomcɒ eǒ|vԁeV%TNOa62yyV1~@*Y%8c%q- q EHB5uΚlunًh>R&/saqVKbYqXЙ%59U"*M+'OǍtasy X7q TB=Tr&f˼+ͭn𡼣C}L \rC1ٚbX™XeMU%x.T`2)L'pyx4 "nGawHq  Oq!l]>o23źHAM 1N\RCy Niۦhl%WXy~%I6so+Vćd&Gڨȟ6k(\J/MN~4zۺmvlN ]6VֵmtQ {>${@|F+6`+pelTh|+VHRXW  mtG?QYE^*Vd+ղH/b:QR֎5^3F ?!ve:W($o9A!Ame\ lFUhr~ ٯ<Ahw(ugl$bpx-aiy8گӗ{"|̴/D\7?*թ%:!v5NA!h$91 f\2a)xвoa8Y",SoS[ӚC2#ilY4vb-QLp1vŷLJjۉDŻ͓믬FDtUW(c  gI<(rȌuNwC 1ҢH[JM٫R}eމu'e/:Qf("lFAڳcpdd+d[Ga0JD T*>[ Rz`Tbv;/ɂ}*J O.vݬ%l6ڮIL q|*B}Y.|q3JQ]}U9poiK#_$*.TAX&aJX b貵L KWN-i"GanbQP*]V"7aLQb]/`v(R^*{uDiM%.qҞ۵4t`k.ɾ0сFfptC2 /EԞVd9Y*{v(9,Vhi8٨lۃӶ^.|Og}d=CUʵ #x]'q Q>/)ҍxE\M7OWG MJ:(KtzFh:#;p edzȆz62b]i3eTYwJUy$P)(YږN9A©@mdeɄPuվmݭ>kV94{Pq°H='D07n=Xi[b \]{vL)}!vSi ve~ +[ Z4pxH,SZKz<)00g[k$Zp [oxu*Y%&v;<|ܝҋ4SGiEa{O?VD' 3T\)=ܠXAEW؂%Lf%ϼk% .m( c\7iÊEwx} mH`HÂW$H^>9 <@% t}BK ap ֣ X9Ww>}][$Hl5pvD7K-8Q))JuqZd?BpWJ27i& ;^8 :-YXԐJ=Lw@my9SElj(نV:{0P-ΣH"5㹙W еWRY aN3dz%ҙ8f'9)Lhs ƠYC'1o/rI AH%3@F^(pM r6UD5Nw{w֣"?"m;z2cr-qa7&)%C{nj/ MV:VS>۶3:QLj/o=Wb${RVS"u1%mԗ]Ci0S0SczPGP 'T "{X#{IJi&e#%:61RcNQ@㰌!5u?mt73 ITUn)ەsIdE^{shn~3tSΘsL-z}K1r[QAytB/FK"T3;"]dC(ݤ$CYᓉハh Q/HXFt {Wӽw.!Vs֊DSMa[_ۡ`r,WINhۈ2Dsoѩ31Eg0 䊡WF9b A3"z˜=F3h#(3\2Bxe j{L"0Tf^z9sվ& NV5gE*nI;ʟNN򮭆4q|!293ĎvUX%)`qs M0EZ[IEm};N1}t_7nF{7SMyLjBޘV$ܥkBylE,%:㑯gzo;.h|3^|)T$c+M*/nJ?R&#_'7';*Ƭù *[q3*)'\9:QTEfHV*[SV]dbCr2L|:kZBSWb#[Jƞ@fV<ޕ>IPTDD?MSG ʁKXz.W's34Eťʫ6T5(/<qtXX 2aɠlXul]iXqٰvMa :_jEB K}Qaih'gU‹TR(4rMj#ۺ / TkDxO(< qkeW7yRc0Fc|)k =|)! /\b2{0+t5K-r h }AUB@BJy1kO^\7D@:ҝoU~ 4(X+bt@P%zz;M␋x-gn `he")p) v[@WLT;~{MB] OTZ5}؍uaw d Nidbu"YrRb/(r^5f ZƒՆl$MR%OzE'ft dAto˿=[R9ŪnEB62[_ޖ=zq:Pe"ttѰ#8~8p5x]h(jZ{ EF .@\7U;,?E/:/R!vHC֑$}m6sQNhR-lU=iJev֞nK#rš6{ s-cjCl݄ ە=h4 , -$U0(,V"*,H+&BYq?r>r}- -t=QJU^E,4ɳ>bD4(*!zY|"E#joF]MT6e#{R&t?(#Mv+Rƥ]88-8ZHn\tmgp91F<[\TIaf%TQRa" ˍᮔxm_SP#COl"TɀG#,k 0}E-ʥСD`b AF!jKXauTY'YԬu@ʂt]ԗeٿ*bvﲌ!fEuvA9N})A.ZB×#7U}ӹQꋄ'BiYFK^f&Yod {*tLtMp&{g/+A|F_$ {[ٌ 3YKEb>`;4XULW#!f"hfĂf 'dORv3EIeUaH7m_8՘QV%`8%M+5nV,P'@"G@זSvDЍE2 NURŊB!ɔokKҝ;po~ R}i&-tJ!=}U{f7=!hRH &*;HfFVɊK!hʀP@'hĨv"^Uy.Q'9׏*+kU;tsc6Œ .µr&( ҰY|638ëD"RC 2 JSiO}Z1A9&tmzTXN&^e( Jf}[IojS[/W E1$-lz@]Y0*xл!IQ&Sֈ~K{o߈2լ"lg~Y|[̖RIe48;X fKv:iu4i8 sTEωX5qaJ K]夒+ҳIjt}Eg`#p gGZ{Tq@j U.!ŨQ~h9N$cK "V2Cq_1[$N_kOf6XvC]CIWp f B``fvh ?Q)xuRڠUp]KJLܪ~x:+nnopEVЪS6L./zBͪȡx+ixXW!O]9* z;&!*pxA;,"x'c&@Oȯ4$HۨhfUR3 $AvzYxAb  p>W~WJR촺YL9;|q`Xn'%%YDtC*`HVl"HjF ZU(WVl PExx|l.3J,dg薒=*Ȼjّ~ h@Bג֛_T k {Y3ѵJ,19X dr~nςDȯMZ6/0Eh݄"5sc S(M&ـY$atN2Qj˨H-c/jݕJneGck!I(j52Oks^U~&Ohh8cΦ 1r3",qK,iUR B #Cbl[q"1*$C9$GfUur3蟅iFe; N`.,X+ǖe٧~0^ nN}U[ mz`qN~( ἵԓ?`0\C&:}2g胙ux%9Vg(E7vGd (vH̀ct? H-'(N"h!>{: F ' 4 bCzrg9mYl꞉9i!CWff!W$MFX"'52NQ?Ap|W!l,z Iw S&hGBE}>o!cbzZ!#{wZG䍌W4Td [e!]GMt-F7Ōz[,a_ jSR'ЕHOr2D+AY'3,x"xAtmTӬ넾 _>\ v6/dNN):bo&)G."p* 1RV'ڻr-V,_0~HIGaage#*^Kܤ[IN Hɤ3-`FPC:JZuL *bōPYj<񲥷OJ٠PW>J MX]0O,fNk{A]8PdjI0Y=wmUGYrJOYz+:W;Ԗ;-XG(N=ŧumC#Y`1X@pLk{ bw#60%ǑMboW8AN4c|™ Nx m#Ȉ*~rx$su C̆J 9'zp cZu}!)eGvף\"Wە?hAHYI*z46Uh5~"ep R4q}^8=Ks/h"QJ]7H%!6{C+;h=N+!"!]pU?x` H9"fԋSuOl֠y4 ܲMV>P)*Kыy^P̂z^c$E[&_UYDX]qsnD=oBO+mZ'q@mX:k]*Ҥ?9ra5ůE4) crՕBWgVKFW0) SJ΃;6 r\G̎_) Qo!DߙcWǶ*?m|sЩZrk#8=w:(ip;D~Ϯ4\}݂1rЕ"uqݘ w9a}{IVge#E6re+"?=޲Qgc&U(`tҝ̝ 4VF}SSNj:6M_9fNGb5v*t]v fA%y,D=b%cDY&UB ;8;"?o4nPp$E'"b*޷I FE`V~CVIx2 B[(k('fe1tEBAO7]R{/W̋=hH PS̝F S"1wHMgZ(vcv}tQ+fݿ˱^**W7 0ЛD'0;; #:juconRMtBO0ANt<2ש⾤WS7'1_aݠ *^[p 3#7{CZ $ 厸Jyf$W } uu~ NZ'F]wMbW'3nx";K>s3><:$9I/gCb3$ ")+}`c2fT(130cKSӬĻLԺ4SX%Nie)K0a|f)Ҝ$eg$P^1V} CIGn9:|",|p r JRWY~gN+𾇈"7wKmZwxu"ΡaVCe$^~dA%wSͬNWZum+UߜKdrߵ# ݾ*ER\ЍL)uq.9ub Z2E]ѤPN ectK8BZ#l"_T:~BE+|ăg+ 7_*=&jY~ Sn.gY#*&~0Iu"B0 sؠdE8 N/1!ُ36#NkKvVCqY"nBT1=s;93eCW[P޶:ܧDCx8S_HEDbJ~#TJO KzNy?YɁzf4QXkn{a/?]8D]<8 M JNu,M4L @UgzG!4hn [1ǫV Dea>JwFDVdE-Sn"'R1Y v0˘\B],4\6^VJav@+hIH`<:n![HaDOd9[+2:FP׾}T m%z[&"v[LkQ>leY ͍;VNQRxdL+Ry{Kr$"^|(GM !jcs.ICh/ %תJ%Q;!䃣Q%sh<gPW񺲖oLa G^cҹぞَ93*%ۨIXSX#Lk#ՓOƸ-!Aѿ^ĮHoUl11X˝wS5LzuGHן|,%5kD,z*Yap&uRGf+13˜t-[(M’idp@g2<`lBXŠrUcSYE} OɊMbΠu \ (aacs'z?0չQ0宐r؝j F$Fǁ֜}U{zIoF X"#㟮ܬװGWF%Lq`4{}*R$5(ЄoքiUJ0&bm*OF×Dtqx.|MC3D[(YOFT%0Gt$'O9%Mc"~e-1 E7%qY²=ZXq$YuwR6,#V@y2<(IY>Ζ_;bm*8oa C8l6T5Mo{K&N%U+|WN:<|^Vv\YkZ2Dt3 pU&z4  jPP Q+d`J, dOAOҤX-XL8Ď4JJ]kw':쏰JY)..R5uh"QLs^9lN{- QK3UǮu[qݠ0lԄW& *r?jT-ˏh4/Uc!_k EUbٵpWWbPիAёda詢D e0ڴܣ[VwBy?UAjo :|ΔPd+ʐWDР; Vt*sX:oU|VVIwJhIHv3/+U:ͅP?&` fr1LJ|Bs&xɴ qHfV4rw /.đ \GQjոy(ad3.&&TV+1H9RI|QЈ. t5ZOcDDa.:& T-cLE6v=w Ҷ Ql֌]B:O=(Jё Lk\ ~Ϥ,'2!zs o#{\y()3cÒ£-@Dc |X,gؿu͹vL/XGMc=!Πc (:qfViGqYTvN _o{L>M3SZ $RcI_ &Ro2s6Ё:Rc}S."1L웝7Q/ԣ6)Tq] HUOٙAz7p0<3 w5\&v#jzΫ?%7S o61BjLY*GL[z.BLR֮,^ nѸUF>n4|˥SMҎ6`P˥N1i#UxVQyxL"^u3;@U?<U-e&jIAf&Ia# BԜE`}kL(a*$Bi|31͌ݲPp &I*8Em>:x|RoDθiP}QH#](^6W_|R ;E&,> ӊ M  NQ6+ D.oeCT!)܂j j#scW9sb7)DŬqf"i>.1OPSBDckRV1[N0Qz?4Eıp9S|dǚŜ :IaxZ0xt?faBzZO*]#33X)?, A(NǻԞzf*|? ֠:{ Paz"o\=ﾜ!SOk ٚ B -S4l/LVk\p fDN@N&SumKk.~ٙYJEEOe[d2Rȟqn-沫Fo2=EhN,h`N>Nch;س,۬'sw9ƅ`x⼃ ^>2(g'SߺHqv^QdNP:xBDYҵvw!V' nYpeaW6IO?(]V=|PۦD ]\8 :lBߢG^}*{'T6V*z|} x`ueaoKMt.Q d|&/A+*OueB:ľv2U] ,h/ֻo !(M +Wfül@Z(GTˡ*UCTtW*Z=k<8EpdiBiV!ˣ( .AXvOd /-Du'*JBxRZ؉F+*0: ܊"𦉤z;tEЦ#Ҥ5IS2`: \iWڡ"Z.I)!.,E䖑&,=$ 4ruGͅ [{!Z(+Jkuᰈą232GޚzToʨ2=ïTd=~\(s$80h{TȂ'BUo G3zIHDv;ǡt 9E߸l׫VOR̰1)b8E[!v~MLdr)&~D?VVϽ2g%uҰmBH&_J:U>49tnkT|bǩ")!^ c-H%?{Dv Tշ94M vkAV_ndCVXDT+ CǑ=r>7aXa:|ʚl=6 Xx0ݠaOtX5`l{i|hvOol'ӑ@w.dt1*$33$Q2As+e?f#r %@Ɵ 2!SKNVe`z-wyF3h!Fʐ[n)RJG'Q!sӀ"*/7pi3k3@d$Д8K ( zɼ#(ynDoo|urum^&e#H*1#j |p\ ܓH cV.ܭP, L@6dTFcP G EyA$QcCSav ro^_o0GeqiV\:&Ϋ%Kb\qIqφĄ1p|l*_{]N7:*L[MM 4 t gѠto#Z@fKWF={GA: F˙uHüX%OJqdɐМ4:?*Lc5So,bD7 ك͔V.%>1~,~Jؗ":)(io# .Ϝ*=MU' E@:4Y55<OSd9ѫ`"PRay"/Yf;9Kz*P1`ť<,t]MR A1$"Nå(ZOOj ֽS:Ƹl⹨idu F̅L;kdu"T6l>x81h( @"9Ke~My'-B@>͑h6sbEQS5,E쬃DCƸaOr"yH,.,vEZ`d~(hw0ɹC[iRY4p|^!tg-SCM78qlO2͑մ?nz_ tξrfumc G3xG H [5Lـ.p䍗"I௢LKe1lSj u;pQlIn3Il9J5.?@E.dl䪀!q}4R(:끀4L{3Hʙ,,> 'Xױmxv6 2* `Ci;GԬ2w}IȽDƽaD:b]?׋×zqz7{A0M?0iJG Lx: Ih$.8>Ŗa}w?0&xuwhӾT濋с]?9.^,h< >n|; ޢyU}ԜGŋ?|$x47j5~%h|KjG n1DN ŕag WfycYxɓ}nC`^vrWp}b_گtOߙ{m^owey{~XIa/o~00-oUKL}/Oogrckn{V.pq4]OAj~'9I~U}zogu{p45nG:ւ߮o;5Rjp\~[:??w wט#[ wž54Bfh?r^a/\3t]w7w_6^?͝<1ǡ?<4^5*ߚo~Wwߞ]g+vmu)'n6zJq~k;‰?izO6.xAs/6S?Lۃ[sezuߘV3V~=÷ڟO;7/l]+c_>ߛՃ9kWM ^H%s/ߖ?>?|6 grwJceM;Kmy'BdL!`Td^y'[Znp-W_&v(d'/m|6<_KaE:80̙͡q¿gX}|mmyGQ6JվLՇ۸"o>C-EƼ`Nq{wtfӑaq32o++++++++++++++++++Wlgnuchess-4.0.pl70/test/bratko-kopec.tar.z100644 21542 13 3364 5527662453 17337 0ustar cracraftuserd+o8_ai"krRu9'Z1BRa&}+wR7a[ގðB̧S"$u8 1LRfcX̓Ƀގe'=,lBTa߼Ndj+x/k9E|;uUxUk.YK_̕D}{Wvb,jny:t-#㏻hp׺h,,y]%B)Y sBJ.M-2Wi%s4% s-~#!z6/3Ub]5! ~(V;awFߕP҆?cG}gq/ P(sc0+Fÿ pp'g2=nB&6 Y ?:S_5ߨF?u+׭l-:=H'3CQ_YR|G[8- ۉ؏OC9}h'r /6=n/!=na_  APT5+1[Eo3 gI&T,/1g@i Qh5>ZtsWМ)A]W ?TȡIJ_Ewꖬ_K4z7%"=yr ۵6.]{1C"s0fTt?C7S*={l2,o u\ DEn\o?5FM/i`@ rx1Xߘ[@M@,~E &)df!N"wG 9`Ȧ&+8'U@ %1nqO_KlgMGgG3#;=KHR?,SP gCA_'о0`w;56,o^ =r5'@#~?9$gX p&@wlX2O~/a?3v&Q?Oy}D=@+,vF8:?~FߗeKJD ryOq@?7{!3foOIO`;EEn6O{;n#lk:?~oH?7P){1=?_b?~OWy{BR5' wL1$5abX,bX,LQgnuchess-4.0.pl70/RELEASE.70100644 21542 13 232 5567302530 14205 0ustar cracraftuserRelease 70 This release fixes up the pl69 bugs. Changes for HP from Richard Lloyd Patches from Kong Sian and Dr Michael J. White and Dmitry Dakhnovsky gnuchess-4.0.pl70/MAKELOG.HP100644 21542 13 25520 5563712213 14333 0ustar cracraftusercc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DBINBOOK=\"./gnuchess.data\" -c main.c mv main.o mainN.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DBINBOOK=\"./gnuchess.data\" -c book.c mv book.o bookN.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c genmoves.c mv genmoves.o genmovesN.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c ataks.c cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c util.c mv util.o utilN.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c eval.c mv eval.o evalN.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c init.c cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c search.c mv search.o searchN.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c dspcom.c mv dspcom.o dspcomN.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c uxdsp.c cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -o gnuchess mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomN.o uxdsp.o -lcurses -ltermcap -lm cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -c dspcom.c mv dspcom.o dspcomR.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -c nondsp.c mv nondsp.o nondspR.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -o gnuchessr mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomR.o nondspR.o -lm cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c nuxdsp.c cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -o gnuchessn mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o dspcomN.o nuxdsp.o -lcurses -ltermcap -lm cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DBINBOOK=\"./gnuchess.data\" -DXBOARD -c main.c mv main.o mainX.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DXBOARD -DBINBOOK=\"./gnuchess.data\" -c book.c mv book.o bookX.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DXBOARD -c genmoves.c mv genmoves.o genmovesX.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c util.c mv util.o utilX.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c eval.c mv eval.o evalX.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DXBOARD -c search.c mv search.o searchX.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -DXBOARD -c dspcom.c mv dspcom.o dspcomX.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -DXBOARD -c nondsp.c mv nondsp.o nondspX.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -o gnuchessx mainX.o bookX.o genmovesX.o ataks.o utilX.o evalX.o init.o searchX.o dspcomX.o nondspX.o -lm cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DBINBOOK=\"./gnuchess.data\" -DNONDSP -DCHESSTOOL -c main.c mv main.o mainC.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -DCHESSTOOL -DBINBOOK=\"./gnuchess.data\" -c book.c mv book.o bookC.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -DCHESSTOOL -c genmoves.c mv genmoves.o genmovesC.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c util.c mv util.o utilC.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -c eval.c mv eval.o evalC.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -DCHESSTOOL -c search.c mv search.o searchC.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -DCHESSTOOL -c dspcom.c mv dspcom.o dspcomC.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DNONDSP -DCHESSTOOL -c nondsp.c mv nondsp.o nondspC.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -o gnuchessc mainC.o bookC.o genmovesC.o ataks.o utilC.o evalC.o init.o searchC.o dspcomC.o nondspC.o -lm cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -c postprint.c cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -o postprint postprint.o cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -DBINBOOK=\"./gnuchess.data\" -c gnuan.c cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -DHASHFILE=\"./gnuchess.hash\" -DLANGFILE=\"./gnuchess.lang\" -o gnuan mainN.o bookN.o genmovesN.o ataks.o utilN.o evalN.o init.o searchN.o gnuan.o -lm cc -DUSEINT -DCACHE -DGDX -DHASGETTIMEOFDAY -DNULLMOVE -DQUIETBACKGROUND -DSEMIQUIETBOOKGEN -DWAY4PL64 -DHISTORY -DHASHSTATS -DAGING -DKILLT +O3 -Aa -D_HPUX_SOURCE -DSYSV -o game game.c